Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D043303.188ON59859831420.0
SAKL0C10472g3.188ON60861318880.0
ZYRO0A04950g3.188ON61851718800.0
KLTH0G16038g3.188ON60961218700.0
KAFR0C008703.188ON61259018090.0
Kwal_56.231173.188ON60760817870.0
Suva_2.1423.188ON60360217710.0
YBR015C (MNN2)3.188ON59759717660.0
Smik_2.1343.188ON59759917390.0
TBLA0F007403.188ON65351917280.0
Skud_2.1273.188ON59659717050.0
TPHA0A043803.188ON64258716390.0
NCAS0E015903.188ON60862316240.0
KNAG0K012903.188ON61152615900.0
CAGL0I04532g3.188ON61252615880.0
KLLA0E17755g3.188ON63852615860.0
NCAS0A03650singletonON60756015470.0
Ecym_53143.188ON61551515290.0
Kpol_1036.503.188ON67654415330.0
NDAI0G017903.188ON60757715250.0
TPHA0C04560singletonON57353314940.0
AER018C3.188ON60651014190.0
Kpol_1045.703.188ON61751613890.0
KNAG0K01300singletonON59758313660.0
KAFR0E01030singletonON64051613660.0
NDAI0A065003.188ON63751613081e-173
KAFR0G002801.150ON57953510271e-132
Kwal_33.136931.150ON55853710211e-131
NDAI0A007801.150ON58753510161e-130
NCAS0B084501.150ON58654010081e-129
SAKL0C04598g1.150ON61155810031e-128
TBLA0D030301.150ON6055439981e-127
KLTH0F03938g1.150ON5625329641e-123
AEL148W1.150ON5735269321e-118
Skud_10.311.150ON5865539281e-117
YJL186W (MNN5)1.150ON5865569191e-116
Kpol_2002.571.150ON6055669121e-114
Ecym_81281.150ON5925379071e-114
TPHA0E034801.150ON7095459021e-112
CAGL0M02871g1.150ON6005148881e-111
ZYRO0D17160g1.150ON5795388851e-111
TBLA0J011901.150ON6165638821e-110
SAKL0H22616gsingletonON7415818911e-110
KNAG0C009001.150ON6235258641e-107
Suva_6.2661.150ON5865148541e-106
TDEL0C03020na 1ON6605768581e-106
KLLA0C16467g1.150ON6075388501e-105
Smik_10.461.150ON5864878471e-105
ZYRO0F13244gna 1ON6645878241e-101
KLLA0F24574gna 2ON7116137893e-95
TBLA0A002703.188ON9575707861e-92
Kwal_56.22779na 2ON6956107011e-82
SAKL0C08888gna 2ON6796116974e-82
KLTH0C08976gna 2ON7026056984e-82
Ecym_3545na 2ON6705986125e-70
CAGL0L08096g1.150ON5645415602e-63
AEL082Wna 2ON6815995154e-56
CAGL0C03938gsingletonON6373061502e-09
TDEL0B00160singletonON5623031457e-09
CAGL0C04004gsingletonON6322631422e-08
AEL345WsingletonON6452581368e-08
TBLA0G03680singletonON7512781369e-08
Kwal_23.2926na 3ON5682361323e-07
NDAI0A085507.123ON6642851304e-07
NDAI0H012707.123ON6562841305e-07
CAGL0C03960gsingletonON6232771297e-07
Suva_5.322na 4ON5532481287e-07
CAGL0C03982gsingletonON6291371261e-06
NCAS0F007807.123ON6392731252e-06
Kpol_298.4singletonON6312631242e-06
CAGL0C03916gsingletonON6282811242e-06
KNAG0D05360singletonON5332781233e-06
KNAG0G01070singletonON6323291215e-06
AFL235WsingletonON3812511188e-06
CAGL0C03894g7.123ON6272571191e-05
Smik_9.1807.123ON6302641162e-05
KNAG0G010607.123ON6942271153e-05
TBLA0A00640singletonON7471471153e-05
ABR245CsingletonON6411291143e-05
KAFR0K012407.123ON6661321119e-05
KLLA0E09813gsingletonON7462881101e-04
KAFR0K01260singletonON6281351091e-04
NCAS0I004807.123ON6572561082e-04
YGL257C (MNT2)na 4ON5582681063e-04
Kwal_55.209847.123ON6191331063e-04
Smik_7.4na 4ON5623121064e-04
TDEL0F05640singletonON5542911054e-04
TBLA0C06250singletonON7363011030.001
TBLA0H00130singletonON6871451020.001
Kwal_23.5454singletonON5832901010.001
TBLA0A011607.123ON6631401010.001
Kpol_1015.13singletonON7432451010.002
SAKL0D15180gsingletonON5771341000.002
Skud_7.10na 4ON566188990.002
CAGL0C04026gsingletonON636136990.002
YNR059W (MNT4)na 5ON580258990.002
KNAG0E03170singletonON746279990.002
Suva_9.1917.123ON625130990.003
KNAG0J02990singletonON644266980.003
KNAG0D03070singletonON650279970.004
YER001W (MNN1)na 6ON762286970.005
Smik_14.393na 5ON580231960.005
YIL014W (MNT3)7.123ON630257960.005
KLTH0F13486g7.123ON623127950.007
TPHA0L008207.123ON730275940.009
CAGL0C04048gsingletonON620131930.014
TPHA0F00130singletonON758205930.014
Smik_5.115na 6ON762200920.015
CAGL0G04279gsingletonON660134920.016
CAGL0H09262gsingletonON625274920.018
Suva_14.418na 5ON580237910.019
CAGL0H09240gsingletonON642247910.020
Skud_14.395na 5ON580252910.024
ZYRO0G04048g7.123ON641181900.028
TPHA0H00240singletonON829213900.030
Kpol_1057.22singletonON764206890.042
Skud_5.100na 6ON762283880.045
AAR183CsingletonON648136860.076
TDEL0H032607.123ON641130860.083
Suva_5.87na 6ON766144850.11
KLTH0G19690gsingletonON588195840.14
Skud_9.1587.123ON629175820.26
YMR264W (CUE1)8.816ON203102780.39
Suva_13.4488.816ON204102780.45
KLLA0D13376gna 7ON663205790.64
KLTH0H07964gna 8ON721240771.1
TPHA0F00700singletonON856193733.4
Kpol_2001.81.212ON548117723.7
KAFR0B008005.328ON675185715.3
NCAS0B039208.248ON120834707.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D04330
         (598 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D04330 Chr4 complement(790232..792028) [1797 bp, 598 aa] {O...  1214   0.0  
SAKL0C10472g Chr3 (953238..955064) [1827 bp, 608 aa] {ON} simila...   731   0.0  
ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {...   728   0.0  
KLTH0G16038g Chr7 (1404292..1406121) [1830 bp, 609 aa] {ON} simi...   724   0.0  
KAFR0C00870 Chr3 complement(175651..177489) [1839 bp, 612 aa] {O...   701   0.0  
Kwal_56.23117 s56 complement(407699..409522) [1824 bp, 607 aa] {...   692   0.0  
Suva_2.142 Chr2 complement(246653..248464) [1812 bp, 603 aa] {ON...   686   0.0  
YBR015C Chr2 complement(267710..269503) [1794 bp, 597 aa] {ON}  ...   684   0.0  
Smik_2.134 Chr2 complement(247923..249716) [1794 bp, 597 aa] {ON...   674   0.0  
TBLA0F00740 Chr6 (187874..189835) [1962 bp, 653 aa] {ON} Anc_3.1...   670   0.0  
Skud_2.127 Chr2 complement(241232..243022) [1791 bp, 596 aa] {ON...   661   0.0  
TPHA0A04380 Chr1 (982546..984474) [1929 bp, 642 aa] {ON} Anc_3.1...   635   0.0  
NCAS0E01590 Chr5 (302992..304818) [1827 bp, 608 aa] {ON} Anc_3.188    630   0.0  
KNAG0K01290 Chr11 (254881..256716) [1836 bp, 611 aa] {ON}             617   0.0  
CAGL0I04532g Chr9 (404659..406497) [1839 bp, 612 aa] {ON} simila...   616   0.0  
KLLA0E17755g Chr5 complement(1572985..1574901) [1917 bp, 638 aa]...   615   0.0  
NCAS0A03650 Chr1 complement(729502..731325) [1824 bp, 607 aa] {O...   600   0.0  
Ecym_5314 Chr5 complement(634571..636418) [1848 bp, 615 aa] {ON}...   593   0.0  
Kpol_1036.50 s1036 complement(135897..137927) [2031 bp, 676 aa] ...   595   0.0  
NDAI0G01790 Chr7 (392941..394764) [1824 bp, 607 aa] {ON} Anc_3.188    592   0.0  
TPHA0C04560 Chr3 (983249..984970) [1722 bp, 573 aa] {ON}              580   0.0  
AER018C Chr5 complement(661035..662855) [1821 bp, 606 aa] {ON} S...   551   0.0  
Kpol_1045.70 s1045 complement(162608..164461) [1854 bp, 617 aa] ...   539   0.0  
KNAG0K01300 Chr11 (257271..259064) [1794 bp, 597 aa] {ON}             530   0.0  
KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON}              530   0.0  
NDAI0A06500 Chr1 complement(1475305..1477218) [1914 bp, 637 aa] ...   508   e-173
KAFR0G00280 Chr7 (92838..94577) [1740 bp, 579 aa] {ON} Anc_1.150...   400   e-132
Kwal_33.13693 s33 (354321..355997) [1677 bp, 558 aa] {ON} YJL186...   397   e-131
NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150    395   e-130
NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa] ...   392   e-129
SAKL0C04598g Chr3 (447448..449283) [1836 bp, 611 aa] {ON} simila...   390   e-128
TBLA0D03030 Chr4 complement(734007..735824) [1818 bp, 605 aa] {O...   389   e-127
KLTH0F03938g Chr6 (351536..353224) [1689 bp, 562 aa] {ON} simila...   375   e-123
AEL148W Chr5 (351089..352810) [1722 bp, 573 aa] {ON} Syntenic ho...   363   e-118
Skud_10.31 Chr10 (54975..56735) [1761 bp, 586 aa] {ON} YJL186W (...   362   e-117
YJL186W Chr10 (80155..81915) [1761 bp, 586 aa] {ON}  MNN5Alpha-1...   358   e-116
Kpol_2002.57 s2002 (129140..130957) [1818 bp, 605 aa] {ON} (1291...   355   e-114
Ecym_8128 Chr8 complement(266920..268698) [1779 bp, 592 aa] {ON}...   353   e-114
TPHA0E03480 Chr5 complement(735664..737793) [2130 bp, 709 aa] {O...   352   e-112
CAGL0M02871g Chr13 (324009..325811) [1803 bp, 600 aa] {ON} simil...   346   e-111
ZYRO0D17160g Chr4 complement(1417469..1419208) [1740 bp, 579 aa]...   345   e-111
TBLA0J01190 Chr10 complement(267291..269141) [1851 bp, 616 aa] {...   344   e-110
SAKL0H22616g Chr8 complement(1966196..1968421) [2226 bp, 741 aa]...   347   e-110
KNAG0C00900 Chr3 (167471..169342) [1872 bp, 623 aa] {ON} Anc_1.1...   337   e-107
Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON...   333   e-106
TDEL0C03020 Chr3 (537820..539802) [1983 bp, 660 aa] {ON}              335   e-106
KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} simi...   332   e-105
Smik_10.46 Chr10 (78173..79933) [1761 bp, 586 aa] {ON} YJL186W (...   330   e-105
ZYRO0F13244g Chr6 (1084412..1086406) [1995 bp, 664 aa] {ON} simi...   322   e-101
KLLA0F24574g Chr6 complement(2285387..2287522) [2136 bp, 711 aa]...   308   3e-95
TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}...   307   1e-92
Kwal_56.22779 s56 complement(277096..279183) [2088 bp, 695 aa] {...   274   1e-82
SAKL0C08888g Chr3 (814687..816726) [2040 bp, 679 aa] {ON} weakly...   273   4e-82
KLTH0C08976g Chr3 (751731..753839) [2109 bp, 702 aa] {ON} weakly...   273   4e-82
Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {O...   240   5e-70
CAGL0L08096g Chr12 complement(886827..888521) [1695 bp, 564 aa] ...   220   2e-63
AEL082W Chr5 (474072..476117) [2046 bp, 681 aa] {ON} Non-synteni...   202   4e-56
CAGL0C03938g Chr3 complement(386673..388586) [1914 bp, 637 aa] {...    62   2e-09
TDEL0B00160 Chr2 (29809..31497) [1689 bp, 562 aa] {ON}                 60   7e-09
CAGL0C04004g Chr3 complement(394614..396512) [1899 bp, 632 aa] {...    59   2e-08
AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic ho...    57   8e-08
TBLA0G03680 Chr7 complement(975688..977943) [2256 bp, 751 aa] {O...    57   9e-08
Kwal_23.2926 s23 complement(78806..80512) [1707 bp, 568 aa] {ON}...    55   3e-07
NDAI0A08550 Chr1 complement(1967085..1969079) [1995 bp, 664 aa] ...    55   4e-07
NDAI0H01270 Chr8 (306136..308106) [1971 bp, 656 aa] {ON} Anc_7.123     55   5e-07
CAGL0C03960g Chr3 complement(389250..391121) [1872 bp, 623 aa] {...    54   7e-07
Suva_5.322 Chr5 (525925..527586) [1662 bp, 553 aa] {ON} YGL257C ...    54   7e-07
CAGL0C03982g Chr3 complement(391909..393798) [1890 bp, 629 aa] {...    53   1e-06
NCAS0F00780 Chr6 (156307..158226) [1920 bp, 639 aa] {ON} Anc_7.123     53   2e-06
Kpol_298.4 s298 (12426..14321) [1896 bp, 631 aa] {ON} (12426..14...    52   2e-06
CAGL0C03916g Chr3 complement(383989..385875) [1887 bp, 628 aa] {...    52   2e-06
KNAG0D05360 Chr4 (981032..982633) [1602 bp, 533 aa] {ON}               52   3e-06
KNAG0G01070 Chr7 complement(232251..234149) [1899 bp, 632 aa] {O...    51   5e-06
AFL235W Chr6 (2..1147) [1146 bp, 381 aa] {ON} Non-syntenic homol...    50   8e-06
CAGL0C03894g Chr3 complement(381514..383397) [1884 bp, 627 aa] {...    50   1e-05
Smik_9.180 Chr9 (300789..302681) [1893 bp, 630 aa] {ON} YIL014W ...    49   2e-05
KNAG0G01060 Chr7 complement(228987..231071) [2085 bp, 694 aa] {O...    49   3e-05
TBLA0A00640 Chr1 (128803..131046) [2244 bp, 747 aa] {ON}               49   3e-05
ABR245C Chr2 complement(854587..856512) [1926 bp, 641 aa] {ON} N...    49   3e-05
KAFR0K01240 Chr11 complement(258683..260683) [2001 bp, 666 aa] {...    47   9e-05
KLLA0E09813g Chr5 (867899..870139) [2241 bp, 746 aa] {ON} simila...    47   1e-04
KAFR0K01260 Chr11 complement(261190..263076) [1887 bp, 628 aa] {...    47   1e-04
NCAS0I00480 Chr9 (77950..79923) [1974 bp, 657 aa] {ON}                 46   2e-04
YGL257C Chr7 complement(12481..14157) [1677 bp, 558 aa] {ON}  MN...    45   3e-04
Kwal_55.20984 s55 complement(634833..636692) [1860 bp, 619 aa] {...    45   3e-04
Smik_7.4 Chr7 complement(8045..9733) [1689 bp, 562 aa] {ON} YGL2...    45   4e-04
TDEL0F05640 Chr6 complement(1055778..1057442) [1665 bp, 554 aa] ...    45   4e-04
TBLA0C06250 Chr3 (1512916..1515126) [2211 bp, 736 aa] {ON}             44   0.001
TBLA0H00130 Chr8 complement(8943..11006) [2064 bp, 687 aa] {ON}        44   0.001
Kwal_23.5454 s23 (1171360..1173111) [1752 bp, 583 aa] {ON} YGL25...    44   0.001
TBLA0A01160 Chr1 complement(267341..269332) [1992 bp, 663 aa] {O...    44   0.001
Kpol_1015.13 s1015 complement(31451..33682) [2232 bp, 743 aa] {O...    44   0.002
SAKL0D15180g Chr4 complement(1259592..1261325) [1734 bp, 577 aa]...    43   0.002
Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON} Y...    43   0.002
CAGL0C04026g Chr3 complement(397303..399213) [1911 bp, 636 aa] {...    43   0.002
YNR059W Chr14 (736803..738545) [1743 bp, 580 aa] {ON}  MNT4Putat...    43   0.002
KNAG0E03170 Chr5 complement(632635..634875) [2241 bp, 746 aa] {O...    43   0.002
Suva_9.191 Chr9 (314586..316463) [1878 bp, 625 aa] {ON} YIL014W ...    43   0.003
KNAG0J02990 Chr10 (576491..578425) [1935 bp, 644 aa] {ON}              42   0.003
KNAG0D03070 Chr4 (552018..553970) [1953 bp, 650 aa] {ON}               42   0.004
YER001W Chr5 (153520..155808) [2289 bp, 762 aa] {ON}  MNN1Alpha-...    42   0.005
Smik_14.393 Chr14 (693641..695383) [1743 bp, 580 aa] {ON} YNR059...    42   0.005
YIL014W Chr9 (326103..327995) [1893 bp, 630 aa] {ON}  MNT3Alpha-...    42   0.005
KLTH0F13486g Chr6 complement(1108786..1110657) [1872 bp, 623 aa]...    41   0.007
TPHA0L00820 Chr12 complement(162210..164402) [2193 bp, 730 aa] {...    41   0.009
CAGL0C04048g Chr3 complement(399734..401596) [1863 bp, 620 aa] {...    40   0.014
TPHA0F00130 Chr6 (14360..16636) [2277 bp, 758 aa] {ON}                 40   0.014
Smik_5.115 Chr5 (157563..159851) [2289 bp, 762 aa] {ON} YER001W ...    40   0.015
CAGL0G04279g Chr7 complement(404144..406126) [1983 bp, 660 aa] {...    40   0.016
CAGL0H09262g Chr8 complement(908258..910135) [1878 bp, 625 aa] {...    40   0.018
Suva_14.418 Chr14 (721586..723328) [1743 bp, 580 aa] {ON} YNR059...    40   0.019
CAGL0H09240g Chr8 complement(905670..907598) [1929 bp, 642 aa] {...    40   0.020
Skud_14.395 Chr14 (704847..706589) [1743 bp, 580 aa] {ON} YNR059...    40   0.024
ZYRO0G04048g Chr7 complement(328792..330717) [1926 bp, 641 aa] {...    39   0.028
TPHA0H00240 Chr8 (40339..42828) [2490 bp, 829 aa] {ON}                 39   0.030
Kpol_1057.22 s1057 complement(42104..44398) [2295 bp, 764 aa] {O...    39   0.042
Skud_5.100 Chr5 (150236..152524) [2289 bp, 762 aa] {ON} YER001W ...    39   0.045
AAR183C Chr1 complement(672091..674037) [1947 bp, 648 aa] {ON} N...    38   0.076
TDEL0H03260 Chr8 complement(542810..544735) [1926 bp, 641 aa] {O...    38   0.083
Suva_5.87 Chr5 (129322..131622) [2301 bp, 766 aa] {ON} YER001W (...    37   0.11 
KLTH0G19690g Chr7 complement(1704559..1706325) [1767 bp, 588 aa]...    37   0.14 
Skud_9.158 Chr9 (296090..297979) [1890 bp, 629 aa] {ON} YIL014W ...    36   0.26 
YMR264W Chr13 (795805..796416) [612 bp, 203 aa] {ON}  CUE1Endopl...    35   0.39 
Suva_13.448 Chr13 (775127..775741) [615 bp, 204 aa] {ON} YMR264W...    35   0.45 
KLLA0D13376g Chr4 (1150858..1152849) [1992 bp, 663 aa] {ON} simi...    35   0.64 
KLTH0H07964g Chr8 complement(698453..700618) [2166 bp, 721 aa] {...    34   1.1  
TPHA0F00700 Chr6 (158182..160752) [2571 bp, 856 aa] {ON}               33   3.4  
Kpol_2001.8 s2001 (24348..25994) [1647 bp, 548 aa] {ON} (24348.....    32   3.7  
KAFR0B00800 Chr2 complement(152478..154505) [2028 bp, 675 aa] {O...    32   5.3  
NCAS0B03920 Chr2 (699812..703438) [3627 bp, 1208 aa] {ON} Anc_8....    32   7.7  

