Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D043403.187ON1201203563e-44
YDL012C3.187ON1071201391e-11
KAFR0C008803.187ON121231235e-09
SAKL0C08008g3.187ON145241193e-08
ZYRO0A04972g3.187ON122251183e-08
Smik_2.1353.187ON127251167e-08
CAGL0I04510g3.187ON116251157e-08
Ecym_52633.187ON1241241158e-08
Skud_2.1283.187ON127231132e-07
Suva_2.1443.187ON119251122e-07
Suva_4.2373.187ON103251112e-07
KLTH0E15840g3.187ON113221113e-07
Kwal_YGOB_Anc_3.1873.187ON112221103e-07
TBLA0B016803.187ON40241053e-07
Klac_YGOB_Anc_3.1873.187ON119221095e-07
Skud_4.2413.187ON106251085e-07
NCAS0I019003.187ON93251051e-06
KNAG0K012853.187ON126251052e-06
CAGL0K01903g3.187ON101251042e-06
AER212W3.187ON11324893e-04
Kpol_1036.513.187ON7925760.014
CAGL0J08349g1.66ON100333661.5
ZYRO0F10802g8.608ON41622615.9
NOTE: 3 genes in the same pillar as TDEL0D04340 were not hit in these BLAST results
LIST: Smik_4.222 TBLA0F00730 YBR016W

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D04340
         (120 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D04340 Chr4 (792565..792609,792675..792992) [363 bp, 120 aa...   141   3e-44
YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp, ...    58   1e-11
KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa...    52   5e-09
SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438...    50   3e-08
ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122 a...    50   3e-08
Smik_2.135 Chr2 (250473..250856) [384 bp, 127 aa] {ON} YBR016W (...    49   7e-08
CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351...    49   7e-08
Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp...    49   8e-08
Skud_2.128 Chr2 (243786..244169) [384 bp, 127 aa] {ON} YBR016W (...    48   2e-07
Suva_2.144 Chr2 (249704..250063) [360 bp, 119 aa] {ON} YBR016W (...    48   2e-07
Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312 b...    47   2e-07
KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp, 1...    47   3e-07
Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273) [3...    47   3e-07
TBLA0B01680 Chr2 complement(375921..376043) [123 bp, 40 aa] {ON}...    45   3e-07
Klac_YGOB_Anc_3.187 Chr3 complement(406964..407278,407429..40747...    47   5e-07
Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321 b...    46   5e-07
NCAS0I01900 Chr9 (349882..350163) [282 bp, 93 aa] {ON} Anc_3.187...    45   1e-06
KNAG0K01285 Chr11 complement(253589..253930,254081..254119) [381...    45   2e-06
CAGL0K01903g Chr11 complement(169669..169974) [306 bp, 101 aa] {...    45   2e-06
AER212W Chr5 (1027712..1027753,1027805..1028104) [342 bp, 113 aa...    39   3e-04
Kpol_1036.51 s1036 (140002..140004,140137..140373) [240 bp, 79 a...    34   0.014
CAGL0J08349g Chr10 complement(829222..832233) [3012 bp, 1003 aa]...    30   1.5  
ZYRO0F10802g Chr6 (882144..883394) [1251 bp, 416 aa] {ON} simila...    28   5.9  

>TDEL0D04340 Chr4 (792565..792609,792675..792992) [363 bp, 120 aa]
           {ON} Anc_3.187 YDL012C
          Length = 120

 Score =  141 bits (356), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 75/120 (62%), Positives = 75/120 (62%)

Query: 1   MSAKEYYSQSETKETYNRPNIPPPGHGKTAGAPNGQYVETQNERGFFSGNXXXXXXXXXX 60
           MSAKEYYSQSETKETYNRPNIPPPGHGKTAGAPNGQYVETQNERGFFSGN          
Sbjct: 1   MSAKEYYSQSETKETYNRPNIPPPGHGKTAGAPNGQYVETQNERGFFSGNQQQPQYYQQQ 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGNQDCLTACLAAMCICCTLDMLF 120
                                              KSGNQDCLTACLAAMCICCTLDMLF
Sbjct: 61  QYQQQQYPPQQYPQYYQQGPPQHQQQPIYVQQQPPKSGNQDCLTACLAAMCICCTLDMLF 120

>YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp, 107
           aa] {ON} Tail-anchored plasma membrane protein
           containing a conserved CYSTM module, possibly involved
           in response to stress; may contribute to non-homologous
           end-joining (NHEJ) based on ydl012c htz1 double null
           phenotype
          Length = 107