>TDEL0D04330 Chr4 complement(790232..792028) [1797 bp, 598 aa] {ON}
           Anc_3.188 YBR015C
          Length = 598

 Score = 1214 bits (3142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/598 (97%), Positives = 583/598 (97%)

Query: 1   MALITKRYRXXXXXXXXXXXXXXXFIATSRFMDEGLSVSEYQDYIKSYLGNAQPADTISR 60
           MALITKRYR               FIATSRFMDEGLSVSEYQDYIKSYLGNAQPADTISR
Sbjct: 1   MALITKRYRKALKLATVVLVLCVTFIATSRFMDEGLSVSEYQDYIKSYLGNAQPADTISR 60

Query: 61  NPAVDVGLNAGREPIANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFR 120
           NPAVDVGLNAGREPIANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFR
Sbjct: 61  NPAVDVGLNAGREPIANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFR 120

Query: 121 PENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGG 180
           PENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGG
Sbjct: 121 PENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGG 180

Query: 181 GKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPS 240
           GKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPS
Sbjct: 181 GKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPS 240

Query: 241 LKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRR 300
           LKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRR
Sbjct: 241 LKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRR 300

Query: 301 TTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESG 360
           TTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESG
Sbjct: 301 TTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESG 360

Query: 361 QLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKS 420
           QLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKS
Sbjct: 361 QLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKS 420

Query: 421 ATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEF 480
           ATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEF
Sbjct: 421 ATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEF 480

Query: 481 YKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDL 540
           YKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDL
Sbjct: 481 YKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDL 540

Query: 541 ELENFKAINEYVCVKRTNVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVSPSK 598
           ELENFKAINEYVCVKRTNVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVSPSK
Sbjct: 541 ELENFKAINEYVCVKRTNVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVSPSK 598

>SAKL0C10472g Chr3 (953238..955064) [1827 bp, 608 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 608

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/613 (56%), Positives = 445/613 (72%), Gaps = 25/613 (4%)

Query: 1   MALITKRYRXXXXXXXXXXXXXXXFIATSRFMDEGLSVSEYQDYIKSYL-----GNAQPA 55
           M L+TKR+                FI T++++ + L V EY+ Y+++Y+     G+  P 
Sbjct: 1   MVLLTKRFAKVFKLAAITTLCCLLFILTNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPP 60

Query: 56  DTI--------SRNPAVDVGLNAGREPIANGG---NAKLKKFYEQVFEDLKNYSPSSKSA 104
             +         R P  DV     R+P +        KL+ FY QVF+ L  YSP  KS 
Sbjct: 61  AVVPSPPQKGRDREPMTDVS----RQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKST 116

Query: 105 REYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLV 164
           R Y  +C L GDIG R ++Y+ WFKLT  EL QCL++S  + A L+++H+ +V+ L SLV
Sbjct: 117 RVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLV 176

Query: 165 LPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSK 224
           LPK+SYKG GIVTVGGGKFSL+A L+IKTLRN+HTTLPVEV IPP DEGETD C+ +  K
Sbjct: 177 LPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPK 236

Query: 225 YNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQD 284
           YNAKCI++SD+LP   +  F+F GYQFKSL++IASSFE++L LDADNFP+K LD IF+++
Sbjct: 237 YNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEE 296

Query: 285 PYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVP 344
           PY STG+VLWPDFWRRTT P +YDIA I +   KRVRNC D++TPPE+YT+++ DLSNVP
Sbjct: 297 PYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVP 356

Query: 345 FHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETF 404
            HDL+G+IP+VSTESGQLMISKS HLPT+LL+LYYNVNGPSWYYP+FSQ+A+GEGDKETF
Sbjct: 357 LHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETF 416

Query: 405 LTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYG 464
           +  A+FYGLP+YQ+KSAT V+GYH+PDG+GFRGVAMLQHD  QDY RY+ A K I  +Y 
Sbjct: 417 IAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYS 476

Query: 465 AQA--KISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWE 522
            +    I  D  Y+   FY+ YF  D+     EVDIMF HS+ PKF+P TLW+ +DLI  
Sbjct: 477 GKTSNSIHLDKDYTPESFYRKYFEGDD---IKEVDIMFVHSNLPKFDPLTLWREKDLIVN 533

Query: 523 GKHIRSYTALSKINRYDLELENFKAINEYVCVKRTNVKYLNENLATSAEWASMCDYIRDR 582
           GKHIRSYT L ++N YDLELE+FK   +Y+CV+R++ KYL+E+L   A+W SMCDYI +R
Sbjct: 534 GKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEEAQWQSMCDYIHNR 593

Query: 583 LAYLQSTHVQAVS 595
           L +L STH  AVS
Sbjct: 594 LKFLDSTHKDAVS 606

>ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {ON}
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 618

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/517 (65%), Positives = 407/517 (78%), Gaps = 3/517 (0%)

Query: 81  AKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLV 140
           AKLK+FYE+VF  LKN+SP  KS R Y + C L GDIGFRPENY+EW  L    L  CL 
Sbjct: 102 AKLKRFYEEVFTHLKNFSPEGKSQRIYKEDCPLHGDIGFRPENYDEWPTLAHDSLENCLE 161

Query: 141 VSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTT 200
           +S  +V  L+++H+ YV  LGSL LPKN YKG+GIVTVGGGKFSL+ALLVI+++R L TT
Sbjct: 162 ISPEEVTMLKKNHAAYVDVLGSLRLPKNVYKGKGIVTVGGGKFSLLALLVIRSMRELGTT 221

Query: 201 LPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASS 260
           LPVEVFIPPSD GE   C+ +  +YNAKC++LSD+LP   +   QFTGYQFKSL+LIASS
Sbjct: 222 LPVEVFIPPSDLGENQFCDEILPQYNAKCVYLSDVLPPNVIANSQFTGYQFKSLSLIASS 281

Query: 261 FEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRV 320
           FEDVLFLDADNFPVK L+ +F+  PY +TG VLWPDFWRRTTQP++YDIA I V+R+KR+
Sbjct: 282 FEDVLFLDADNFPVKRLNDVFDLAPYKTTGFVLWPDFWRRTTQPIYYDIADITVNRRKRI 341

Query: 321 RNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYN 380
           RNCFDDLTPPEVYTKN   + ++PFHD EG+IP+VSTESGQLMISKS HLPTILLALYYN
Sbjct: 342 RNCFDDLTPPEVYTKNTKSMDDIPFHDFEGTIPDVSTESGQLMISKSTHLPTILLALYYN 401

Query: 381 VNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAM 440
           VNGPSWYYPMFSQRA+GEGDKETFL AA+FYGLP+YQ+K+ATGVEGYHR + +GFRGVAM
Sbjct: 402 VNGPSWYYPMFSQRAAGEGDKETFLAAANFYGLPFYQVKTATGVEGYHRANNEGFRGVAM 461

Query: 441 LQHDVTQDYMRYKTAQKAISNKYGAQA--KISYDSSYSLHEFYKTYFGADEPNYPNEVDI 498
           LQHD+ QDY+RY+ A  AI  KYG +    I YD  YSL  FYKT+FG+ E +   E D+
Sbjct: 462 LQHDLNQDYLRYQAAADAIEAKYGGKTAKSIKYDKLYSLDNFYKTFFGS-ENSALKECDV 520

Query: 499 MFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELENFKAINEYVCVKRTN 558
           MFAHSHAPKF+PY LW   +L+ +GKH RSYT+L KIN YDLEL    +I+++VC+ + N
Sbjct: 521 MFAHSHAPKFDPYGLWTQNELVQDGKHFRSYTSLEKINNYDLELSAIDSIHKFVCLDKVN 580

Query: 559 VKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVS 595
            KYL+E + +  E   MCDYI  R  +L STH QA+S
Sbjct: 581 FKYLSEKIQSKQEHQEMCDYISKRREFLLSTHQQAIS 617

>KLTH0G16038g Chr7 (1404292..1406121) [1830 bp, 609 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 609

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/612 (56%), Positives = 449/612 (73%), Gaps = 18/612 (2%)

Query: 1   MALITKRYRXXXXXXXXXXXXXXXFIATSRFMDEGLSVSEY----QDYIKSYLGNAQPAD 56
           M L+TKR+                F+ ++R++D+ LS  EY    Q+Y ++Y GN    +
Sbjct: 1   MVLLTKRFNKIFRFSLVAALCCLIFVLSTRYIDQDLSSLEYVRYLQNYHETYSGNGNKVE 60

Query: 57  TISRNP----AVDVGLNAGREPIANGGNAK----LKKFYEQVFEDLKNYSPSSKSAREYS 108
                P    A D   +    P+ +  + K    L++FY+QVF++L+ +SP+  S+R+Y 
Sbjct: 61  PEVETPPAPAANDKIKSPSGGPVLSAQDQKRRQALQEFYKQVFKNLRQHSPTGSSSRQYD 120

Query: 109 KQCSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKN 168
           ++C L+GDIG R  +YN W KLT + L  CL +SN +   L+++H D+V++L SLVLPK 
Sbjct: 121 EKCQLNGDIGARANDYNSWSKLTSKNLGNCLKLSNKEKTMLKETHYDFVESLKSLVLPKG 180

Query: 169 SYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAK 228
           +YKG GIVTVGGGKFS+++ L+IKTLRNL T LPVEVFIPP+DEGE + C T+  KYNAK
Sbjct: 181 TYKGDGIVTVGGGKFSMLSFLIIKTLRNLGTHLPVEVFIPPNDEGEEEFCNTLLPKYNAK 240

Query: 229 CIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHS 288
           CI++SD+LP   ++ F F GYQFKS+++IASSFE++L LDADNFP+K LD+IFE++PY S
Sbjct: 241 CIYISDVLPEDIIENFDFKGYQFKSISIIASSFENLLLLDADNFPIKALDNIFEEEPYKS 300

Query: 289 TGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDL 348
           TG+VLWPDFWRRTT P +Y+IA I V+ KKRVRNC DD+TPP+ YTK++ +L NVP HDL
Sbjct: 301 TGMVLWPDFWRRTTNPAYYEIADIAVNYKKRVRNCMDDITPPQAYTKDMKNLENVPLHDL 360

Query: 349 EGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAA 408
           EG+IP+VSTESGQLMI KS+HLPTILL+LYYNVNGP+WYYP+FSQ+ASGEGDKETF+ AA
Sbjct: 361 EGTIPDVSTESGQLMIRKSRHLPTILLSLYYNVNGPTWYYPIFSQKASGEGDKETFIAAA 420

Query: 409 SFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAK 468
           +FYGLP+YQ+KS T V+GYH+PD +GFRGVAMLQHD  QDY RYK A+  I NKY  +  
Sbjct: 421 NFYGLPFYQVKSVTAVDGYHQPDNKGFRGVAMLQHDFVQDYSRYKWAKSDIENKYAGKVP 480

Query: 469 --ISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHI 526
             I  D+SYS    YKTYF   EP    EVDIMF HS+ PKF+PYTLW ++DLI +GKHI
Sbjct: 481 QFIKQDTSYSPDAMYKTYF---EPEDLKEVDIMFVHSNLPKFDPYTLWNDKDLIVDGKHI 537

Query: 527 RSYTALSKINRYDLELENFKAINEYVCVKRTNVKYLNENL-ATSAEWASMCDYIRDRLAY 585
           RSYT L ++N YDLELENFK   EY+CV RT  KYL+++L     +W SMC YI++RL +
Sbjct: 538 RSYTNLRRLNNYDLELENFKVFKEYLCVSRTKFKYLDDSLQGDERQWKSMCGYIKERLNF 597

Query: 586 LQSTHVQAVSPS 597
           L  TH  A++ S
Sbjct: 598 LDQTHSDAINAS 609

>KAFR0C00870 Chr3 complement(175651..177489) [1839 bp, 612 aa] {ON}
           Anc_3.188 YBR015C
          Length = 612

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/590 (57%), Positives = 435/590 (73%), Gaps = 19/590 (3%)

Query: 25  FIATSRFM--DEGLSVSEYQDYIKSYLGNAQPADTISRN--------PAVDVGLN-AGRE 73
           F+ T+R    ++ +SV +Y++Y++SY+ N     T ++         PA   G N     
Sbjct: 22  FLLTNRLYINNDSVSVKDYKEYLQSYINNNAGDSTDAQGTKGGDESVPAASKGKNPVLMS 81

Query: 74  PIANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTER 133
            + +    +L++FY +VF+   NYSPS KSAR Y   C LS  +G RP  Y  W+KL+  
Sbjct: 82  TVESNTKNRLREFYNEVFQYFINYSPSGKSARHYQDACQLSEKMGNRPHEYASWYKLSYT 141

Query: 134 ELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKT 193
           EL++CL +S +DV  L+ SH ++V+ LG LVLPKNSYKG GIVTVGGGKFSLM+LLVI+T
Sbjct: 142 ELNKCLSISKSDVLNLKTSHKEFVENLGKLVLPKNSYKGNGIVTVGGGKFSLMSLLVIRT 201

Query: 194 LRNLHTTLPVEVFIPPSDE-GETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFK 252
           LRNL TTLPVEVFIPP +E GE + C  +  +Y+AKCI++SDILP   +  F+F GYQFK
Sbjct: 202 LRNLGTTLPVEVFIPPQEEKGEMEFCNKILPQYHAKCIYISDILPQQMIDNFEFAGYQFK 261

Query: 253 SLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGI 312
           SLA+IASSFE++L LDADNFP+K LDHIFE++PY STGLVLWPDFWRRTTQPL+Y+IA +
Sbjct: 262 SLAIIASSFENLLLLDADNFPIKPLDHIFEEEPYVSTGLVLWPDFWRRTTQPLYYEIADV 321

Query: 313 QVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPT 372
            VD K RVRN  DD+TPP VYTK++ DLSN+P HDL+G+IP+VSTESGQLMISKSKHLPT
Sbjct: 322 SVDFKTRVRNSIDDITPPPVYTKDMNDLSNIPLHDLKGTIPDVSTESGQLMISKSKHLPT 381

Query: 373 ILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDG 432
           +LLALYYNVNGPSWYYP+FSQ+ASGEGDKETFL AA+FY LPYYQ+++  GV+GYH+P+ 
Sbjct: 382 VLLALYYNVNGPSWYYPIFSQKASGEGDKETFLAAANFYDLPYYQIRTEVGVDGYHQPEN 441

Query: 433 QGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQ---AKISYDSSYSLHEFYKTYF-GAD 488
           +GFRGVAMLQHD  QDY RY  A++ +  KYG     +KI YD +Y +  FY+TYF    
Sbjct: 442 KGFRGVAMLQHDFAQDYKRYVKAKEEVRLKYGKDRYSSKIKYDPNYDVDSFYRTYFDSGS 501

Query: 489 EPNY--PNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELENFK 546
           EP      EVD+MF HS+ PKFEP T WK  DLI +GKHIRS+T L ++  YD+ELENFK
Sbjct: 502 EPGQGGAQEVDVMFIHSNLPKFEPLTSWKTSDLIIDGKHIRSFTNLKRLKNYDIELENFK 561

Query: 547 AINEYVCVKRTNVKYLNENLATSA-EWASMCDYIRDRLAYLQSTHVQAVS 595
             +E +C +  + KYL++ L  +  + +SMC YI DRL +LQSTH  A+S
Sbjct: 562 IYHEVLCEQGLHFKYLDDALGNNKNDKSSMCKYISDRLDFLQSTHEAAIS 611

>Kwal_56.23117 s56 complement(407699..409522) [1824 bp, 607 aa] {ON}
           YBR015C (MNN2) - putative Golgi
           alpha-1,2-mannosyltransferase [contig 183] FULL
          Length = 607

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/608 (54%), Positives = 429/608 (70%), Gaps = 18/608 (2%)

Query: 1   MALITKRYRXXXXXXXXXXXXXXXFIATSRFMDEGLSVSEYQDYIKSYLGNA-------Q 53
           M  +TKR+                F+ ++++ D+ L+  EY   + +++ +A       +
Sbjct: 1   MVFLTKRFSKIFKLSLVAALCCLAFMFSTKYFDKDLTSLEYGKLVDTFMADAGYGKDAQE 60

Query: 54  PADTISRNPAVDVGLNAGREPIANGGNAK----LKKFYEQVFEDLKNYSPSSKSAREYSK 109
            A + S   A + G+ AG + ++   N K    ++KFY  VF  LK +SP+  S REY  
Sbjct: 61  VAGSSSDGTADNNGIGAGAK-VSTSSNEKRKIAMRKFYTDVFNSLKKHSPTGVSKREYGA 119

Query: 110 QCSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNS 169
           QC LSGDIG R ++Y+ W KLT + L QCL+VS+ +   L++ H  YV++L SLVLPK +
Sbjct: 120 QCKLSGDIGARADDYDNWSKLTSKNLGQCLIVSDKEKRMLKEKHRGYVESLESLVLPKGA 179

Query: 170 YKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKC 229
           YKG GIVTVGGGKFS++A L+IKTLRNLHT+LPVEVFIPP+DEGET  C  +  +YNAKC
Sbjct: 180 YKGDGIVTVGGGKFSMLAFLIIKTLRNLHTSLPVEVFIPPADEGETFFCNELLPQYNAKC 239

Query: 230 IFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHST 289
           I++SD+LP   +  F+F GYQFKS+A+IASSF+++L LDADNFP+K LD++F ++PY S 
Sbjct: 240 IYISDVLPQEIIDNFEFKGYQFKSIAIIASSFDNLLLLDADNFPIKDLDNVFNEEPYKSK 299

Query: 290 GLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLE 349
           G+VLWPDFWRRTT P++YDIA I+V+ KKRVRNC DD+TPP VYTK++ DLSNVP HDLE
Sbjct: 300 GMVLWPDFWRRTTNPIYYDIADIEVNYKKRVRNCMDDVTPPAVYTKDMSDLSNVPLHDLE 359

Query: 350 GSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAAS 409
           G+IP+VSTESGQLMI KS HL TILL+LYYNVNGPSWYYP+FSQ+ASGEGDKETF+ AA+
Sbjct: 360 GTIPDVSTESGQLMIRKSDHLGTILLSLYYNVNGPSWYYPIFSQKASGEGDKETFIAAAN 419

Query: 410 FYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAK- 468
           FY LP+YQ+KS T V+GYH+P  +GFRGVAMLQHD  QDY R   AQ  I + +  +   
Sbjct: 420 FYDLPFYQVKSVTAVDGYHQPHDKGFRGVAMLQHDFVQDYGRQMWAQVEIRSHFAGKDTQ 479

Query: 469 -ISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIR 527
              YD SYS    YK +F  D      E DIMF HS+ PKF+PY LW +QDLI +GKHIR
Sbjct: 480 YAKYDPSYSPDAVYKKFFSDDN---IGETDIMFVHSNLPKFDPYQLWHDQDLIVDGKHIR 536

Query: 528 SYTALSKINRYDLELENFKAINEYVCVKRTNVKYLNENL-ATSAEWASMCDYIRDRLAYL 586
           SY  L ++N YDLELENFK  NEY+C  +   KYL++ L      W  MC YI +RL YL
Sbjct: 537 SYRNLKRLNGYDLELENFKIFNEYLCTTQARFKYLDDKLNGDQRNWKDMCSYIGERLKYL 596

Query: 587 QSTHVQAV 594
           + TH+ A+
Sbjct: 597 EQTHLDAI 604

>Suva_2.142 Chr2 complement(246653..248464) [1812 bp, 603 aa] {ON}
           YBR015C (REAL)
          Length = 603

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/602 (55%), Positives = 437/602 (72%), Gaps = 11/602 (1%)

Query: 3   LITKRYRXXXXXXXXXXXXXXXFIATSRFMDEGLSVSEYQDYIKSYLGNAQPADTISRNP 62
           L+TKR+                F+ T+++MDE  SV +Y+ +++SY+ +    D+ S   
Sbjct: 2   LLTKRFSKLFKLAFIALLLCGLFVVTNKYMDENTSVKDYKSHLQSYIDSYANKDSSSPED 61

Query: 63  AVDVGLNAGREPIANGGNA---KLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGF 119
           A           +    NA   KLK FY  VF  L   SPS KS R Y+++C L GDIG 
Sbjct: 62  AAAAAAADDAASLKGNDNASTEKLKSFYNNVFNFLMLDSPSGKSKRVYNEKCPLKGDIGD 121

Query: 120 RPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVG 179
           RP+ Y + +KL+ +EL++CL +S  +V+KL++SH DYV+ + SL+LPK +YKG GI TVG
Sbjct: 122 RPDQYKDLYKLSAKELAKCLELSPDEVSKLKKSHKDYVEHIASLILPKGTYKGSGIATVG 181

Query: 180 GGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAP 239
           GGKFSLMA L+IKTLRN+ TTLPVEV IPP DEGET+ C  +  KYNAKCI++SDILPA 
Sbjct: 182 GGKFSLMAFLIIKTLRNMGTTLPVEVLIPPGDEGETEFCSKILPKYNAKCIYISDILPAE 241

Query: 240 SLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWR 299
           +++KF F GYQFKSLALI SSFE++L LDADNFP+K+LD+IF ++PY STGLV+WPDFWR
Sbjct: 242 TIEKFVFKGYQFKSLALITSSFENLLLLDADNFPIKSLDNIFLEEPYVSTGLVMWPDFWR 301

Query: 300 RTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTES 359
           RTT PL+YDIAGI V++++RVRN  DD+TPP VYTK+L DL  VP  D+EG+IP+VSTES
Sbjct: 302 RTTHPLYYDIAGIPVNKERRVRNSQDDITPPAVYTKDLKDLDAVPLSDMEGAIPDVSTES 361

Query: 360 GQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLK 419
           GQLMI+KSKHL T LL+L+YNVNG +WYYP+FSQ+A+GEGDKETF+ AA+FYGLP+YQ+K
Sbjct: 362 GQLMINKSKHLATALLSLFYNVNGINWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVK 421

Query: 420 SATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKY-----GAQAKISYDSS 474
           + TGVEGYH  D  GF GVAMLQHD  QDY RY TA K I+NKY      + A I +D  
Sbjct: 422 TKTGVEGYH--DSDGFHGVAMLQHDFVQDYSRYLTASKTINNKYKDLIIKSSAPIKFDKD 479

Query: 475 YSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSK 534
           YSL ++ K +F  ++ +  + VD+MF HS+ PKF+PY L K+  L  + K  RS+T+L K
Sbjct: 480 YSLEKYIKEFFDNEDSHAKDHVDVMFIHSNLPKFDPYDLSKSNFLTTDNKPARSFTSLGK 539

Query: 535 INRYDLELENFKAINEYVCVKRTNVKYLNENLATSAE-WASMCDYIRDRLAYLQSTHVQA 593
           I++YD+ELENFKA++EYVCV +   KYL++ L    + W  MCDYI  RL +L+STH +A
Sbjct: 540 IHKYDIELENFKALHEYVCVNKNPFKYLDDALGQDEKGWKKMCDYIAKRLQFLESTHEKA 599

Query: 594 VS 595
           ++
Sbjct: 600 IA 601

>YBR015C Chr2 complement(267710..269503) [1794 bp, 597 aa] {ON}
           MNN2Alpha-1,2-mannosyltransferase, responsible for
           addition of the first alpha-1,2-linked mannose to form
           the branches on the mannan backbone of oligosaccharides,
           localizes to an early Golgi compartment
          Length = 597

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/597 (55%), Positives = 432/597 (72%), Gaps = 7/597 (1%)

Query: 3   LITKRYRXXXXXXXXXXXXXXXFIATSRFMDEGLSVSEYQDYIKSYLGNAQPADTISRNP 62
           L+TKR+                F+ T+++MDE  SV EY++Y+  Y+ +     + S + 
Sbjct: 2   LLTKRFSKLFKLTFIVLILCGLFVITNKYMDENTSVKEYKEYLDRYVQSYSNKYSSSSDA 61

Query: 63  AVDVGLNAGREPIANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPE 122
           A        R+     GN KLK FY  VF  L   SP   +A++Y++ C L GDIG RP+
Sbjct: 62  ASADDSTPLRDN-DEAGNEKLKSFYNNVFNFLMVDSPKGSTAKQYNEACLLKGDIGDRPD 120

Query: 123 NYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGK 182
           +Y + +KL+ +ELS+CL +S  +VA L +SH DYV+ + +LV PK +YKG GI TVGGGK
Sbjct: 121 HYKDLYKLSAKELSKCLELSPDEVASLTKSHKDYVEHIATLVSPKGTYKGSGIATVGGGK 180

Query: 183 FSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLK 242
           FSLMA L+IKTLRN+ TTLPVEV IPP DEGET+ C  +  KYN+KCI++SDILP  +++
Sbjct: 181 FSLMAFLIIKTLRNMGTTLPVEVLIPPGDEGETEFCNKILPKYNSKCIYVSDILPRETIE 240

Query: 243 KFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTT 302
           KF F GYQFKSLALIASSFE++L LDADNFP+K LD+IF ++PY STGLV+WPDFWRRTT
Sbjct: 241 KFVFKGYQFKSLALIASSFENLLLLDADNFPIKPLDNIFNEEPYVSTGLVMWPDFWRRTT 300

Query: 303 QPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQL 362
            PL+YDIAGI VD+KKRVRN  DD+TPP VYTK+L DLS+VP  DL+G+IP+VSTESGQL
Sbjct: 301 HPLYYDIAGIAVDKKKRVRNSRDDITPPAVYTKDLKDLSDVPLSDLDGTIPDVSTESGQL 360

Query: 363 MISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSAT 422
           MI+K+KHL T LL+L+YNVNGP+WYYP+FSQ+A+GEGDKETF+ AA+FYGL +YQ+++ T
Sbjct: 361 MINKTKHLATALLSLFYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVRTRT 420

Query: 423 GVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAK---ISYDSSYSLHE 479
           GVEGYH  D  GF GVAMLQHD  QDY RY  A ++I NKYG       I +D +YSL +
Sbjct: 421 GVEGYH--DEDGFHGVAMLQHDFVQDYGRYLNAMESIGNKYGGTKSADAIKFDKNYSLEK 478

Query: 480 FYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYD 539
           + + +F  ++ N  N VD+MF HS+ PKF+PY L K+  L   GK  RSYTAL K+  YD
Sbjct: 479 YTEEFFDNEDLNAKNHVDVMFIHSNFPKFDPYDLSKSNFLTTNGKPARSYTALKKVKNYD 538

Query: 540 LELENFKAINEYVCVKRTNVKYLNENLATS-AEWASMCDYIRDRLAYLQSTHVQAVS 595
           +ELENFK +NEYVCV +   KYL++ L     EW  +C YI DRLA+L+STH +A++
Sbjct: 539 IELENFKVLNEYVCVNKNPFKYLDDLLGQDKTEWKRVCGYITDRLAFLESTHDKAIA 595

>Smik_2.134 Chr2 complement(247923..249716) [1794 bp, 597 aa] {ON}
           YBR015C (REAL)
          Length = 597

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/599 (54%), Positives = 424/599 (70%), Gaps = 11/599 (1%)

Query: 3   LITKRYRXXXXXXXXXXXXXXXFIATSRFMDEGLSVSEYQDYIKSYLGNAQPADTISRNP 62
           L+TKR+                F+ T+++MDE  SV +Y+ Y+   L N     +   + 
Sbjct: 2   LLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYL---LDNINSYSSKHSSS 58

Query: 63  AVDVGLNAGREPIANG--GNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFR 120
           + + G +       N    N KLK FY  VF  L   SP+ KSAR+Y++ C LSGDIG R
Sbjct: 59  SDNAGADDSSSLKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDR 118

Query: 121 PENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGG 180
           P+ Y E +KL+  ELS+CL +S  +VA+L +SH DYV  + SL LPK +YKG GI TVGG
Sbjct: 119 PDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGG 178

Query: 181 GKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPS 240
           GKFSLM+ L+IKTLRN+ TTLPVEV IPP DEGE++ C  +   YNAKCI++SDILP  +
Sbjct: 179 GKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLET 238

Query: 241 LKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRR 300
           ++KF F GYQFKSLAL+ASSFE++L LDADNFP+K LD+IF ++PY STGLV+WPDFWRR
Sbjct: 239 IEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRR 298

Query: 301 TTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESG 360
           TT PL+Y+IA I V+ K RVRN  DDLTPP +YTKN  DL  VP  DL+G+IP+VSTESG
Sbjct: 299 TTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESG 358

Query: 361 QLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKS 420
           QLMI+K+KHL T LL+L+YNVNGP+WYYP+FSQ+A+GEGDKETF+ AA+FYGL +YQ+K+
Sbjct: 359 QLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKT 418

Query: 421 ATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKY---GAQAKISYDSSYSL 477
            TGVEGYH  D +GF GVAMLQHD  QDY RY TA K+I+NKY    + A I YD +YSL
Sbjct: 419 RTGVEGYH--DKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSL 476

Query: 478 HEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINR 537
            ++ K +F  ++    + VD+MF HS+ PKF+PYTL +   L  + K  RS+TAL K+  
Sbjct: 477 EKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQN 536

Query: 538 YDLELENFKAINEYVCVKRTNVKYLNENLATS-AEWASMCDYIRDRLAYLQSTHVQAVS 595
           YD+ELENFK + EYVC K+   KYL++ L     EW  MCDYI  RL +L+STH + ++
Sbjct: 537 YDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIA 595

>TBLA0F00740 Chr6 (187874..189835) [1962 bp, 653 aa] {ON} Anc_3.188
           YBR015C
          Length = 653

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/519 (59%), Positives = 394/519 (75%), Gaps = 6/519 (1%)

Query: 82  KLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVV 141
           K+ KFY+ +F  LKN +   KS R Y  +C L GD+G RP+NY EW+KLT +ELS CL V
Sbjct: 129 KVYKFYQDIFNILKNTTIPGKSDRVYKLECQLKGDVGTRPDNYKEWYKLTSKELSNCLEV 188

Query: 142 SNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTL 201
                  L++SH+DYV  +GSLVLPK +Y G+GIVTVGGGKFS++A L+I+TLRNL T+L
Sbjct: 189 PYETAKMLQESHADYVDKIGSLVLPKVAYGGKGIVTVGGGKFSVLAFLIIRTLRNLGTSL 248

Query: 202 PVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSF 261
           PVEVFIPPSDEGETD C  V  +YNAKCI+++DILP   + +F+F GYQFKSLA+IASSF
Sbjct: 249 PVEVFIPPSDEGETDFCNNVLPQYNAKCIYMTDILPKEFVDEFEFKGYQFKSLAMIASSF 308

Query: 262 EDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVR 321
           +D+L LDADNFP+K LD+IFEQ+PY STGLV+WPDFWRRTT P++Y IA + V+ KKRVR
Sbjct: 309 DDLLMLDADNFPIKDLDNIFEQEPYTSTGLVMWPDFWRRTTNPVYYSIADVPVNEKKRVR 368

Query: 322 NCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNV 381
           N FDDLTP E+YT+++ DLS+VPFHDLEG++P+VSTESGQLMI+K KH+ T+LLALYYN 
Sbjct: 369 NTFDDLTPVEIYTEDISDLSDVPFHDLEGTLPDVSTESGQLMINKEKHIATVLLALYYNF 428

Query: 382 NGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAML 441
           NGP+WYYP+FSQ+A+GEGDKETF+ AA+FYGL YYQ++++ GV+GYH+ D +GFRGVAML
Sbjct: 429 NGPTWYYPIFSQKAAGEGDKETFIAAANFYGLSYYQVRTSVGVDGYHQSDDKGFRGVAML 488

Query: 442 QHDVTQDYMRYKTAQKAISNKYGAQAKI-SYDSSYSLHEFYKTYFGADEPNYPN----EV 496
           QHD  QDY RY+ A+  I  KYG   K+  YD +YS  +FYKTYF + + +  N    EV
Sbjct: 489 QHDFVQDYERYERARNEIDIKYGGAKKVMKYDYNYSPDDFYKTYFDSGDDSNVNQPIKEV 548

Query: 497 DIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELENFKAINEYVCVKR 556
           DIMF HS+ PKF+P+TLW   DL  +G H RSY  L  +  YDLE ENFK  ++ +CV +
Sbjct: 549 DIMFVHSNLPKFDPFTLWDENDLTLDGSHFRSYLKLPHLTHYDLEYENFKIFHQSLCVLK 608

Query: 557 TNVKYLNENL-ATSAEWASMCDYIRDRLAYLQSTHVQAV 594
              KYL +      +   SMC+YI DRL YL  TH  A+
Sbjct: 609 NQFKYLEDKFQGKESNRESMCNYIMDRLKYLTDTHEMAL 647

>Skud_2.127 Chr2 complement(241232..243022) [1791 bp, 596 aa] {ON}
           YBR015C (REAL)
          Length = 596

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/597 (54%), Positives = 426/597 (71%), Gaps = 8/597 (1%)

Query: 3   LITKRYRXXXXXXXXXXXXXXXFIATSRFMDEGLSVSEYQDYIKSYLGNAQPADTISRNP 62
           L+TKR+                F+ T+++MDE  SV EY+ Y++ YL +       +  P
Sbjct: 2   LLTKRFSKLFKLAFIALILCGLFVITNKYMDENTSVREYKSYLQDYLDSHSNKHPSTDAP 61

Query: 63  AVDVGLNAGREPIANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPE 122
             D   ++  +   N    KLK FY++VF  L   SP+ KSAR Y K C L+GDIG RP+
Sbjct: 62  VTDD--SSSSKVNDNAATRKLKDFYDKVFNFLILDSPTGKSARNYGKACLLNGDIGDRPD 119

Query: 123 NYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGK 182
            Y E  KL+ ++LS+CL +S  ++++L +SH DYV+ + +L+LPK +YKG GI TVGGGK
Sbjct: 120 QYEELHKLSAKQLSKCLELSPDEISRLTKSHRDYVEHIATLLLPKGTYKGSGIATVGGGK 179

Query: 183 FSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLK 242
           FSLMA L+IKTLRN  T LPVEV IPP DEGE++ C  +  KYN+KCI++SDILP  ++K
Sbjct: 180 FSLMAFLIIKTLRNRGTNLPVEVLIPPGDEGESEFCNKILPKYNSKCIYVSDILPVETIK 239

Query: 243 KFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTT 302
           KF F GYQFKSLALIASSFE++L LDADNFP+K+LD+IF ++PY STGLV+WPDFWRRTT
Sbjct: 240 KFHFEGYQFKSLALIASSFENLLLLDADNFPIKSLDNIFNEEPYVSTGLVMWPDFWRRTT 299

Query: 303 QPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQL 362
            PL+Y+IAGI V+  KRVRN  DD+TPP VYTK+L +L +VP  DL+G+IP+VSTESGQL
Sbjct: 300 HPLYYEIAGIPVNMNKRVRNSQDDITPPAVYTKDLKNLDDVPLSDLDGTIPDVSTESGQL 359

Query: 363 MISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSAT 422
           MI+KSK L T LL+L+YNVNGP+WYYP+FSQ+A+GEGDKETF+ AA+FYG P+YQ+++ T
Sbjct: 360 MINKSKQLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGEPFYQVRTRT 419

Query: 423 GVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYG---AQAKISYDSSYSLHE 479
           GVEGYH  + + F GVAMLQHD  QDY RY  A K  ++KY    + A I +D SYS   
Sbjct: 420 GVEGYH--ENKDFHGVAMLQHDFVQDYSRYLIASKKTNDKYNTMKSSASIKFDKSYSFEN 477

Query: 480 FYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYD 539
           +++ +F  ++ N  N VD+MF HS+ PKF+PY L +   L  + K  RSYTAL KI  YD
Sbjct: 478 YFEEFFENEDTNAKNHVDVMFIHSNLPKFDPYDLSETNFLTIDKKPARSYTALHKIQNYD 537

Query: 540 LELENFKAINEYVCVKRTNVKYLNENLATS-AEWASMCDYIRDRLAYLQSTHVQAVS 595
           +ELENFKA+ EYVC  +   KYL++ L     +W  MCDYI +RL +L+STH +A++
Sbjct: 538 IELENFKALKEYVCTNKNPFKYLDDALGEDKVKWKKMCDYITERLEFLESTHDKAIA 594

>TPHA0A04380 Chr1 (982546..984474) [1929 bp, 642 aa] {ON} Anc_3.188
           YBR015C
          Length = 642

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/587 (52%), Positives = 403/587 (68%), Gaps = 32/587 (5%)

Query: 33  DEGLSVSEYQDYIKSYL------------------GNAQPADTI----SRNPAVDVGLNA 70
           D   S++EY +Y+K +L                  GN+  +       S+ PA     NA
Sbjct: 52  DSKNSLNEYSNYLKGFLKQDNEGSVNYGANSHSGKGNSDKSKGSLAQGSKPPATSFSENA 111

Query: 71  GR-EPIANGGNAK--LKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEW 127
              E   N  +    LK+FY QVF+ ++ YSP  K AR+Y + C L+ +I  RPEN   W
Sbjct: 112 KTVEKNVNSSDRTKLLKEFYSQVFDSIRKYSPVGKCARKYKESCILTDNIPDRPENSEHW 171

Query: 128 FKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMA 187
           FKLT++ L  CL  +  +   L+ +H ++V ++  L LPK  Y  QGIV VGGGKFS++A
Sbjct: 172 FKLTKKALENCLEFTPDEFKMLKSTHDNFVNSISKLTLPKQGYSKQGIVMVGGGKFSMLA 231