 Score = 58.2 bits (139), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 49/120 (40%), Gaps = 13/120 (10%)

Query: 1   MSAKEYYSQSETKETYNRPNIPPPGHGKTAGAPNGQYVETQNERGFFSGNXXXXXXXXXX 60
           MSA++YY  S +K++Y+RP+ PPPG+            ET + RG+              
Sbjct: 1   MSAQDYYGNSASKQSYSRPSAPPPGY------------ETAS-RGYAPSQSQQNYYPPQQ 47

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGNQDCLTACLAAMCICCTLDMLF 120
                                               SGN+DCL  CLA +C+CCTLDMLF
Sbjct: 48  QQQQYQQQPQYYQQQQPQYYQQHPQQPIYVQQQPASSGNEDCLAGCLAGLCLCCTLDMLF 107

>KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa]
           {ON} Anc_3.187 YDL012C
          Length = 121

 Score = 52.0 bits (123), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 22/23 (95%), Positives = 23/23 (100%)

Query: 98  GNQDCLTACLAAMCICCTLDMLF 120
           GN+DCLTACLAAMCICCTLDMLF
Sbjct: 99  GNEDCLTACLAAMCICCTLDMLF 121

 Score = 33.1 bits (74), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 18/24 (75%), Gaps = 2/24 (8%)

Query: 1  MSAKEYYSQSETKETYNRPNIPPP 24
          MSA+EYY   +TK  YNRP+ PPP
Sbjct: 1  MSAREYYG--DTKTQYNRPSAPPP 22

>SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438
           bp, 145 aa] {ON} similar to uniprot|Q12489 Saccharomyces
           cerevisiae YDL012C Plasma membrane protein of unknown
           function
          Length = 145

 Score = 50.4 bits (119), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 21/24 (87%), Positives = 22/24 (91%)

Query: 97  SGNQDCLTACLAAMCICCTLDMLF 120
           S NQDCLTACLA MC+CCTLDMLF
Sbjct: 122 SNNQDCLTACLAGMCLCCTLDMLF 145

 Score = 27.3 bits (59), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 2/26 (7%)

Query: 1  MSAKEYYS--QSETKETYNRPNIPPP 24
          MSA +YYS   +++K+TY RP   PP
Sbjct: 29 MSAADYYSGAAADSKQTYQRPTGAPP 54

>ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122 aa]
           {ON} weakly similar to uniprot|P38216 Saccharomyces
           cerevisiae YBR016W
          Length = 122

 Score = 50.1 bits (118), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%)

Query: 96  KSGNQDCLTACLAAMCICCTLDMLF 120
           + GN+DCLTACLA +C+CCTLDMLF
Sbjct: 98  QRGNEDCLTACLAVLCVCCTLDMLF 122

 Score = 30.0 bits (66), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 1  MSAKEYYSQSETKETYNRPNIPPPGHGKTAGA 32
          MSA+EYY   ++K +Y+RP  PPP      GA
Sbjct: 1  MSAQEYYG--DSKASYSRPQGPPPSSDYYGGA 30

>Smik_2.135 Chr2 (250473..250856) [384 bp, 127 aa] {ON} YBR016W
           (REAL)
          Length = 127

 Score = 49.3 bits (116), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%)

Query: 96  KSGNQDCLTACLAAMCICCTLDMLF 120
           + GN+ C+TACLAA+CICCT+DMLF
Sbjct: 103 QKGNEGCITACLAALCICCTMDMLF 127

>CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351
           bp, 116 aa] {ON} similar to uniprot|P38216 Saccharomyces
           cerevisiae YBR016w and similar to uniprot|Q12489
           Saccharomyces cerevisiae YDL012c
          Length = 116

 Score = 48.9 bits (115), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%)

Query: 96  KSGNQDCLTACLAAMCICCTLDMLF 120
           + GN DC+TACLAA+CICCTLD+LF
Sbjct: 92  QRGNDDCMTACLAALCICCTLDLLF 116

 Score = 33.9 bits (76), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 1  MSAKEYYSQS-ETKETYNRPNIPPPGHGKTAGAPNG 35
          MSA+EYY+ + ++K+ Y+RP  PPP  G+   +  G
Sbjct: 1  MSAQEYYNGAGDSKQQYSRPTAPPPSQGQGKDSSRG 36

>Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp,
           124 aa] {ON} similar to Ashbya gossypii AER212W
          Length = 124

 Score = 48.9 bits (115), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 44/124 (35%), Gaps = 4/124 (3%)