Query: 188 LLVIKTLRNLHTTLPVEVFIPPSDEGET-DLCETVFSKYNAKCIFLSDILPAPSLKKFQF 246
            L+IKTLRNL TTLPVEVFIPP DE E  D C+ V   +NAKCIF+SD+LP   +K F F
Sbjct: 232 FLIIKTLRNLGTTLPVEVFIPPVDEAEKDDFCKDVLPNFNAKCIFISDVLPEEQIKTFDF 291

Query: 247 TGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLF 306
            GYQFKSLALI+SSFED+L LDADNFPVK LD+IF+Q+PY S GL+LWPDFWRRTT P++
Sbjct: 292 KGYQFKSLALISSSFEDLLLLDADNFPVKNLDNIFDQEPYKSKGLILWPDFWRRTTTPVY 351

Query: 307 YDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISK 366
           Y IA + VD  KRVRN  DDLTPPE+YT+N   L  VP HDL+G+IP+ STESGQL+I+K
Sbjct: 352 YQIADVPVDYTKRVRNSIDDLTPPEIYTEN---LDTVPLHDLQGTIPDPSTESGQLLINK 408

Query: 367 SKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEG 426
            +H+PT+LL+LYYN+NGP+WYYPMF+Q+A+GEGDKETF+ AA +Y LP+YQ+K+ TGV+G
Sbjct: 409 KQHVPTLLLSLYYNINGPNWYYPMFTQKAAGEGDKETFIAAAVYYDLPFYQVKTKTGVDG 468

Query: 427 YHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYKTYF- 485
           YH+ D +GFRGVAMLQHD  QDY R+  A+  I + Y       +D +YSL ++YK Y  
Sbjct: 469 YHQADNKGFRGVAMLQHDFVQDYKRFLKAKDKIQSIYKTVESRIFDKNYSLEDYYKNYIL 528

Query: 486 --GADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELE 543
              + + N   EVDIMF HS+ PKF+P +LWK  +LI  G+HIR Y A+ K+N YD+ELE
Sbjct: 529 KTNSFDKNDEGEVDIMFVHSNLPKFDPISLWKQNELIVNGEHIRGYRAIEKLNNYDIELE 588

Query: 544 NFKAINEYVCVKRTNVKYLNENLATSAEWASMCDYIRDRLAYLQSTH 590
           NFK  N+Y+CV++T   ++ ++L    +  SMCDYI+ RL YL+ TH
Sbjct: 589 NFKTFNQYLCVEKTKFVHVEKHLENEQDRKSMCDYIKSRLEYLEKTH 635

>NCAS0E01590 Chr5 (302992..304818) [1827 bp, 608 aa] {ON} Anc_3.188
          Length = 608

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/623 (50%), Positives = 425/623 (68%), Gaps = 40/623 (6%)

Query: 1   MALITKRY-RXXXXXXXXXXXXXXXFIATSRFMDEGLSVSEYQDYIKSYLGNAQPADTIS 59
           M L+ +R+ R               F   S    E +SV +Y++Y+++Y+ N+    T S
Sbjct: 1   MVLLRRRFSRVFKLALLLSIVGAGLFFFNSGQYSESISVKDYKEYLQNYI-NSNSDPTPS 59

Query: 60  RNPAVDVGLNAGREPIAN-------------GGNA--------KLKKFYEQVFEDLKNYS 98
            +P      NA ++P AN             GG+         K+K F+  VF+ + +YS
Sbjct: 60  SSP------NAAKQPAANLKDESNKNNNKKNGGSVGSPKTHDEKMKAFFNTVFQHIIDYS 113

Query: 99  PSSKSAREYSKQ-CSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYV 157
           P  K+ + Y+K+ C L GD+G RPENY +W+KL+ + L  CL VS+ +   L+ SH+ + 
Sbjct: 114 PKGKTKKIYNKEKCLLDGDVGSRPENYKDWYKLSYKNLGNCLEVSDTEFTNLKTSHASFT 173

Query: 158 KALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSD-EGETD 216
           + L  LVLPK +YKG GIV VGGGKFSL++ LVIKT+RNL TTLP+EVFIPP++ EGE++
Sbjct: 174 ENLNKLVLPKGTYKGDGIVLVGGGKFSLLSYLVIKTIRNLGTTLPIEVFIPPNEVEGESE 233

Query: 217 LCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKT 276
            C    S  +AKCI++SDILP   + KF+F GYQFKSLA+IASSFE++L LDADN P+K 
Sbjct: 234 FCSQTISDLDAKCIYISDILPKDMVSKFEFKGYQFKSLAIIASSFENLLLLDADNTPIKN 293

Query: 277 LDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKN 336
           L+ IF+Q+PY S GLVLWPDFWRRTTQP++Y IAGI V+ +KRVRN  DDLTP  VYTK 
Sbjct: 294 LNTIFKQEPYASRGLVLWPDFWRRTTQPIYYKIAGIPVNLQKRVRNDIDDLTPVGVYTK- 352

Query: 337 LGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRAS 396
             D+ ++PFHD EG++P+VSTESGQLM++KSKHL T+LLALYYNVNGP+WYYP+FSQ+A+
Sbjct: 353 -PDMVDIPFHDFEGTMPDVSTESGQLMVNKSKHLATVLLALYYNVNGPNWYYPIFSQKAA 411

Query: 397 GEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQ 456
           GEGDKETF+  A+FY LPYYQ+KS  GV+GYHR   +GFRGVAMLQHD  QDY RYK A 
Sbjct: 412 GEGDKETFIAGANFYDLPYYQVKSKVGVDGYHRK--EGFRGVAMLQHDFVQDYNRYKLAS 469

Query: 457 KAISNKYGAQAKISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKN 516
             I+ +Y   + + +D SY++ +FY  YF     N   ++D+MF HS+ PKF+P  LWK+
Sbjct: 470 ADIAREYSNPSSVVFDKSYTVQKFYDKYFD----NTDEDIDVMFIHSNLPKFDPLPLWKD 525

Query: 517 QDLIWEGKHIRSYTALSKINRYDLELENFKAINEYVCVKRTNVKYLNENLATSAEW-ASM 575
            DLI +GK +RSYT L K+  +D+E ENFK + E +C K  + KYL +   ++ +   S 
Sbjct: 526 NDLIEDGKPVRSYTNLRKLGYHDIEYENFKTLKELLCEKNVDFKYLADEFKSNPQARMSF 585

Query: 576 CDYIRDRLAYLQSTHVQAVSPSK 598
           C YI DR  YL+ TH +A+S S+
Sbjct: 586 CKYITDRYKYLEETHQEALSASE 608

>KNAG0K01290 Chr11 (254881..256716) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/526 (57%), Positives = 387/526 (73%), Gaps = 20/526 (3%)

Query: 82  KLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVV 141
           KLKKFY +VF+++ ++SPS  + ++Y  +C L GDIG RP++Y+ + +L    L  CL +
Sbjct: 91  KLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNL 150

Query: 142 SNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTL 201
           S AD++ LR SH  +V +L  + LP NSYKG GIVTVGGGKFSLMA L+++ +R + TTL
Sbjct: 151 SGADISNLRHSHKSFVDSL-DVTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTL 209

Query: 202 PVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSF 261
           PVEVFIPP++  ET+ C  +  KYNAKCIF+  ILP   ++KF F GYQFKSLAL+ASSF
Sbjct: 210 PVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSF 269

Query: 262 EDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVR 321
           E+ L LDADNFPVK L+ IF ++P+ S GLVLWPDFWRRTTQPL+YDIAG+ V+ K RVR
Sbjct: 270 ENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVR 329

Query: 322 NCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNV 381
           N FDDLTPPEVYT+N+ DLS VPFHDLEG++P+VSTESGQLM++K+KHL TILLALYYNV
Sbjct: 330 NSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNV 389

Query: 382 NGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAML 441
           NGP+WYYP+FSQ+A+GEGDKETF+ AA+FYGLP+YQ+KS+T V+GY   +G+ F GVAML
Sbjct: 390 NGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFE-NGE-FHGVAML 447

Query: 442 QHDVTQDYMRYKTAQKAISNKYG--------AQAKISYDSSYSLHEFYKTYFGADEPNYP 493
           Q+D  QDY  Y+ A+  I  KYG        +Q +IS+D SYSL +F   YF  D  N  
Sbjct: 448 QYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFREDSHN-- 505

Query: 494 NEVDIMFAHSHAPKFEPYTLWKNQDLI-WEGKHIRSYTALSKINRYDLELENFKAINEYV 552
              D+MF HS+ PKF+P +LWKN+ L+  +G H RSYT L K   +D+ELENFK    + 
Sbjct: 506 ---DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFF 562

Query: 553 C--VKRTNVKYLNENL-ATSAEWASMCDYIRDRLAYLQSTHVQAVS 595
           C   K +   YL + L  T   W  MC+YI  RL +L+ TH++AV+
Sbjct: 563 CGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVN 608

>CAGL0I04532g Chr9 (404659..406497) [1839 bp, 612 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015c TTP1
           type II membrane protein
          Length = 612

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/526 (55%), Positives = 380/526 (72%), Gaps = 11/526 (2%)

Query: 82  KLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVV 141
           K+K FY+ VFE + +YSP+ K+ARE+   C  SGDI  RP++Y  W KL+  +LS C+ +
Sbjct: 85  KIKDFYKTVFEHILDYSPAGKTAREFDDSCFDSGDISTRPDSYKNWKKLSYHQLSHCMKI 144

Query: 142 SNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTL 201
           S +++  LR +H  YV  +  LVLPK SYKG+GIVTVGGGKF+LMAL +IK LR L TTL
Sbjct: 145 SPSEINHLRGNHKSYVDKINELVLPKGSYKGEGIVTVGGGKFTLMALTMIKALRTLGTTL 204

Query: 202 PVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSF 261
           PVEVFIPP DEGE+  CE+V  +YNAKCI++SDILP   ++KF F GYQFKSLA+I SSF
Sbjct: 205 PVEVFIPP-DEGESTFCESVLPQYNAKCIYISDILPDDMIQKFTFKGYQFKSLAMITSSF 263

Query: 262 EDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVR 321
           E++L LDADN PVK +DHIFE   + S GL+LWPDFWRRTT P +Y+IA +  ++ KRVR
Sbjct: 264 ENLLLLDADNIPVKKIDHIFESQIFRSAGLILWPDFWRRTTMPAYYEIANLPYNQNKRVR 323

Query: 322 NCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNV 381
           N FDD+TPPEVYTK  GDLS VPFHD+EG++P+ STESGQL+ISK+KHLPT+LL+LYYNV
Sbjct: 324 NAFDDITPPEVYTKPDGDLSEVPFHDMEGTLPDPSTESGQLLISKAKHLPTLLLSLYYNV 383

Query: 382 NGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAML 441
           NGP+WYYP+FSQR +GEGDKETF++AASFY L YYQ+K++ GV+GY R DG G+RGV ML
Sbjct: 384 NGPNWYYPIFSQRTAGEGDKETFISAASFYSLSYYQVKTSVGVDGYFRHDGSGYRGVGML 443

Query: 442 QHDVTQDYMRYKTAQKAISNKYG----AQAKISYDSSYSLHEFYKTYFGADEPNYPNE-- 495
           QHD  QD  +Y  A +  + KY      +  ISYD SY  +EF+  +F   +P+  +E  
Sbjct: 444 QHDFIQDSKQYMEAFEYSNTKYNNLRSEKGSISYDPSYDPNEFFDKFFSRKKPDGGDESK 503

Query: 496 VDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELENFKAINEYVCV- 554
            D+MF H + PKF+PY  W   DL+++ KH RS+     I ++D+ELENFK  NE +C  
Sbjct: 504 ADVMFVHCNLPKFDPYVSWDTNDLVYQTKHFRSFNNKKVIAQFDIELENFKFFNETLCPY 563

Query: 555 --KRTNVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVSPSK 598
              +   KYL+  L+    W  MCDYI  RL YL+ +H +A+   K
Sbjct: 564 ENGKGKFKYLDNKLS-EERWPQMCDYISKRLQYLKESHNEALGLEK 608

>KLLA0E17755g Chr5 complement(1572985..1574901) [1917 bp, 638 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 638

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/526 (55%), Positives = 375/526 (71%), Gaps = 7/526 (1%)

Query: 69  NAGREPIANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWF 128
           N G     +    +++ FY QVF+ LK + P   +   Y+++CSL+GDIG+R EN ++W+
Sbjct: 116 NVGASSTPSSKKKQVQGFYGQVFKYLKEFGPVGVNIATYNQKCSLNGDIGYRQENTDQWW 175

Query: 129 KLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMAL 188
           KLT  EL+ CL +S      L+++HS+YV AL  LVLPK++Y G GIVTVGGGKFS+MA 
Sbjct: 176 KLTTEELNNCLQLSQEQRLMLKEAHSNYVHALSKLVLPKDTYSGDGIVTVGGGKFSMMAF 235

Query: 189 LVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTG 248
           L+IKT+RN  TTLPVEVFIPPSDEG+ + C  +  +YNAKCI+LSD  P   ++K  F G
Sbjct: 236 LIIKTVRNFGTTLPVEVFIPPSDEGDDEFCNVLLPQYNAKCIYLSDAFPPDLIEKSDFKG 295

Query: 249 YQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYD 308
           YQFKSLA+IASSF+++L LDADNFP+K LD IFE+  Y  TGL+LWPDFWRRTT P +Y 
Sbjct: 296 YQFKSLAIIASSFKNLLLLDADNFPIKPLDGIFEEKSYKDTGLILWPDFWRRTTHPSYYS 355

Query: 309 IAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSK 368
           IA   +   +R+RN  DD+TPP VYTK+L DLS+VP HDL+G+IP+ STESGQLMI+K K
Sbjct: 356 IANTPI-SSERIRNTMDDVTPPSVYTKDLKDLSDVPLHDLDGTIPDASTESGQLMINKLK 414

Query: 369 HLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYH 428
           H PT+LL+LYYNV GPSWYY +FSQR+SGEGDKETF+ AA FY LP+YQ++S   V+GYH
Sbjct: 415 HFPTVLLSLYYNVYGPSWYYSIFSQRSSGEGDKETFIAAAHFYDLPFYQVRSEPRVDGYH 474

Query: 429 RPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYKTYFGAD 488
           R + +GFRGV MLQHD  QDY RY+ AQ  I  KY  +    YD  Y+  E Y   +  +
Sbjct: 475 RHNNEGFRGVCMLQHDFAQDYKRYRQAQNEIGTKYTNEPD-DYDPKYNYQENYLGKYFTN 533

Query: 489 EPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELENFKAI 548
           +P     VD+MF HSH PKF+P  L  +QDLI +GKHIRSY  L ++N YDLELE FK  
Sbjct: 534 DP-----VDVMFVHSHLPKFDPVELALSQDLIQDGKHIRSYRNLKRMNGYDLELEVFKTF 588

Query: 549 NEYVCVKRTNVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAV 594
            EYVC KR + KY  + +   + W  +C+Y+ +RL YL  +H +A+
Sbjct: 589 KEYVCDKRVHFKYFEKAVKLESNWGIICNYVNERLVYLIESHSEAM 634

>NCAS0A03650 Chr1 complement(729502..731325) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/560 (50%), Positives = 397/560 (70%), Gaps = 17/560 (3%)

Query: 39  SEYQDYIKSYLGNAQPADTISRNPAVDVGLNAGREPIANGGNAKLKKFYEQVFEDLKNYS 98
           ++Y+DY+KSY+       T +   +V    +  +E  ++  +  +K F++ VF+ + +YS
Sbjct: 61  TQYKDYLKSYI-------TSNSTSSVSAEHDIEQENSSSYNDNNIKSFFDTVFQHILDYS 113

Query: 99  PSSKSAREYSKQ-CSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYV 157
           P+ KS R Y+K+ C L+  +G+ P+NY +W+KL+   L  CL +S+ +   L+ +H+ ++
Sbjct: 114 PTGKSERIYNKEKCLLNSVVGYSPDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFI 173

Query: 158 KALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSD-EGETD 216
           + +  L LP + Y+G GIV V GGKFSL++ LV+KT+R   TTLPVEVFIPP + E E +
Sbjct: 174 EEMDKLTLPNDIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAE 233

Query: 217 LCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKT 276
            C+T+ ++++AKC+++SDILP   +  F F GYQFKSLA+IASSFE++L LDADNFPVK 
Sbjct: 234 FCKTMLNEFDAKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKN 293

Query: 277 LDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKN 336
           LD+IF+Q+PY +TGL+LWPDFWRRTTQP+FY+IAGI V+ +KRVRN  D+LTP +VY K+
Sbjct: 294 LDNIFQQEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKS 353

Query: 337 LGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRAS 396
             ++ +VP+HD EG++P+VSTESG+LM++K +HL T+LLALYYNVNGP+WYYP+FSQ  +
Sbjct: 354 DQEM-DVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLA 412

Query: 397 GEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQ 456
           GEGDKETF+  A+FY LP+YQ+K+  GV+GYH+ D  GFRGVAMLQHD  QDY RYK AQ
Sbjct: 413 GEGDKETFIAGATFYNLPFYQVKTKVGVDGYHKED--GFRGVAMLQHDFVQDYDRYKLAQ 470

Query: 457 KAISNKYGAQAKISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKN 516
             I  KY    ++ YD  Y++ +FY  YF  +     NE D++F HSH PKF+P +LWK+
Sbjct: 471 LKIDKKYLPSNEVLYDKDYTVQKFYDEYFNIE----GNETDVLFVHSHLPKFDPVSLWKD 526

Query: 517 QDLIWEGKHIRSYTALSKINRYDLELENFKAINEYVCVKRTNVKYLNENLATS-AEWASM 575
            DLI +GKH+RSYT L+K   YD+E ENFK + E +C   T+  Y++E       E A  
Sbjct: 527 NDLIKDGKHLRSYTNLNKFGYYDIEYENFKTMKELLCESDTHFYYIDEAFKDKPEEKADF 586

Query: 576 CDYIRDRLAYLQSTHVQAVS 595
           C YI DR  +L  TH    S
Sbjct: 587 CKYIVDRYEFLNETHDAVTS 606

>Ecym_5314 Chr5 complement(634571..636418) [1848 bp, 615 aa] {ON}
           similar to Ashbya gossypii AER018C
          Length = 615

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/515 (56%), Positives = 375/515 (72%), Gaps = 7/515 (1%)

Query: 81  AKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLV 140
           AKL+ FYE+VF  L  ++PS  S++   + C L+ DIG R E+   W+KL+   LS+CL 
Sbjct: 106 AKLRGFYEKVFNMLSKHAPSGSSSKIRGENCQLTKDIGGRLEDQKWWYKLSYEHLSKCLQ 165

Query: 141 VSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTT 200
           VS  D   L++ HSDYV  L SLVLP +SY G GIVTVGGGKFS++A L+I TLRN+ TT
Sbjct: 166 VSRKDRKMLKKKHSDYVADLASLVLPLDSYTGNGIVTVGGGKFSVLAFLMITTLRNVGTT 225

Query: 201 LPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASS 260
           LPVEV IPP++E E + C  V  ++NAKCI+LSD+LP   L  F+  GYQ KS A+IASS
Sbjct: 226 LPVEVLIPPNEESEHEFCNNVLPEFNAKCIYLSDVLPKSVLTSFEVKGYQLKSFAIIASS 285

Query: 261 FEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRV 320
           F+++L LDADN P+K LD IFE  PY STGLVLWPDFWRRTT P++Y++AGI ++  KRV
Sbjct: 286 FQNLLLLDADNLPIKNLDDIFESKPYKSTGLVLWPDFWRRTTSPIYYEVAGIPINYNKRV 345

Query: 321 RNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYN 380
           RN  DD+TP  VYT N   LS VP HDLEG+IP++STESGQLMISK  HL T LL+LYYN
Sbjct: 346 RNSIDDVTPASVYTSNPYSLSTVPMHDLEGAIPDMSTESGQLMISKRTHLGTALLSLYYN 405

Query: 381 VNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAM 440
           VNGP+WYYP+FSQ ASGEGDKETF+ AASFY LP+YQ+++ TGV+GYHR    G+RGVAM
Sbjct: 406 VNGPTWYYPLFSQGASGEGDKETFIAAASFYQLPFYQVRTVTGVDGYHR--SSGYRGVAM 463

Query: 441 LQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYKTYFGADEPNYPNEVDIMF 500
           LQHD  QDY RY  +++    KY A    +Y+SSY++++FY TYFG      P  +D+MF
Sbjct: 464 LQHDFRQDYERYTHSKEDTEAKYAA-GSAAYESSYNVNDFYNTYFGTYNSQEP--LDVMF 520

Query: 501 AHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELENFKAINEYVCVKRTNVK 560
            HS+ PK EP +L  + DL+ +G+HIRSY+ L +++ YD+EL +F+  NEY+C KR   K
Sbjct: 521 VHSNLPKLEPLSL--STDLMEDGQHIRSYSNLKRLHGYDIELRSFQTFNEYLCDKRVKFK 578

Query: 561 YLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVS 595
           Y  + L     W SMCDYI+ RL++L+ TH +A++
Sbjct: 579 YYEKTLIDEESWTSMCDYIKGRLSFLERTHDEALN 613

>Kpol_1036.50 s1036 complement(135897..137927) [2031 bp, 676 aa]
           {ON} complement(135897..137927) [2031 nt, 677 aa]
          Length = 676

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/544 (55%), Positives = 403/544 (74%), Gaps = 6/544 (1%)

Query: 58  ISRNPAVDVGLNAGREPIANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDI 117
           I  N  +D  L+       +     LK+FY +VFE ++ +SP  KS R Y + C L+GDI
Sbjct: 133 IQINSMLDEHLSTDSIQDLDENTKSLKQFYGRVFELIQAHSPLGKSKRNYKEACLLNGDI 192

Query: 118 GFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVT 177
           G RPE Y  W+KL+ +EL  CL +S A+++KL+  H+ Y+  + SL LP+NS++G+GIV 
Sbjct: 193 GDRPEFYEVWYKLSMKELGNCLEISKAEMSKLKAKHAKYIADISSLSLPRNSFRGKGIVI 252

Query: 178 VGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGE-TDLCETVFSKYNAKCIFLSDIL 236
           VGGGKFSL++ L+I  +RN  TTLPVEVF+P +D+GE  + C+ +  + NAKCI+LSD+L
Sbjct: 253 VGGGKFSLLSFLIINAIRNQGTTLPVEVFMP-NDKGEDAEFCK-LLPELNAKCIYLSDVL 310

Query: 237 PAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPD 296
           P  ++ +F+F GYQFKS+AL+ SSF+D+L LDADN+P+K LD IF ++PY STGLVLWPD
Sbjct: 311 PEETIDQFKFGGYQFKSIALLLSSFDDLLLLDADNYPIKNLDEIFTKEPYKSTGLVLWPD 370

Query: 297 FWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVS 356
           FWRRTT P +Y IAGI V+ KKRVRN  DD+TPPEVYT+N+G+L NVP HDLEGSIP+ S
Sbjct: 371 FWRRTTTPFYYKIAGITVNSKKRVRNSIDDITPPEVYTENMGNLVNVPLHDLEGSIPDGS 430

Query: 357 TESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYY 416
           TESGQLMI+KSKHL TILL+LYYNVNGP+WYYPMFSQ+A+GEGDKETF+ AA F  LP+Y
Sbjct: 431 TESGQLMINKSKHLATILLSLYYNVNGPNWYYPMFSQKAAGEGDKETFVAAAVFNKLPFY 490

Query: 417 QLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYS 476
           Q+K+ TGV+GYH+ D +GFRGVAMLQ D  QDY+RYK A++AI  +Y  +   +YD  YS
Sbjct: 491 QVKTNTGVDGYHQADNKGFRGVAMLQFDFHQDYLRYKRAKEAIEYQYQDKNLRTYDKRYS 550

Query: 477 LHEFYKTY--FGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSK 534
           L++FY+ Y     D     +E D+MF HS+ PKF+P  LW+ QDLI  GKHIRS+  L +
Sbjct: 551 LNDFYRKYIMINDDRNGGTSEADVMFVHSNLPKFDPVGLWRGQDLIEHGKHIRSFRNLQR 610

Query: 535 INRYDLELENFKAINEYVCVKRTNVKYLNENLATSAE-WASMCDYIRDRLAYLQSTHVQA 593
           +N YD+ELENF    +++C+KR + KYL + L  + E W  MC YI+DR+ +L  +H +A
Sbjct: 611 LNNYDIELENFTIFYKHLCLKRRSFKYLEDELGDNEEDWKDMCKYIKDRVTFLNMSHQRA 670

Query: 594 VSPS 597
           ++P+
Sbjct: 671 ITPN 674

>NDAI0G01790 Chr7 (392941..394764) [1824 bp, 607 aa] {ON} Anc_3.188
          Length = 607

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/577 (50%), Positives = 395/577 (68%), Gaps = 20/577 (3%)

Query: 33  DEGLSVSEYQDYIKSYLGNAQPADTISRNPAVDVGLNAGREPIANGGNAK---------L 83
           +  +SV EY++Y++ Y+ N  P   I  N  V+       + + +G N +         +
Sbjct: 34  NSSISVQEYKEYLQGYI-NKLP---IQSNSNVNDDTQKEFQHLVSGENKEDIPSIKKNTV 89

Query: 84  KKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVSN 143
           + FY  VF+++ +YSPS K+AR YS +C L   I  RP++Y +W KL+ + L  CL VS 
Sbjct: 90  EDFYNVVFQNIIDYSPSGKTARNYSSKCKLDQGIASRPDSYKDWEKLSMQNLLNCLEVSP 149

Query: 144 ADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPV 203
            +   L  SH ++V+ +  LVLPK +Y   GIV VGGGKF+ MA LV+KTLRN  TTLPV
Sbjct: 150 EEFTNLSTSHHNFVEHVNKLVLPKGTYNNDGIVMVGGGKFTFMAYLVLKTLRNQGTTLPV 209

Query: 204 EVFIPPSDE-GETDLCET-VFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSF 261
           E+FIPP D   E   C++ + S+ +AKCI++S+ILP   ++KF F GYQFKSLA+IASSF
Sbjct: 210 EIFIPPIDTVKEETFCKSEMLSELSAKCIYMSNILPQEMIEKFDFKGYQFKSLAIIASSF 269

Query: 262 EDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVR 321
           E++L LDADNFP+K+LD IF+ +PY+STGLV+WPDFWRRTTQP++Y +A I V+  KRVR
Sbjct: 270 ENLLLLDADNFPIKSLDKIFKHEPYNSTGLVMWPDFWRRTTQPIYYKLADIYVNVLKRVR 329

Query: 322 NCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNV 381
           N  DD+TP +VY+ +  D + +PFHD EG++P+ STESGQLMI+KSKHLPT+LLALYYNV
Sbjct: 330 NDIDDITPTKVYSDDNFDFTKIPFHDFEGTMPDDSTESGQLMINKSKHLPTVLLALYYNV 389

Query: 382 NGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAML 441
           NGP+WYYP+FSQ A GEGDKETF+ AA+FY LP+YQ+++  G +GYH  D   F+GVAM 
Sbjct: 390 NGPNWYYPIFSQNAHGEGDKETFIAAATFYRLPFYQVRTKVGADGYHTKD--RFQGVAMA 447

Query: 442 QHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFA 501
           QHD  QDY  Y+ AQ+ I  +Y     I YD+ Y++ +FY  +F  D   Y  E+DIMF 
Sbjct: 448 QHDFIQDYEHYQIAQREIKKRYSNVKDIKYDAEYAVQKFYDEFFNKDTTKY-GEIDIMFL 506

Query: 502 HSHAPKFEPYTLWKNQDLIWE-GKHIRSYTALSKINRYDLELENFKAINEYVCVKRTNVK 560
           HS+ PKF+P  LW++  LI E GKH RS++    + +YD+E ENFK I + +C K  +  
Sbjct: 507 HSNLPKFDPLKLWEDSALIDETGKHFRSFSDPKIVKKYDIEYENFKIIKDVICDKGIHFS 566

Query: 561 YLNENLATS-AEWASMCDYIRDRLAYLQSTHVQAVSP 596
           YL+E L     +W SMC YI+DR  +L+ TH  A SP
Sbjct: 567 YLDEELQEKPQDWVSMCQYIKDRYIFLKDTHQDATSP 603

>TPHA0C04560 Chr3 (983249..984970) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/533 (49%), Positives = 372/533 (69%), Gaps = 6/533 (1%)

Query: 67  GLNAGREPIANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNE 126
           GL    EP +   +  +KK +  +F+ +K +SP  +  R+ +  C L G +G    +   
Sbjct: 41  GLENNNEP-SFASDPSIKKTFSSIFDAIKKHSPDKEVVRKKNDNCLLDGTVGTGNNDVKN 99

Query: 127 WFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLM 186
           W +L+++ +  CL +S++++  L+  H  Y+++L  + + K  YKG+GI  VGGGKFSL+
Sbjct: 100 WHRLSQKSMEGCLELSDSEINTLKSKHDAYIQSLEEIAVEKIHYKGKGIAIVGGGKFSLL 159

Query: 187 ALLVIKTLRNLHTTLPVEVFIPPSD-EGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQ 245
           A LV+KT+R   TTLP+E+FIPP D E E + C+ +  + NAKCI+LSDILP+  +KK++
Sbjct: 160 AFLVVKTIRKFETTLPIEIFIPPQDVEDELEFCQQLLPEDNAKCIYLSDILPSQDIKKYE 219

Query: 246 FTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPL 305
           F  YQ+KSLA++ASSF+D+L +DADNFP+K LD IF+ +PY STGL+LWPDFWRR+  P 
Sbjct: 220 FKRYQYKSLAILASSFDDLLLIDADNFPIKNLDGIFDNEPYTSTGLILWPDFWRRSANPK 279

Query: 306 FYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMIS 365
           FY+I GI++D KKRVRN  DDLTPPEVYT++   L++VPFHD  G++P+ STESGQ+MI+
Sbjct: 280 FYEITGIELDTKKRVRNAIDDLTPPEVYTEDFSKLADVPFHDFSGTLPDPSTESGQMMIN 339

Query: 366 KSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVE 425
           K KH+ T+LLALYYNVNGPSWYYP+ SQ A+GEGDKET + AA      +YQ+K  TGVE
Sbjct: 340 KGKHMKTLLLALYYNVNGPSWYYPILSQGAAGEGDKETVIAAALHNKAKFYQVKFKTGVE 399

Query: 426 GYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYKTYF 485
           GYH+ +G+GFRGVAMLQHD  QD+ RY+ A   I   Y  ++   +DS YS+  FY+ Y 
Sbjct: 400 GYHQSNGRGFRGVAMLQHDFVQDFARYEDATARIKELYSTESFKQFDSGYSIDAFYEKYI 459

Query: 486 ---GADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLEL 542
                D P    ++D++F HSH PKF+P  LW++QDLI +GKH RSYT+L KIN +D+EL
Sbjct: 460 SQVNTDIPEEKRKIDVLFVHSHLPKFDPVPLWQSQDLIEDGKHFRSYTSLKKINYFDIEL 519

Query: 543 ENFKAINEYVCVKRTNVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVS 595
           +NF+  ++Y+C       Y+ +N    A+   +C+YI++RL+YLQ TH    S
Sbjct: 520 QNFEIFDKYICQDTIAFPYI-KNEVKDADMPDLCNYIKNRLSYLQETHESVTS 571

>AER018C Chr5 complement(661035..662855) [1821 bp, 606 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR015C
           (MNN2)
          Length = 606

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/510 (50%), Positives = 358/510 (70%), Gaps = 8/510 (1%)

Query: 86  FYEQVFEDLKNYSPSSKSAREYSKQCSLSGDI-GFRPENYNEWFKLTERELSQCLVVSNA 144
           FY++VFE L  +SPS + + +  +QC +S  +     ++ + W  LT   LS+CL ++  
Sbjct: 101 FYQKVFELLAEHSPSGQISHKSGRQCQVSQVVLQGHLDDTSHWPLLTREHLSKCLKMTQK 160

Query: 145 DVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVE 204
           D   +   H  YV AL +L L K +Y G GIVTVGGGKFS++ALL+IK+LR + T+LPVE
Sbjct: 161 DKQMVSDKHMHYVDALSNLKLSKRAYSGAGIVTVGGGKFSMLALLLIKSLRKVGTSLPVE 220

Query: 205 VFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDV 264
           V IPP +E E D C  +  +  AKCI+L D+LP   +    F GYQ KS A+IASSF+D+
Sbjct: 221 VLIPPGEEEEYDYCSKLLPEVGAKCIYLKDVLPPAVINNHYFEGYQLKSAAIIASSFKDL 280

Query: 265 LFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCF 324
           L LDADN P+  LD IF+  PY   GLVLWPDFWRR+T P +Y+IA +QVD  +RVRN  
Sbjct: 281 LLLDADNIPILNLDDIFQSKPYVEHGLVLWPDFWRRSTSPDYYEIARVQVDYNRRVRNHI 340

Query: 325 DDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGP 384
           D+LTP  VYT+N+ DLS++P HD+EG++P+ STESGQL+I K +HL T+LL+LYYNVNG 
Sbjct: 341 DNLTPASVYTQNMKDLSSIPMHDMEGTLPDPSTESGQLLIDKERHLSTVLLSLYYNVNGE 400

Query: 385 SWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHD 444
           +WYYP+FSQ A GEGDKETF+ AA+FY  PYYQ++++TG EGYH    +GF GVAMLQHD
Sbjct: 401 TWYYPLFSQGAPGEGDKETFIAAANFYRKPYYQVRTSTGAEGYH--TKKGFSGVAMLQHD 458

Query: 445 VTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSH 504
             +DY RY+ A++ +  KY    +  YD  Y++  FYK YF  ++PN P  VD+MF H++
Sbjct: 459 FREDYRRYEAAREDVKTKYAKSQQ--YDPEYTVEGFYKKYF--EDPNQP-PVDVMFVHAN 513

Query: 505 APKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELENFKAINEYVCVKRTNVKYLNE 564
            PKFEP  + + Q L+  G H RSY+ L K++ YD+ELE+F+ +NEY+CV++  +K+  +
Sbjct: 514 LPKFEPLKMSEKQLLMENGSHFRSYSHLDKLHNYDIELESFRVLNEYLCVRKVQLKFYKD 573

Query: 565 NLATSAEWASMCDYIRDRLAYLQSTHVQAV 594
            L+  A+W SMC Y+ DRL +L+STH +A+
Sbjct: 574 KLSRPAKWNSMCKYVEDRLKFLESTHEEAL 603

>Kpol_1045.70 s1045 complement(162608..164461) [1854 bp, 617 aa]
           {ON} complement(162610..164463) [1854 nt, 618 aa]
          Length = 617

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/516 (49%), Positives = 348/516 (67%), Gaps = 7/516 (1%)

Query: 83  LKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVS 142
           +K FY +V++ L++  P   S R+Y + C L  DIG R  + ++W  LT+  LS+CL + 
Sbjct: 106 MKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQID 165

Query: 143 NADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLP 202
              +A L+ SH  Y+  L  L    + Y G GIV V GGKFSL++ LVIKT+RNL   LP
Sbjct: 166 EESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLP 225

Query: 203 VEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKK-FQFTGYQFKSLALIASSF 261
           +EVFIPP DEG+ +LC T+  KYNAKCIFLSD LP   + +  +  GYQ K +A+ ASSF
Sbjct: 226 IEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSF 285

Query: 262 EDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVR 321
           ++VL LDADN+P+K +D IF  +PY S GL+ WPD+WRR+T P +YDI    + + +RVR
Sbjct: 286 KNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVR 345

Query: 322 NCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNV 381
           N  DD+TPP VYT++L +  ++P HD EG++P+VSTESGQLMI+K KHL ++LLA+YYN+
Sbjct: 346 NNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNM 405

Query: 382 NGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAML 441
            GP+WYYP+ +Q+ASGEGDKETF+  A+F+ LP+YQ+K   G +GY RP   G+RGVAM 
Sbjct: 406 YGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRP--GGYRGVAMF 463

Query: 442 QHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFA 501
           QHD  QDY  Y+ A+  I  KY    +   D  YS  +F   +F  DE   P  +D+MF 
Sbjct: 464 QHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFF-EDEHADP-VIDVMFV 521

Query: 502 HSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELENFKAINEYVCVKRT-NVK 560
           H+H PKFEP  LW+  DL+ +G H+RSYT   K+N YDLE+ENFKA+ E +C+++    K
Sbjct: 522 HAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFK 581

Query: 561 YLNENLATSAE-WASMCDYIRDRLAYLQSTHVQAVS 595
           YL + L+   E W  +C YI+DR  +++ TH +  S
Sbjct: 582 YLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEEHFS 617

>KNAG0K01300 Chr11 (257271..259064) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/583 (46%), Positives = 386/583 (66%), Gaps = 38/583 (6%)

Query: 28  TSRFMDEGLSVSEYQDYIKSYLGNAQPADTISRNPAVDVGLNAGREPIANGGNAKLKKFY 87
           T  F D   +V EY+++++ YLG        + N  V V  +A           K+K +Y
Sbjct: 35  THHFHDGPKTVDEYKEFLQGYLGG-------NANTTVTVVNDAD----------KIKSYY 77

Query: 88  EQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVA 147
             VFE+L  +SP  ++AR Y  +C L+  IG   +N  ++ +L+   L  CL +SN +++
Sbjct: 78  NTVFENLLLFSPKGETARAYGDKCILNEAIGTTSDNIPKFERLSYENLLDCLKLSNEELS 137

Query: 148 KLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFI 207
            L+ SH+ +V++L  +  PK  Y+G GIV VGGGK+SLMA LVIK LR+  T+LPVEVFI
Sbjct: 138 ALKLSHNFFVQSL-DVKYPKGMYQGDGIVMVGGGKYSLMAYLVIKHLRSSGTSLPVEVFI 196

Query: 208 PPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFL 267
           PP++E ET+ CET   + NA+CIF+  ILP+  +K F F GYQFKSLAL++SSFE+VL L
Sbjct: 197 PPNEEDETEFCETALPELNAQCIFIDRILPSAMIKTFHFKGYQFKSLALVSSSFENVLLL 256

Query: 268 DADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDL 327
           DADN+PV+ LD IF+Q+P+ STGL+LWPDFWRRTT PLFY+I+G+ +D    VR  FDDL
Sbjct: 257 DADNYPVRRLDDIFKQEPFKSTGLILWPDFWRRTTTPLFYNISGVAIDLTSPVRYSFDDL 316

Query: 328 TPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWY 387
           TPPEVY  +  D S +P +D  G++P+VSTESGQL+I+K  HL TILL+LYYNVNGP+WY
Sbjct: 317 TPPEVYFNSTMDRSKIPVNDFAGAMPDVSTESGQLLINKRTHLKTILLSLYYNVNGPAWY 376