Query: 1   MSAKEYYSQSETKETYNRPNIPPPGHGKTAGAPNG---QYVETQNERGFFSGNXXXXXXX 57
           MSA +YY   + K+++NRP+ PPP    T G   G   QY E Q       G        
Sbjct: 1   MSAADYYGTGDNKQSFNRPSAPPPNQSGTYGDTRGYEQQYYEPQKAYYQQPGPGVQPGPQ 60

Query: 58  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSGNQD-CLTACLAAMCICCTL 116
                                                     +D CL ACLA  C+CCTL
Sbjct: 61  QGYPQQGYPQQGYAQQGHPPQQGYYGGQPQQPIYVQQQPESKKDSCLMACLAGACLCCTL 120

Query: 117 DMLF 120
           DMLF
Sbjct: 121 DMLF 124

>Skud_2.128 Chr2 (243786..244169) [384 bp, 127 aa] {ON} YBR016W
           (REAL)
          Length = 127

 Score = 48.1 bits (113), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (95%)

Query: 98  GNQDCLTACLAAMCICCTLDMLF 120
           GN+ C+TACLAA+CICCT+DMLF
Sbjct: 105 GNEGCITACLAALCICCTMDMLF 127

>Suva_2.144 Chr2 (249704..250063) [360 bp, 119 aa] {ON} YBR016W
           (REAL)
          Length = 119

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%)

Query: 96  KSGNQDCLTACLAAMCICCTLDMLF 120
           K GN+ C+TACLAA+CICCT+DMLF
Sbjct: 95  KKGNEGCMTACLAALCICCTMDMLF 119

>Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312 bp,
           103 aa] {ON} YDL012C (REAL)
          Length = 103

 Score = 47.4 bits (111), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 21/25 (84%)

Query: 96  KSGNQDCLTACLAAMCICCTLDMLF 120
            SGNQDCLT CLA +C+CCTLDML 
Sbjct: 79  SSGNQDCLTGCLAGLCLCCTLDMLI 103

 Score = 35.0 bits (79), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 1  MSAKEYYSQSETKETYNRPNIPPPGH 26
          MSA++YY  S  K++Y+ P  PPPG+
Sbjct: 1  MSAQDYYGNSAYKQSYSHPTAPPPGY 26

>KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp, 113
           aa] {ON} similar to uniprot|Q12489 Saccharomyces
           cerevisiae YDL012C Plasma membrane protein of unknown
           function
          Length = 113

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (90%)

Query: 99  NQDCLTACLAAMCICCTLDMLF 120
           N DCLTACLA MC+CCTLDMLF
Sbjct: 92  NSDCLTACLAGMCLCCTLDMLF 113

>Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273) [339
           bp, 112 aa] {ON} ANNOTATED BY YGOB -
          Length = 112

 Score = 47.0 bits (110), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (90%)

Query: 99  NQDCLTACLAAMCICCTLDMLF 120
           N DCLTACLA MC+CCTLDMLF
Sbjct: 91  NSDCLTACLAGMCLCCTLDMLF 112

 Score = 29.3 bits (64), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%)

Query: 1  MSAKEYYS-QSETKETYNRPNIPPPGH 26
          MSA EYY   S+ ++ Y  P+ PPPGH
Sbjct: 1  MSAAEYYKGTSQPQQQYTSPSGPPPGH 27

>TBLA0B01680 Chr2 complement(375921..376043) [123 bp, 40 aa] {ON}
           Anc_3.187 YDL012C
          Length = 40

 Score = 45.1 bits (105), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (91%)

Query: 97  SGNQDCLTACLAAMCICCTLDMLF 120
           S N DC+TACLAA+C+CCTLDMLF
Sbjct: 17  SNNDDCMTACLAALCVCCTLDMLF 40

>Klac_YGOB_Anc_3.187 Chr3 complement(406964..407278,407429..407473)
           [360 bp, 119 aa] {ON} ANNOTATED BY YGOB -
          Length = 119

 Score = 46.6 bits (109), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (90%)

Query: 99  NQDCLTACLAAMCICCTLDMLF 120
           N DCLTACLA MC+CCTLDMLF
Sbjct: 98  NSDCLTACLAGMCLCCTLDMLF 119

 Score = 36.6 bits (83), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 7/49 (14%)

Query: 1  MSAKEYYSQSETKETYNRPNIPPPGHGKTAGAPNGQYVETQNERGFFSG 49
          MSA EYY     +  YNRP   P   G+ + A + Q       RGFFS 
Sbjct: 1  MSAAEYYGTDNKQTVYNRPTGAPTTQGQASAADDSQ-------RGFFSA 42

>Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321 bp,
           106 aa] {ON} YDL012C (REAL)
          Length = 106

 Score = 46.2 bits (108), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%)

Query: 96  KSGNQDCLTACLAAMCICCTLDMLF 120
            +GN DCLT CLA +C+CCTLDMLF
Sbjct: 82  STGNGDCLTGCLAGLCLCCTLDMLF 106

 Score = 38.1 bits (87), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 1  MSAKEYYSQSETKETYNRPNIPPPGH 26
          MSA++YY  S +K++Y+RP  PPPG+
Sbjct: 1  MSAQDYYGNSTSKQSYSRPTAPPPGY 26

>NCAS0I01900 Chr9 (349882..350163) [282 bp, 93 aa] {ON} Anc_3.187
           YBR016W
          Length = 93

 Score = 45.1 bits (105), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%)

Query: 96  KSGNQDCLTACLAAMCICCTLDMLF 120
           + GN+DCLT CLA +CICCTLDML 
Sbjct: 69  QRGNEDCLTGCLAGLCICCTLDMLM 93

>KNAG0K01285 Chr11 complement(253589..253930,254081..254119) [381
           bp, 126 aa] {ON}
          Length = 126

 Score = 45.1 bits (105), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 22/25 (88%)

Query: 96  KSGNQDCLTACLAAMCICCTLDMLF 120
           + GN DC+TACLAA+C+CC ++M+F
Sbjct: 102 QRGNDDCMTACLAALCVCCAMNMIF 126

>CAGL0K01903g Chr11 complement(169669..169974) [306 bp, 101 aa] {ON}
           no similarity
          Length = 101

 Score = 44.7 bits (104), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%)

Query: 96  KSGNQDCLTACLAAMCICCTLDMLF 120
           ++GN+DCL ACLAAMCIC TLD+L 
Sbjct: 77  QNGNEDCLMACLAAMCICLTLDLLI 101

>AER212W Chr5 (1027712..1027753,1027805..1028104) [342 bp, 113 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL012C and YBR016W; 1-intron
          Length = 113

 Score = 38.9 bits (89), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 17/24 (70%)

Query: 97  SGNQDCLTACLAAMCICCTLDMLF 120
           S N  CL ACL  MC+C TLDMLF
Sbjct: 90  SKNDSCLVACLGGMCLCYTLDMLF 113

>Kpol_1036.51 s1036 (140002..140004,140137..140373) [240 bp, 79 aa]
           {ON} (140002..140004,140137..140373) [240 nt, 80 aa]
          Length = 79

 Score = 33.9 bits (76), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%)

Query: 96  KSGNQDCLTACLAAMCICCTLDMLF 120
           + GN+DC+TACLAA+C+  TL++  
Sbjct: 55  QRGNEDCMTACLAALCVLFTLNLFI 79

>CAGL0J08349g Chr10 complement(829222..832233) [3012 bp, 1003 aa]
           {ON} similar to uniprot|P53836 Saccharomyces cerevisiae
           YNL278w CAF120 and similar to uniprot|Q06315
           Saccharomyces cerevisiae YLR187w
          Length = 1003

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 18  RPNI-PPPGHGKTAGAPNGQYVETQNERGFFSG 49
           RPN+  PP  G   GAP+G YV   N+ G+ +G
Sbjct: 789 RPNMHTPPPQGVRTGAPSGSYVSPNNKMGYANG 821

>ZYRO0F10802g Chr6 (882144..883394) [1251 bp, 416 aa] {ON} similar
          to uniprot|Q08601 Saccharomyces cerevisiae YOR197W MCA1
          Putative cysteine protease similar to mammalian
          caspases
          Length = 416

 Score = 28.1 bits (61), Expect = 5.9,   Method: Composition-based stats.
 Identities = 12/22 (54%), Positives = 16/22 (72%), Gaps = 2/22 (9%)

Query: 16 YNRPNIPPPGHGKTAGAPNGQY 37
          Y+RP +PPP  G+TAG  +G Y
Sbjct: 38 YSRPAVPPP--GRTAGNRDGGY 57

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,544,613
Number of extensions: 219158
Number of successful extensions: 724
Number of sequences better than 10.0: 31
Number of HSP's gapped: 722
Number of HSP's successfully gapped: 47
Length of query: 120
Length of database: 53,481,399
Length adjustment: 89
Effective length of query: 31
Effective length of database: 43,276,125
Effective search space: 1341559875
Effective search space used: 1341559875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)