Query: 388 YPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQ 447
           YP+ +QRA GEGDK+TF+ AA+FYGLP+YQ+K+  G++GY   DGQ + GV MLQ+D  Q
Sbjct: 377 YPIIAQRAPGEGDKDTFIAAANFYGLPWYQVKTRVGIDGYSE-DGQ-YHGVGMLQYDFVQ 434

Query: 448 DYMRYKTAQKAISNKYGA---------QAKISYDSSYSLHEFYKTYFGADEPNYPNEVDI 498
           DY  Y++A++ I+ KYG          +++I+YD +YSL  F + YF  ++  +     +
Sbjct: 435 DYELYQSARRDITAKYGVAGPSKTGQLRSEIAYDENYSLDTFEEKYFNKEKSGH----KV 490

Query: 499 MFAHSHAPKFEPYTLWKNQDLI-WEGKHIRSYTALSKINRYDLELENFKAINEYVCVKRT 557
           MF H++ PKF+P +LW+++  I  +G   R+Y  L K N +D+EL NF +     C    
Sbjct: 491 MFIHANFPKFDPLSLWQDKKFINKQGSTYRTYNNLGKFNYWDIELYNFNSFETLFCSGAD 550

Query: 558 NVK---YLNENL-ATSAEWASMCDYIRDRLAYLQSTHVQAVSP 596
           +V    Y+N  L   + +  SMC YIR RL +L+ TH +A  P
Sbjct: 551 SVTWFPYMNRALQGNTNDRESMCSYIRMRLDHLEQTHHEATVP 593

>KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON} 
          Length = 640

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/516 (48%), Positives = 351/516 (68%), Gaps = 13/516 (2%)

Query: 83  LKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVS 142
           +++FY+++F  + + SP+ +S + Y K+C +   IG RP ++ +W KLT   LS+CL +S
Sbjct: 107 IQEFYDEIFNAIISNSPTEESKKVYGKECIVDTSIGGRPGDHKDWHKLTYDNLSKCLQLS 166

Query: 143 NADVAKLRQSHSDYVKALGSLV------LPKNSYKGQGIVTVGGGKFSLMALLVIKTLRN 196
           + +V  L   H  YV A+  +V      L     K  GIV VGGGK+SL++LL + T+R 
Sbjct: 167 DEEVDMLHTKHKSYVSAINQIVEDSKELLNGQRTKKNGIVMVGGGKYSLLSLLSVMTIRK 226

Query: 197 LHTTLPVEVFIPPSDEGETDL---CETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKS 253
             TTLPVEVFIP  DE + D    C  +  +YNAKCIF S++L    ++ F F GYQ KS
Sbjct: 227 FGTTLPVEVFIPRDDELKGDFQSFCNELLPQYNAKCIFTSNVLSEKLIENFHFNGYQHKS 286

Query: 254 LALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQ 313
           LAL+ASSF+++L LD+DN P+K LD IF+ +P+   G+VLWPDFWRRTT P FY IAGI 
Sbjct: 287 LALLASSFDNILLLDSDNHPIKNLDSIFKAEPFVKNGMVLWPDFWRRTTSPKFYQIAGIP 346

Query: 314 VDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTI 373
           +++  RVRNC DDLTP EVY     ++ +VPFHD EG+ P++S+ESGQL+I++++HL +I
Sbjct: 347 INKNTRVRNCIDDLTPLEVYNNEEINIYDVPFHDTEGTFPDMSSESGQLLINRNRHLKSI 406

Query: 374 LLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQ 433
           LLALYYN NGP+WYY +FSQ A+GEGDKETF+  A FYGLPYYQ+K+   V GYH+P   
Sbjct: 407 LLALYYNYNGPAWYYSIFSQGAAGEGDKETFIAGAHFYGLPYYQVKTFPSVSGYHQPGNS 466

Query: 434 GFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYKTYF--GADEPN 491
            FRGVA+LQHD+ QDY RY+ A   +   Y     ++YD +YSL  FY  YF  G +EP+
Sbjct: 467 EFRGVAILQHDLVQDYQRYQEASIGLGKTYEFPENVTYDENYSLGTFYNKYFDGGNNEPD 526

Query: 492 YPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELENFKAINEY 551
              EVD  F H++ PKF+P +L +    I+EG+H RS+T L+K+N YD+E ENF  ++++
Sbjct: 527 V-KEVDFAFVHANFPKFDPVSLAEGSSFIFEGQHFRSFTDLTKLNGYDIEYENFVTLHDF 585

Query: 552 VCVKRTNVKYLNENLATSAEWASMCDYIRDRLAYLQ 587
           VCV R    Y+ ++++   E+  MC YI DRL +L+
Sbjct: 586 VCVNRKYFPYIEKSIS-KEEYEKMCRYISDRLQFLR 620

>NDAI0A06500 Chr1 complement(1475305..1477218) [1914 bp, 637 aa]
           {ON} Anc_3.188
          Length = 637

 Score =  508 bits (1308), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 242/516 (46%), Positives = 340/516 (65%), Gaps = 8/516 (1%)

Query: 83  LKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVS 142
           + KF++QVF  +  +SP +K   +Y+    ++  IG R  +   +FKL+   L  CL +S
Sbjct: 126 IHKFFDQVFNYINEFSPETKLDIKYNPSRLVTDAIGSRRNDVKNFFKLSRNSLYDCLQIS 185

Query: 143 NADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLP 202
           + ++  L+  H  +  ++  L LPKN+Y+  GIV VGGGK+SL++LL IKTLR  +TTLP
Sbjct: 186 DQEIDMLKNYHQGFTNSIAPLELPKNTYQNDGIVIVGGGKYSLLSLLAIKTLRKFNTTLP 245

Query: 203 VEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFE 262
           VEV+I   +EG+ + C+ +  +YNAKCI + +IL    +  F+F GYQ+KSLA+++SSFE
Sbjct: 246 VEVYISQDEEGDLEFCDEILPQYNAKCISIKNILSNDLINTFKFAGYQYKSLAVLSSSFE 305

Query: 263 DVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRN 322
           ++L LDADNFP+K LD IF+Q+PY S  +V+WPDFWRRTT P +YDIA I V++  R+RN
Sbjct: 306 NLLLLDADNFPIKPLDDIFKQEPYLSKRMVMWPDFWRRTTHPSYYDIAHIFVNKSSRIRN 365

Query: 323 CFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVN 382
            +DD+TP  VYT     L  +PFHD EG++P++STESGQL+++K +HL  ILLALYYNVN
Sbjct: 366 SYDDVTPSNVYTDYSKSLDEIPFHDFEGTLPDLSTESGQLLLNKKEHLKAILLALYYNVN 425

Query: 383 GPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQ 442
           GP+WYYP+FSQ  +GEGDKETFL  A+FY L YYQ+K+   V G+   +   +RGVA+LQ
Sbjct: 426 GPNWYYPIFSQGVAGEGDKETFLAGANFYNLTYYQVKTYPRVSGHFNKEDGSYRGVAILQ 485

Query: 443 HDVTQDYMRYKTAQKAISNKYG--AQAKISYDSSYSLHEFYKTYFGADEPNYPNEVDIMF 500
            D   DY RY  A   I++KY   +  +I  D  Y L  F   YF  +      + D+MF
Sbjct: 486 SDFVDDYKRYSHAMDDINSKYKDLSPNEIKLDEDYDLQNFLDKYFELE----GKQADVMF 541

Query: 501 AHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELENFKAINEYVCVKRTNVK 560
            H++ PKF+P  L      I EGKH RS+  L  I  YDLELE FK +N  +CV+R + K
Sbjct: 542 IHANFPKFDPVDLESGSSFIHEGKHFRSFDNLKDIKYYDLELETFKILNNIICVERKHFK 601

Query: 561 YLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVSP 596
           Y+++      E   +C YI DRL +L+ TH +A++P
Sbjct: 602 YIDD--KGVEERGKVCKYIEDRLKFLEETHEEAITP 635

>KAFR0G00280 Chr7 (92838..94577) [1740 bp, 579 aa] {ON} Anc_1.150
           YJL186W
          Length = 579

 Score =  400 bits (1027), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 212/535 (39%), Positives = 315/535 (58%), Gaps = 27/535 (5%)

Query: 86  FYEQVFEDLKNYSPSSKSAREYS---KQCSLSGDIGFRPENYNEWFKLTERELSQCLVVS 142
           FY +V+E L +  P    + + S     C L  D+G    + + + KL+   L +C  +S
Sbjct: 48  FYSEVYELLISSKPMDPPSDKNSFRLTSCDLPKDVGIN--DLDRFEKLSFDNLQRCYHLS 105

Query: 143 NADVAKLRQSHSDYVKALGSLV------LPKNSYKGQGIVTVGGGKFSLMALLVIKTLRN 196
           N     L+++HS YVK++  L+      + K+  K +GI+TVGGG++S++   +I+ LR 
Sbjct: 106 NEQAQDLQKAHSSYVKSIKDLIDNHSNIISKDDEKKKGILTVGGGRYSVLLFTMIQKLRE 165

Query: 197 LHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLAL 256
             TTLPVEV IPP DEG+ + C  +  ++NAKCI+  D LP   L K     YQ K+L L
Sbjct: 166 TGTTLPVEVLIPPQDEGDDEFCNVILPQFNAKCIYFKDYLPPNLLDKLVLKSYQIKALGL 225

Query: 257 IASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDR 316
           + +SF  +LFLDADN+P+K L++IFE + +   GL+ WPD WRR T P +Y+IA I  + 
Sbjct: 226 LMTSFNQILFLDADNYPMKNLNYIFETESFQKYGLITWPDIWRRYTPPAYYNIADIDFNL 285

Query: 317 KKRVRNCFDDLTPPEVYTKNLGDLSN------------VPFHDLEGSIPEVSTESGQLMI 364
           +KRVR   DD++P   Y      L N            VPFHDLEG+I +++TESGQ++I
Sbjct: 286 EKRVRFETDDISPVSRYDDIFPTLLNDERKLTEYTSSKVPFHDLEGTISDLTTESGQMLI 345

Query: 365 SKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGV 424
            K KHL T+LLA YYN  GPSWYY MFS  +SGEGDKETF++AA   G PYYQ+KS    
Sbjct: 346 DKKKHLDTLLLAFYYNFYGPSWYYNMFSLGSSGEGDKETFISAAHALGKPYYQVKSKVEF 405

Query: 425 EGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYKTY 484
           +G+   D  GF+G+ ++QHD  QDY  +K A   ++      +K  Y+S Y L   +   
Sbjct: 406 DGFFH-DKDGFQGLGLMQHDFEQDYQVHKNAMLEVAGNPDKYSK--YESDYKLETSFTDQ 462

Query: 485 FGADEPNYPNEVDIMFAHSHAPKFEPYTLW-KNQDLIWEGKHIRSYTALSKINRYDLELE 543
           F     N  + VDIMF H+   KFEP  L  KN+  + +   +R +  + ++N +DLEL 
Sbjct: 463 FLRKYNNKKDLVDIMFVHASFFKFEPLELHSKNRYYMSDNSPLRGFKRMDRMNNFDLELF 522

Query: 544 NFKAINEYVCVKRTNVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVSPSK 598
           NF+ + + +C  +     + E+   + EW S+C+Y+  R+ +L+ TH +A++ +K
Sbjct: 523 NFQILRDNLCSTKPVAFKVYEDKYDTDEWKSVCEYLDKRVTFLKKTHEEAINAAK 577

>Kwal_33.13693 s33 (354321..355997) [1677 bp, 558 aa] {ON} YJL186W
           (MNN5) - putative Golgi alpha-1,2-mannosyltransferase
           [contig 114] FULL
          Length = 558

 Score =  397 bits (1021), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/537 (40%), Positives = 316/537 (58%), Gaps = 30/537 (5%)

Query: 77  NGGNAKLKKFYEQVFEDLKNYSP--SSKSAREYSKQ--CSLSGDIGFRPENYNEWFKLTE 132
           N G +  +K Y  +F  L+ + P  + K+ RE  KQ  C++ G +G    N  +    T 
Sbjct: 30  NPGPSVAEKVYSDLFSALEKHKPIDAPKNMREAVKQQGCNMKG-VGV---NKGDDVSPTV 85

Query: 133 RE-LSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSY--------KGQGIVTVGGGKF 183
            E L  C   S A    L+  H+ Y+ AL S    +N            +G VTVGGG+F
Sbjct: 86  YENLDACFRPSKAQFEGLQAPHTAYLAALRSTFNYQNEPGVFNELFPNDKGFVTVGGGRF 145

Query: 184 SLMALLVIKTLRNLHTTLPVEVFIPPSDE-GETDLCETVFSKYNAKCIFLSDILPAPSLK 242
           SL++  +I+T+R   +TLP+EV IPP DE GE   C+ +  K N +C+F  D LP   ++
Sbjct: 146 SLLSYTMIRTMRERGSTLPIEVVIPPQDEKGEEHFCQEILPKLNGRCVFFGDTLPPSIVE 205

Query: 243 KFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTT 302
            ++F  YQ K +AL+ SSF+ ++F+DAD+ P+K LD +FE   +   GLVLWPD WRR T
Sbjct: 206 DWKFKSYQIKVMALLLSSFKKIVFIDADDLPLKNLDDVFESKVFKKNGLVLWPDLWRRMT 265

Query: 303 QPLFYDIAGIQVDRKKRVRNCFDDLTPPEVY-TKNLGDLSNVPFHDLEGSIPEVSTESGQ 361
            P+FY +A I  D  KRVRN  DD++P   Y   N  +   +PFHD  G+IP+ +TESGQ
Sbjct: 266 APVFYRLANIDTDLTKRVRNLGDDISPVSRYLNPNAKEQKPIPFHDFAGTIPDPTTESGQ 325

Query: 362 LMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSA 421
           ++I K +H  T+LLALYYNV GP WYY +FSQ  +GEGDKETF +AA    LPYYQ+++ 
Sbjct: 326 MVIDKVRHFQTLLLALYYNVYGPDWYYALFSQGTAGEGDKETFASAAHVLELPYYQVRTK 385

Query: 422 TGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAIS---NKYGAQAKISYDSSYSLH 478
              +GY  P   GFRGVA+ QHD TQDY  Y+ A++ +    +KY A  K  YDS     
Sbjct: 386 LSFDGYSDPKDGGFRGVALYQHDCTQDYETYEQARELVKSQPDKYSA-FKEDYDSE---P 441

Query: 479 EFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWE-GKHIRSYTALSKINR 537
           +FY++     +P    EV++MFAH+   KF+P+ L+K +  + E G   RS+  L +I  
Sbjct: 442 DFYQSLM---KPEGKPEVEVMFAHASFHKFDPWQLFKEKVYLNEDGTQFRSFRRLHRIKH 498

Query: 538 YDLELENFKAINEYVCVKRTNVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAV 594
           +D+EL NF+ + E +C ++       E+     EW  +C Y++DR+ YL+ TH +AV
Sbjct: 499 FDIELFNFEVLEEAMCSEQPIRFRYFEDKFKREEWPKVCQYVKDRVEYLKKTHDEAV 555

>NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150
          Length = 587

 Score =  395 bits (1016), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 210/535 (39%), Positives = 317/535 (59%), Gaps = 35/535 (6%)

Query: 83  LKKFYEQVFEDLKNYSP----SSKSAREYSKQCSLSGDIGFRP-ENYNEWFKLTERELSQ 137
           +++FY  +F  +  Y P    S+      +++C   GDI     + +NE+  L+   L++
Sbjct: 62  VERFYIDLFNSINQYRPLNPPSNPDDLRDTEKCKWHGDISVHDFDKFNEY--LSYNNLNE 119

Query: 138 CLVVSNADVAKLRQSHSDYVKA-----------LGSLVLPKNSYKGQGIVTVGGGKFSLM 186
           C  +SN  +  L++SHS +V++           L S + P N    +GIVTVGGGK++++
Sbjct: 120 CYKLSNIQLNNLKRSHSGFVESILSEFSTKDDKLTSGLFPNN----EGIVTVGGGKYTVL 175

Query: 187 ALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQF 246
            + +I+ LR   TTLP+EV IPP DEG+ + C  V   YN KCI+  D+LP     K   
Sbjct: 176 LMTMIEKLRQSGTTLPLEVIIPPQDEGDDEFCNNVLPNYNGKCIYFKDVLPDQLSDKLVI 235

Query: 247 TGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLF 306
            G+Q K LA++ SSF+  LFLDADN  +K LD+IF    +    L++WPD WRR T P +
Sbjct: 236 KGFQLKPLAILLSSFKKALFLDADNLAMKDLDNIFNTQAFKQKRLIVWPDVWRRFTAPAY 295

Query: 307 YDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGD----LSNVPFHDLEGSIPEVSTESGQL 362
           Y IA I++D  KR+RN  DD++PP  Y  N  +    L NVPFHDL+G+IP+ ++ESGQ+
Sbjct: 296 YKIANIKLDLGKRIRNLNDDVSPPSRYDDNSENSAQYLENVPFHDLKGTIPDPTSESGQM 355

Query: 363 MISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSAT 422
           +I K +H  T++L+LYYN+ GP WYY MFSQ  SG+GDKETF+ AA   G PYYQ+ +  
Sbjct: 356 VIDKIEHFHTLILSLYYNLYGPPWYYRMFSQGTSGQGDKETFIAAAHALGKPYYQVHTKM 415

Query: 423 GVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYK 482
           G +GY+  +  GF+GV +LQHD  QD+ + + A K I+      +K   D   ++     
Sbjct: 416 GFKGYND-EKLGFQGVGLLQHDFEQDFKQLQLASKTINENESEYSKFKQDYKATVDFDDS 474

Query: 483 TYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWE-GKHIRSYTALSKINRYDLE 541
                D P     +DIMF H+   K+EP  L +    + E G H R ++ L ++N +DLE
Sbjct: 475 LMKPIDGP-----IDIMFLHASFFKYEPLDLIREHRYVKEDGSHFRVFSGLERLNYFDLE 529

Query: 542 LENFKAINEYVCVKR-TNVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVS 595
           L NFK +N+++C +   + KY  +N+ +  EW+ MC ++++   YL+STH +A +
Sbjct: 530 LFNFKILNKFLCTEEMIHFKYY-KNVESKPEWSDMCKFLKEHTEYLESTHKEATA 583

>NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa]
           {ON} Anc_1.150
          Length = 586

 Score =  392 bits (1008), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 214/540 (39%), Positives = 322/540 (59%), Gaps = 41/540 (7%)

Query: 82  KLKKFYEQVFEDLKNYSPSS-----KSAREYSKQCSLSGDIGFRPENYNEWFKLTERELS 136
           +++ FY  +F  +  Y P +     +  R+  K C  SGDI    +  +   +L+   L 
Sbjct: 56  QVEAFYLDLFNSINQYRPLNPPGNWEDLRDKDK-CKWSGDISVNDDGRDANERLSMENLD 114

Query: 137 QCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSY-------KGQGIVTVGGGKFSLMALL 189
           +C  +S+  +  L+++HS YVK +      KN            GIVT+GGG+++++ + 
Sbjct: 115 ECFKLSSIQLNNLKRAHSGYVKNIRDKFDDKNERLTNSLFPNNVGIVTIGGGRYTVLLMT 174

Query: 190 VIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGY 249
           +I  LR+  T+LP+EV IPP DEG+ D C  +  K+N KC+F  D+LP    KK     Y
Sbjct: 175 MIAKLRDTGTSLPIEVIIPPEDEGDDDFCNVILPKWNGKCVFFKDVLPDELNKKLMLQSY 234

Query: 250 QFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDI 309
           Q K LA++ SSF+ +LFLDADN+ +K LDHIFE +P+   GL++WPD+WRR T P +Y I
Sbjct: 235 QIKPLAVLLSSFKKILFLDADNYAMKDLDHIFESEPFIENGLIVWPDYWRRVTPPAYYKI 294

Query: 310 AGIQVDRKKRVRNCFDDLTPPEVYTKNLGD----LSNVPFHDLEGSIPEVSTESGQLMIS 365
           A I + +KKR+RN  DD+TPP  Y   L D    L  VP HDLEG+IP+ ++ESGQ++I 
Sbjct: 295 ADINISKKKRIRNINDDITPPSYYDNKLKDRDHLLKEVPMHDLEGTIPDPTSESGQMVID 354

Query: 366 KSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVE 425
           K KH  T+LL+LYYN+ GPSWYY +FSQ  SG+GDKETF+ AA     PYYQ+ ++ G++
Sbjct: 355 KVKHFHTLLLSLYYNLYGPSWYYQIFSQGTSGQGDKETFIAAAHALNKPYYQVTTSLGLK 414

Query: 426 GYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYKTYF 485
           G+   +   FRG+ +LQ D  QDY +++  ++ I +             YS  EF + Y 
Sbjct: 415 GFFYEN--EFRGIGLLQRDFQQDYAQHQLVKQTIQDHL---------EEYS--EFKEDYK 461

Query: 486 GADEPNY-----PN--EVDIMFAHSHAPKFEPYTLWKNQDLI-WEGKHIRSYTALSKINR 537
            ADE N      PN   +D+MF H+   K+EP+ L+  +  +  +G H R ++ L + N 
Sbjct: 462 VADEFNKKLMIPPNGQPLDVMFVHASFYKYEPWDLYNERRYVNSDGTHFRGFSDLKEFNY 521

Query: 538 YDLELENFKAINEYVCV--KRTNVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVS 595
           +D+EL NFK + + +C   K+   K+ N+ +  S EW +MC Y++D + +LQ TH +AV+
Sbjct: 522 FDMELFNFKILRDTLCSPNKKVEFKFYNDKVF-SPEWDNMCTYLKDHVNFLQETHSEAVA 580

>SAKL0C04598g Chr3 (447448..449283) [1836 bp, 611 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 611

 Score =  390 bits (1003), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/558 (40%), Positives = 325/558 (58%), Gaps = 31/558 (5%)

Query: 61  NPAVDVGLNAGREPIANGGN--AKLKKFYEQVFEDLKNYSPSS--KSAREYSKQCSLSGD 116
           + A ++    G    A G +  A   + Y ++F  L+ Y P +  K      +   +  D
Sbjct: 62  DSAFELAKEEGASAAARGKDEFAGPNELYSKLFGYLQRYKPVAPPKDKAALRQSGCVMRD 121

Query: 117 IGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKAL--------GSLVLPKN 168
           +G   ++   +  L    L +C  +S      L  +H+ YV  L         S +L K 
Sbjct: 122 VGLADDS--RFSNLAYNNLDRCYNLSPEQFDSLHSNHAKYVSKLKKEFELGPDSPLLDKL 179

Query: 169 SYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAK 228
               +GIVTVGGG+FSL++L +I+ LR   TTLPVEV IPP+DEGE D C  V    N  
Sbjct: 180 FPNEKGIVTVGGGRFSLLSLTMIRVLRERGTTLPVEVVIPPADEGEDDFCNNVLPALNGT 239

Query: 229 CIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHS 288
           C++ SD+L   +L +  F  YQ K +AL+ SSF++ +FLDADNF +K LD+IFE + Y  
Sbjct: 240 CVYFSDVLSKSTLNQVTFERYQIKGVALLLSSFKNTIFLDADNFAIKPLDNIFESEAYLE 299

Query: 289 TGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDL----SNVP 344
            GLVLWPD WRR T P+FY+++ +++D  KR R   DD+TP   Y K   DL    + VP
Sbjct: 300 HGLVLWPDLWRRVTAPVFYNVSDVELDLTKRARFIGDDVTPASKYHKPDADLAYNKAEVP 359

Query: 345 FHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETF 404
            HDL+G+IP+ S+ESGQ+++ K +H  T+LLALYYN  GP WYY MFSQ  SGEGDKETF
Sbjct: 360 LHDLDGAIPDPSSESGQMIVDKREHFQTLLLALYYNYYGPDWYYRMFSQGTSGEGDKETF 419

Query: 405 LTAASFYGLPYYQLKSATGVEGY--HRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNK 462
           + AA     PYYQ+KS  G  GY     DG GF+G A+LQHD  QDY ++K A + + + 
Sbjct: 420 VAAAHVLSKPYYQVKSKLGFAGYWDEYTDG-GFKGAALLQHDFVQDYGQHKKALEVVRSN 478

Query: 463 YGAQAKISYDSSY-SLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQD-LI 520
           Y    +  +D +Y S  +FYK       P+   E D+MF H+   KF+P+ L++ +  L 
Sbjct: 479 YDEYTR--FDPNYNSEKDFYKKLM---VPDGKEETDVMFVHASFHKFDPWDLYRRKTYLK 533

Query: 521 WEGK-HIRSYTALSKINRYDLELENFKAINEYVCV-KRTNVKYLNENLATSAEWASMCDY 578
            +GK   RSY  L ++  +DLEL NF+ + + +C  K+   KYL + + TS EW  MC+Y
Sbjct: 534 PDGKSQFRSYRDLKRLGGFDLELFNFEVLEDALCAGKQIGFKYLQDKV-TSQEWPGMCEY 592

Query: 579 IRDRLAYLQSTHVQAVSP 596
           + DR+ +L+ TH +A+ P
Sbjct: 593 VHDRVQFLKETHAEALGP 610

>TBLA0D03030 Chr4 complement(734007..735824) [1818 bp, 605 aa] {ON}
           Anc_1.150 YJL186W
          Length = 605

 Score =  389 bits (998), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 207/543 (38%), Positives = 314/543 (57%), Gaps = 39/543 (7%)

Query: 75  IANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSK----QCSLSGDIGFRPENYNEWFKL 130
           + N  N     FY  +F  +    P + S ++  +    +C L  DI     +     ++
Sbjct: 65  LDNSSNNFRDNFYTFMFSAIARGKPVNPSVKDLKQSKRSECKLESDISMTDNSPGSLSRV 124

Query: 131 TERELSQCLVVSNADVAKLRQSHSDYVKALGSLV--LPKNSY------KGQGIVTVGGGK 182
           +   L  CL +S   +  L+  HS++++ L + +  L K  +       G+GIVT+GGGK
Sbjct: 125 SFNSLLNCLSISRPQLDNLKYVHSNFIQLLEAKMSELTKPEFLDQIFPNGRGIVTIGGGK 184

Query: 183 FSLMALLVIKTLRNLHTTLPVEVFIPPSDE-GETDLCETVFSKYNAKCIFLSDILPAPSL 241
           FS++A+ VIK LR   +TLPVEV IPP DE  E D C      YNAKC+F  D+LP    
Sbjct: 185 FSVLAMNVIKVLRKTGSTLPVEVVIPPQDEKNEVDFCNNFLPNYNAKCVFFKDVLPKHYA 244

Query: 242 KKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRT 301
           +  +  GYQ K +AL+ SSF++++FLD+DN+P+K+LDH+F+ D Y   GL+LWPD WRR 
Sbjct: 245 ENLRLKGYQIKVMALLISSFKEIIFLDSDNYPLKSLDHVFDADIYKEAGLILWPDIWRRV 304

Query: 302 TQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYT---------KNLGDLSNVPFHDLEGSI 352
           T P++YDIA + VD  +RVR   DD++PP  YT         K + + + +PFHDL G++
Sbjct: 305 TNPMYYDIANVSVDINQRVRYGTDDISPPNRYTIPRVHKNNEKEIENKNTIPFHDLLGTV 364

Query: 353 PEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYG 412
           P+ STESGQ++++K+KHL T+LLA YYN  GP+WYY +FSQ  +GEGDKETF++AA    
Sbjct: 365 PDASTESGQMIVNKAKHLDTLLLAAYYNFYGPAWYYRLFSQGTAGEGDKETFISAAHTLN 424

Query: 413 LPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYD 472
            PYYQ+KS  G +G+      GF+G+ +LQHD  QDY  Y  A+  + + Y       + 
Sbjct: 425 KPYYQVKSKVGFDGFW-DSKLGFQGIMLLQHDFIQDYEHYSKAKNQVIDHYDDYYH--FK 481

Query: 473 SSYSL-HEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLI--WEGKHIRSY 529
           S Y+L  +FY      D   +  ++ IMF H+   K+EP+ L+  +  I     +H+R  
Sbjct: 482 SDYNLDRDFY------DNLIHEKDISIMFGHTSFFKYEPWVLYHERRYIDHETQQHVRGL 535

Query: 530 TALSKINRYDLELENFKAINEYVCVKRTNVK-----YLNENLATSAEWASMCDYIRDRLA 584
            ++ +   +DLEL  F  + + +C    N K        +++  +  W SMC+Y+ +R++
Sbjct: 536 RSIGRALDFDLELFCFDNLLQTLCKGNANDKSSIRFAFYKDIQGTPLWDSMCEYLDNRVS 595

Query: 585 YLQ 587
           YLQ
Sbjct: 596 YLQ 598

>KLTH0F03938g Chr6 (351536..353224) [1689 bp, 562 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 562

 Score =  375 bits (964), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 206/532 (38%), Positives = 300/532 (56%), Gaps = 29/532 (5%)

Query: 84  KKFYEQVFEDLKNYSP----SSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCL 139
           ++ Y  VF+ L  Y P      + A      C + G +G    +  +   +    L +C 
Sbjct: 38  ERVYSDVFDALLQYRPVRPPKDRQAAVRQAGCEMKG-VGVNRGDAVD--AMLYENLDRCY 94

Query: 140 VVSNADVAKLRQSHSDYVKAL--------GSLVLPKNSYKGQGIVTVGGGKFSLMALLVI 191
             + A    L+  HS ++  L         S V  +   + +G VTVGGG+FSL+A  ++
Sbjct: 95  RPTKAQFEGLQAPHSAFLTQLRTTFAYEADSPVFERLFPRERGFVTVGGGRFSLLAYSML 154

Query: 192 KTLRNLHTTLPVEVFIPPSDE-GETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQ 250
           + LR   + LP EV IPP D  GE   C  V  + NA+C+F  D LP   ++ + F  YQ
Sbjct: 155 RALRARGSKLPAEVVIPPQDAAGEEHFCNEVLPELNARCVFFEDALPRALVETWDFERYQ 214

Query: 251 FKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIA 310
            K++AL+ SSF+ ++F+DAD+FP++ LD +F+ +     GLVLWPD WRR T P+FY +A
Sbjct: 215 IKAVALLLSSFKKIVFIDADDFPIQNLDSLFDSEVLREHGLVLWPDLWRRATAPVFYRLA 274

Query: 311 GIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNV----PFHDLEGSIPEVSTESGQLMISK 366
            I VD ++RVRN  D+L+P   YT    D   +    PFHD  G++P+ +TESGQ++I K
Sbjct: 275 NIDVDLRRRVRNMGDNLSPASRYTDPDQDPEQLQKIAPFHDFAGTVPDPTTESGQMVIDK 334

Query: 367 SKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEG 426
            +H  T+LLALYYNV GP WYY +FSQ  +GEGDKETF TAA   GLP+YQ+K+    +G
Sbjct: 335 VRHFQTLLLALYYNVYGPEWYYSLFSQGTAGEGDKETFATAAHVLGLPFYQVKNKLAFDG 394

Query: 427 YHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLH-EFYKTYF 485
           Y  P+G GFRGVA+ QHD  +DY+ Y  A+  I  K    +  +Y   Y    +FYK+  
Sbjct: 395 YFHPNGDGFRGVALYQHDCVEDYLLYCRARDII--KENQDSFSAYKPDYDPEPDFYKSLM 452

Query: 486 GADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQD-LIWEGKHIRSYTALSKINRYDLELEN 544
               P    E+ +MFAH+   KF+P+ L+  +  L  +G H RS+  + +I  +D+EL  
Sbjct: 453 A---PEGHPEIPVMFAHASFHKFDPWQLYHEKVYLDNDGAHFRSFHNIKRIGNFDIELFV 509

Query: 545 FKAINEYVCVKR-TNVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVS 595
           F+ + + +C       KYL +     A+W  +C Y+ DR+ YLQ TH  AV 
Sbjct: 510 FEGLQKAICSDNPIRFKYLEDKF-IHADWPKVCQYVEDRVKYLQDTHDPAVG 560

>AEL148W Chr5 (351089..352810) [1722 bp, 573 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL186W (MNN5)
          Length = 573

 Score =  363 bits (932), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 201/526 (38%), Positives = 312/526 (59%), Gaps = 35/526 (6%)

Query: 85  KFYEQVFEDLKNYSPSSKSAREYSKQ---CSLSGDIGFRPENYNEWFKLTERELSQCLVV 141
           +FY+ +FE L+  +   K+   Y  Q   C +       PE+ +     +   L++C  +
Sbjct: 55  EFYKMLFERLRKDAAQIKTVGSYVTQDADCQIRDLEDKLPESSHLG---SYDGLAKCFRL 111

Query: 142 SNADVAKLRQSHSDYVKAL-GSLVLPKNS--YKG-----QGIVTVGGGKFSLMALLVIKT 193
               +  LRQ HS++++ + G L +   S  +K       GIVTVGGG++S++A+++I+ 
Sbjct: 112 ERDHLEGLRQGHSEFLRTIHGELAISAKSALFKTLYPLPAGIVTVGGGRYSILAMVMIRA 171

Query: 194 LRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKS 253
           LR   TTLPVEVF+   D  +   C  +   +NAKC+  SD LP   L   + +G++ K+
Sbjct: 172 LRKRGTTLPVEVFLTDDDADDEAFCSYI-EHFNAKCVLFSDRLPKSVLASQKLSGFELKA 230

Query: 254 LALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQ 313
           +AL+ SS++ V+F+DADN P+K LD +F+  P    GLVLWPD W+R T P FYDIAGI 
Sbjct: 231 VALLLSSYQQVIFIDADNVPLKPLDDVFKSKPLAEYGLVLWPDIWKRVTAPAFYDIAGIP 290

Query: 314 VDRKKRVRNCFDDLTPPEVYTKNLGDL------SNVPFHDLEGSIPEVSTESGQLMISKS 367
           VD K+RVR   DD++PP  YTK  G++      ++VP HD  G++PE+S+ESGQL+I K+
Sbjct: 291 VDFKRRVRFSADDVSPPSRYTKP-GEVDESFNRAHVPLHDFAGTMPELSSESGQLLIDKA 349

Query: 368 KHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGY 427
           +H+ T+LL LYYNV+G   +Y + +Q  SGEGDKETF  AA   G PYYQ+K+    +GY
Sbjct: 350 RHMDTLLLILYYNVHGKHLFYRLSTQGTSGEGDKETFAMAAQALGKPYYQVKTKLRFQGY 409

Query: 428 HRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHE-FYKTYFG 486
           H P    + G A+LQHD  QD+ ++  A++ ++ +    A  +Y+ +Y++ E FY T   
Sbjct: 410 HTP--SQYVGAALLQHDFVQDHEQWLRAREEVARRPSELA--AYNPAYNVDEHFYNTLMR 465

Query: 487 ADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWE-GKHIRSYTALSKINRYDLELENF 545
            ++P     +D+MF H+   K  P  L++ +  I E GK  RS+  L+ ++ +D+EL   
Sbjct: 466 PEKP-----LDVMFVHASYHKLVPIDLFREKVYIGEDGKQFRSFPDLAAMDNFDIELFAI 520

Query: 546 KAINEYVCVKRTNV--KYLNENLATSAEWASMCDYIRDRLAYLQST 589
           + +NE +C   T +  KY  + + +  E+  MC Y+RDR+  L  T
Sbjct: 521 QILNEAICSATTKIEFKYNRDKIKSPEEFEDMCTYVRDRMRMLLDT 566

>Skud_10.31 Chr10 (54975..56735) [1761 bp, 586 aa] {ON} YJL186W
           (REAL)
          Length = 586

 Score =  362 bits (928), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/553 (37%), Positives = 315/553 (56%), Gaps = 53/553 (9%)

Query: 78  GGNAKLKKFYEQVFEDLKNY----SPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTER 133
            G++   KFY  + + +       SP   +    ++ C+ +G++       +   +L+  
Sbjct: 47  AGSSHRSKFYSVLVDAIVQCKPMGSPPDLAKLHDAEGCTFAGNVAAHTSERDS--ELSYE 104

Query: 134 ELSQCLVVSNADVAKLRQSHSDYVKAL-GSL---------VLPKNSYKGQGIVTVGGGKF 183
            L++C  ++      L   H+ +   L G L         + P++    +GIVT+GGGK+
Sbjct: 105 SLNKCYRLNTTVQEGLTAMHNKFTDILSGKLNFSFAQREALFPES----EGIVTIGGGKY 160

Query: 184 SLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKK 243
           S++A  +IK LR   TTLP+EV IPP DEG+ D C+    K+N KCI+ SDI+PA SL+ 
Sbjct: 161 SVLAYTMIKKLRETGTTLPIEVIIPPQDEGDDDFCKNWLPKHNGKCIYFSDIVPAKSLRD 220

Query: 244 FQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQ 303
            + T +Q K   LI S+F+ ++F+DADN+ VK LD  F    +  TGL+LWPDFWRR T 
Sbjct: 221 LELTHFQLKVFGLIISNFKRIIFIDADNYAVKNLDLAFNTTSFEDTGLILWPDFWRRVTP 280

Query: 304 PLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGD-------------LSNVPFHDLEG 350
           P+FY+I G  ++  KRVR   DD++P   Y   + D             L +VP HD++G
Sbjct: 281 PVFYNIIGSTINTGKRVRFVSDDVSPVSRYDPFVSDSKDYNPEEIQNHFLRHVPLHDMDG 340

Query: 351 SIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASF 410
           ++P+++TESGQ++I K +H  T+LLALYYNV GP+WYY M SQ  +GEGDKETF+ AA  
Sbjct: 341 TMPDLTTESGQMVIDKIRHFHTLLLALYYNVYGPTWYYKMLSQGTAGEGDKETFIAAAHA 400

Query: 411 YGLPYYQLKSATGVEG-YHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKI 469
             +PYYQ+K+    +G Y++ D   F+G+A+LQHD  QDY  Y+TAQ+ +    G  +K+
Sbjct: 401 LNVPYYQVKTKFEFDGFYYKKD--DFKGLALLQHDFEQDYRHYQTAQQKVKANIGEFSKL 458

Query: 470 SYDSSYSLHE-FYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIW-EGKHIR 527
             +  Y+L + F K     D+    +++DIMF H+   K +P+ L+  +  I  +GK +R
Sbjct: 459 --NPEYTLDKGFLKNLMLNDD---GSDLDIMFIHASFYKADPWNLYHEKRFIGPDGKQLR 513

Query: 528 SYTALSKINRY--DLELENFKAINEYVCVKRTN----VKYLNENLATSAEWASMCDYIRD 581
            +    K+ RY  D EL  F  + +  C    N     KY  E+  T+ EW +MC Y+ D
Sbjct: 514 GF---KKLGRYGMDFELFLFDDMKKSFCTTPKNQVLRFKYF-EDKITTPEWDAMCKYLAD 569

Query: 582 RLAYLQSTHVQAV 594
            + YL+ TH  A+
Sbjct: 570 HVDYLERTHKDAM 582

>YJL186W Chr10 (80155..81915) [1761 bp, 586 aa] {ON}
           MNN5Alpha-1,2-mannosyltransferase, responsible for
           addition of the second alpha-1,2-linked mannose of the
           branches on the mannan backbone of oligosaccharides,
           localizes to an early Golgi compartment
          Length = 586

 Score =  358 bits (919), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 209/556 (37%), Positives = 315/556 (56%), Gaps = 48/556 (8%)

Query: 72  REPIANGGNAKLKKFYEQVFEDLKNYSPSSKSAR----EYSKQCSLSGDIGFRPENYNEW 127
           R P+    N K   FY  + + +    P+  S        ++ CS + ++      ++  
Sbjct: 42  RLPVLTRSNLK-NNFYTTLVQAIVENKPADSSPDLSKLHGAEGCSFANNVAAHDSGHDS- 99

Query: 128 FKLTERELSQCLVVSNADVAKLRQSHSDYVKALG---SLVLPKNS--YKG-QGIVTVGGG 181
             L+   LS+C  ++      LR+ HS +   L    +  +P+    + G +GIVT+GGG
Sbjct: 100 -DLSYESLSKCYNLNKTVQESLREVHSKFTDTLSGKLNFSIPQREALFSGSEGIVTIGGG 158

Query: 182 KFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSL 241
           K+S++A  +IK LR+  TTLP+EV IPP DEGE D C+    K+N KCI+ SDI+P+  L
Sbjct: 159 KYSVLAYTMIKKLRDTGTTLPIEVIIPPQDEGEDDFCKNWLPKFNGKCIYFSDIVPSKPL 218

Query: 242 KKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRT 301
              + T +Q K   LI SSF+ ++FLDADN+ VK LD  F    ++ TGL+LWPDFWRR 
Sbjct: 219 SDLKLTHFQLKVFGLIISSFKRIIFLDADNYAVKNLDLAFNTTSFNDTGLILWPDFWRRV 278

Query: 302 TQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVY---TKNLGD----------LSNVPFHDL 348
           T P FY+I G  ++  KRVR   DD++P   Y     N  D          L +VP HDL
Sbjct: 279 TPPAFYNIIGSSINIGKRVRFVSDDISPVSRYDPFVSNSNDYTPKERQEHFLKHVPLHDL 338

Query: 349 EGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAA 408
           +G++P++S+ESGQ++I K +H  T+LLALYYNV GP+WYY M SQ  +GEGDK+TF+ AA
Sbjct: 339 DGTMPDLSSESGQMVIDKIRHFNTLLLALYYNVYGPTWYYKMISQGTAGEGDKDTFVAAA 398

Query: 409 SFYGLPYYQLKSATGVEG--YHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQ 466
               +PYYQ+++    +G  Y + D   ++G+A+LQHD  QDY +Y+ AQ+ +       
Sbjct: 399 HALNMPYYQVRTNFEFDGFFYQKDD---YKGLALLQHDFEQDYKQYQKAQQKVKANIEEF 455

Query: 467 AKISYDSSYSL-HEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIW-EGK 524
           +K+  D  Y+L + F KT    D+    +++DIMF H+   K +P+TL+     I   G+
Sbjct: 456 SKL--DPDYTLDNGFLKTLMVNDD---GSDLDIMFIHASFYKADPWTLYHENRFIGPNGE 510

Query: 525 HIRSYTALSKINRY--DLELENFKAINEYVCV----KRTNVKYLNENLATSAEWASMCDY 578
            +R +    K +RY  D EL  F  +    C     +    KY  + + T  EW +MC+Y
Sbjct: 511 QVRGF---RKPHRYGMDFELFLFNDMRGSFCTTPKSQVIKFKYFTDKVNT-PEWDAMCEY 566

Query: 579 IRDRLAYLQSTHVQAV 594
           + + + YL+STH +A+
Sbjct: 567 LTNHVNYLESTHKEAM 582

>Kpol_2002.57 s2002 (129140..130957) [1818 bp, 605 aa] {ON}
           (129140..130957) [1818 nt, 606 aa]
          Length = 605

 Score =  355 bits (912), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/566 (36%), Positives = 312/566 (55%), Gaps = 28/566 (4%)

Query: 50  GNAQ-PADTISRNPAVDVGLNAGREPIANGGNAKLKKFYEQVFEDL---KNYSPSSKSAR 105
           GNA  P   +   P    G+      I N      K FY ++F+ L   K   P   +  
Sbjct: 43  GNASSPNGGLKYPPPGTNGVGRQNGYIPNHTIKNSKDFYYKLFDALAASKPVRPPKDANF 102

Query: 106 EYSKQCSLSGDIGFRPENYNEWFKLTERE-LSQCLVVSNADVAKLRQSHSDYVKAL-GSL 163
               +C+L     +  +   E   LT  E LS C  ++ +    L  SH  + + +  S 
Sbjct: 103 RDEDKCNLKDIASYSSK---EDHLLTSYESLSNCYNLTQSQYDDLHNSHELFTEHVEKSF 159

Query: 164 VLPKNSYKG-----QGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLC 218
            L  ++ K      +GIV +GGGKFS+  L +IKTLR   T LPVE+ +P +   + + C
Sbjct: 160 QLSNSAAKSMWPNDKGIVAIGGGKFSVYILSMIKTLRAKGTHLPVEILMPLASPEDKEFC 219

Query: 219 ETVFSKYNAKCIFLSDILPAPSLKKF--QFTGYQFKSLALIASSFEDVLFLDADNFPVKT 276
           +      NAKC++  D+LP     K+  + + +Q+K  +++ SSF +V+++D+DN  +K+
Sbjct: 220 DKFLPPLNAKCVYFKDVLPKEFTGKYPIKISRFQYKVFSILFSSFRNVMYIDSDNLALKS 279

Query: 277 LDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVY--T 334
           LD +F+   Y   GL+LWPD WRR T P++Y +AG+  + +KRVRN  DDL+P   Y   
Sbjct: 280 LDKVFDTVAYRENGLILWPDIWRRVTAPIYYSVAGVPYNLEKRVRNMVDDLSPVSRYDNV 339

Query: 335 KNLGD---LSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMF 391
           +N G+      VPFHD EG++P+++TESGQL++ K +H  T+LLA YYN  GP WYY +F
Sbjct: 340 ENPGNDYRTRKVPFHDFEGTLPDLTTESGQLVVDKVRHFKTLLLATYYNFYGPDWYYRIF 399

Query: 392 SQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMR 451
           SQ  +GEGDKETF+ AA  +GLPYYQ+K+    +GY+    +GFRG+ + QHD  QDY +
Sbjct: 400 SQGGAGEGDKETFIAAAHKFGLPYYQVKTNLKFDGYNDAK-EGFRGIGLYQHDFDQDYKQ 458

Query: 452 YKTAQKAISNKYGAQAKIS-YDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEP 510
           Y+ A+  +S  Y   AK+S YD  YS  + ++      +P+   ++D MF H    KF+P
Sbjct: 459 YQAAKSYVSRNY---AKLSQYDPEYSSEKSFEKELM--KPSNGKDIDAMFVHVSFYKFDP 513

Query: 511 YTLWKNQDLIWEGKHIRSYTALSKINRYDLELENFKAINEYVCVKRTNVKYLNENLATSA 570
           + L K +  + +GKH R +     +  +DLEL+ F    +  C          +   +  
Sbjct: 514 FVLAKEKRYMRDGKHFRGFGRFELLKGWDLELDTFTLFRDTFCSDNVIEFSYYKPKMSQP 573

Query: 571 EWASMCDYIRDRLAYLQSTHVQAVSP 596
           EW  MC+Y+  R+A+L+ TH +AV P
Sbjct: 574 EWKDMCNYLSSRVAFLEETHEEAVKP 599

>Ecym_8128 Chr8 complement(266920..268698) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii AEL148W
          Length = 592

 Score =  353 bits (907), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/537 (39%), Positives = 312/537 (58%), Gaps = 42/537 (7%)

Query: 86  FYEQVFEDLKNYSPSSKSAREYS---KQCSLSGDIGFRPENYNEWFKLTERELSQCLVVS 142
           FY+ +F  L+ + P      + S   K C L  D+ F   +  +   L+     +C   S
Sbjct: 67  FYKDLFLALEKFKPPKGPEDKNSLKDKTCDLH-DVSFGSTDPTDGEYLSYAARRKCFRPS 125

Query: 143 NADVAKLRQSHSDYVK------------ALGSLVLPKNSYKGQGIVTVGGGKFSLMALLV 190
               A+L++SH  ++K            AL + + PK +    GIVTVGGGK+S++AL +
Sbjct: 126 EVSTAELKKSHLGFIKHINRHLTVDTKSALFNELFPKEA----GIVTVGGGKYSILALTM 181

Query: 191 IKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQ 250
           ++ LR   T LPVEV IP  D G+   C  +  K+NA+CI L   LP    K   F  Y+
Sbjct: 182 LRALREHGTKLPVEVLIPEGDIGDIHFCRAI-RKWNAECILLPKALPNTVSKLHDFKSYE 240

Query: 251 FKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIA 310
            K  AL+ SSF+DV+ +DADN P+K LD +FE +PY  TGL+LWPD WRR T P+FY+IA
Sbjct: 241 TKLAALLLSSFKDVILIDADNIPIKPLDDVFESEPYKETGLILWPDIWRRQTAPVFYEIA 300

Query: 311 GIQVDRKKRVRNCFDDLTPPEVYTKNLG-------DLSNVPFHDLEGSIPEVSTESGQLM 363
            I +D + R+RN +DDL+PP  Y KN         ++++VP HDL G+IP++S+ESGQL+
Sbjct: 301 DIDIDFRNRIRNSYDDLSPPSRY-KNPDVPNDAKYNMAHVPLHDLAGAIPDLSSESGQLL 359

Query: 364 ISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATG 423
           ++K KHL T+LLALYYN  G  W+Y M S   SG+GDKETF+ AA     PYYQ+K+   
Sbjct: 360 VNKGKHLSTLLLALYYNYYGEQWFYQMSSLGTSGQGDKETFIFAAHALKKPYYQVKNPLL 419

Query: 424 VEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYKT 483
            +GY   DG  F+GV +LQHD TQDY  +K A++ ++         +Y+S Y++++ +K 
Sbjct: 420 FDGYFGDDG-SFKGVGLLQHDFTQDYANWKKAKEYMTENIAHLG--TYNSDYNVNQDFK- 475

Query: 484 YFGADEPNYPNE---VDIMFAHSHAPKFEPYTLWKNQD-LIWEGKHIRSYTALSKINRYD 539
               DE  +  +   VDIMF H+   K  P+ L++ +  L   GK  RS+  L  IN +D
Sbjct: 476 ----DEMLHHKDFDGVDIMFIHASFHKLIPWDLYREKIYLDKSGKQFRSFKNLKNINYFD 531

Query: 540 LELENFKAINEYVCVKRT-NVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVS 595
           +EL  F+ + +Y+C       +Y    + ++  + +MC YI DR+  L+ TH +A+S
Sbjct: 532 VELFAFEGLQKYICSDDAIKFEYHTLQVTSTESFNAMCAYIDDRVKMLRETHEEAIS 588

>TPHA0E03480 Chr5 complement(735664..737793) [2130 bp, 709 aa] {ON}
           Anc_1.150 YJL186W
          Length = 709

 Score =  352 bits (902), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/545 (37%), Positives = 298/545 (54%), Gaps = 46/545 (8%)

Query: 79  GNAKLKK---FYEQVFEDLKNYSPSS----KSAREYSKQCSLSGDIGF-RPENYNEWFKL 130
            NAK+K    FY ++F  +    P +    K A    + C +     + + EN++    L
Sbjct: 89  ANAKIKNVHDFYYKLFNAISKARPVTPPKDKMAAYRKEGCKIKDVASYDKKENFS---LL 145

Query: 131 TERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKN-SYKGQ------GIVTVGGGKF 183
           +   L +C  +S++    L+ +H  +V  + + +   + + K Q      GIV VGGGKF
Sbjct: 146 SYSNLDECFKLSDSQTKDLQVNHERFVNFIDTDIAEMDPAIKEQLWPNEKGIVIVGGGKF 205

Query: 184 SLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKK 243
           S++++  IK +R   +TLP+EV IP S   E + C      +NAKC++L D LP    ++
Sbjct: 206 SIISINTIKAIRERGSTLPIEVIIPRSSVPEEEYCNRFLPSFNAKCVYLDDTLPNEFKER 265

Query: 244 FQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQ 303
                YQ+KS AL+ SSF++VL++DADN P+  LD+IF+   Y   GL+ WPD WRR T 
Sbjct: 266 LTLKKYQYKSFALLVSSFKNVLYIDADNIPLVNLDNIFDSKAYKDNGLITWPDIWRRVTA 325

Query: 304 PLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTK--NLGD---LSNVPFHDLEGSIPEVSTE 358
           P +Y IA I  +   RVR   DD+TP   Y    N G+   L   PFHD EG++P++++E
Sbjct: 326 PAYYKIANINYNLDNRVRYMADDVTPTSYYDNIVNPGNNYKLRRTPFHDFEGTLPDLTSE 385

Query: 359 SGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQL 418
           SGQLM++K  H  T+LLA YYN  GP WYY +FSQ  SGEGDKETFL AA   G PYYQ+
Sbjct: 386 SGQLMVNKETHFRTLLLAFYYNYYGPRWYYTIFSQGTSGEGDKETFLAAAHALGEPYYQV 445

Query: 419 KSATGVEGY--HRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYS 476
           KS    +GY  H+    GF+G+ + Q D  +DY  Y            A+AK+  D  Y 
Sbjct: 446 KSTIEFDGYFDHK---DGFQGIGLYQKDFNKDYENY----------LAAKAKVEKDKKYG 492

Query: 477 LHEFYKTY-FGADEP----NYP-NEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYT 530
             E+   Y F AD      N P NEV+ MF H    KF+P+ L KN+  I +GK  R ++
Sbjct: 493 --EYNPNYDFDADFEKALMNPPGNEVEAMFIHVSFHKFDPHNLAKNKRYILQGKQYRVFS 550

Query: 531 ALSKINRYDLELENFKAINEYVCVKRTNVKYLNENLATSAEWASMCDYIRDRLAYLQSTH 590
               +  +DLELE  + ++ Y+C          ++L     W  MC+Y+ +R+ YL STH
Sbjct: 551 KFKNLRNWDLELEANRNMHFYLCTDNAVEFIFYKDLQGKDSWKDMCNYLSERVEYLASTH 610

Query: 591 VQAVS 595
             A+S
Sbjct: 611 DAALS 615

>CAGL0M02871g Chr13 (324009..325811) [1803 bp, 600 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186w MNN5
           or uniprot|P38069 Saccharomyces cerevisiae YBR015c TTP1
          Length = 600

 Score =  346 bits (888), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/514 (37%), Positives = 287/514 (55%), Gaps = 45/514 (8%)

Query: 108 SKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKAL----GSL 163
           +  C   GD+     +   W   + + L  CL + +  +  L ++HS Y+K L    G  
Sbjct: 93  TSSCPKKGDVSSGGIDQFHW--TSAKNLKACLNLDDYAIKTLSEAHSRYMKTLFNDKGEF 150

Query: 164 VLPKNSYKG-----QGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLC 218
            + K+ +K      +GIVT+GGG+++++A+L+I+T+R   +TLPVEV  PP DEGE D C
Sbjct: 151 AISKSDFKKLYPNEKGIVTLGGGRYTILAMLMIETVRRHGSTLPVEVMFPPEDEGEFDFC 210

Query: 219 ETVFSKYNAKCIFLSDILPAPSLKK---FQFTGYQFKSLALIASSFEDVLFLDADNFPVK 275
                K+N +C+ +S  +P   L+K    +F  YQ KSLAL+ +SF+  +F+DADN  +K
Sbjct: 211 NNWLPKHNGRCVMMSQEVPFEILQKDKEVRFKSYQIKSLALLLTSFKQFVFIDADNNAMK 270

Query: 276 TLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTK 335
            +DHIF+ + + + GL+LWPD W+R T P FYDIAG++ D  KRVRN  DD +PPE Y  
Sbjct: 271 NIDHIFDTEAFKTHGLILWPDLWKRFTNPGFYDIAGVKYDLGKRVRNVNDDASPPETYDP 330

Query: 336 N-----LGDL-----------SNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYY 379
           N       DL            +V   DL+G+I + +TESGQ+M+   KHL T+LLALYY
Sbjct: 331 NHSIYTTHDLKQREEIAKHLYEDVSLADLDGTIADTTTESGQMMVDNKKHLSTLLLALYY 390

Query: 380 NVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVA 439
           N+ GP  YY M S   +GEGDKETF++AA    LPYYQ+K+  G +GY       F+GV 
Sbjct: 391 NIYGPDLYYYMMSMGTAGEGDKETFISAAHVLHLPYYQVKTNIGFDGYVNDVDNQFKGVG 450

Query: 440 MLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSLHEFYKTYFGADEPNYPN--EVD 497
           ++Q D  QDY R+K   K +     A  K      Y L   ++     D+   P+   +D
Sbjct: 451 LMQTDFEQDYQRHKQVLKEL-----ATEKPLEPVKYQLPNHFQ-----DKMKNPDGTSLD 500

Query: 498 IMFAHSHAPKFEPYTLWKNQDLIWE-GKHIRSYTALSKINRYDLELENFKAINEYVCVK- 555
           IMF H+   KF+P  L K++    + G+ +R Y  +     +D EL +FK + + +C   
Sbjct: 501 IMFLHASFHKFDPADLAKSKQYFKQNGEQVRGYNRIDAYKNFDFELFSFKKLYDNLCTSD 560

Query: 556 RTNVKYLNENLATSAEWASMCDYIRDRLAYLQST 589
             + K L ++  T   W SMC Y + R+ +L  T
Sbjct: 561 HISFKSLKKHEGTEF-WTSMCSYFKQRVDFLTKT 593

>ZYRO0D17160g Chr4 complement(1417469..1419208) [1740 bp, 579 aa]
           {ON} similar to uniprot|P46982 Saccharomyces cerevisiae
           YJL186W MNN5 Alpha-1 2-mannosyltransferase responsible
           for addition of the second alpha-1 2-linked mannose of
           the branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 579

 Score =  345 bits (885), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/538 (36%), Positives = 303/538 (56%), Gaps = 32/538 (5%)

Query: 75  IANGGNAKLKKFYEQVFEDLKNYSPSSK----SAREYSKQCSLSGDIGFRPENYNEWFKL 130
           I + G    + FY  +F+ +++ +P  +    S R+  K+    GDI     ++    K 
Sbjct: 56  IFDSGAGFRRNFYSALFQAIQDGTPEGQLIMDSVRD--KEKCRDGDISAFSTDFE---KS 110

Query: 131 TERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKG-----QGIVTVGGGKFSL 185
           +   L  C  +S+  +  L   H  +V+A+ S    K+          GIVT+GG K+S+
Sbjct: 111 SYENLDACFHLSDDRLGMLASKHEKFVEAINSWKFSKSDIDKLFPNESGIVTIGGSKYSV 170

Query: 186 MALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQ 245
           ++L +++TLR+  + LPVEV IPP DEG+ D C  V  K  AKC+++++ LP   +K  +
Sbjct: 171 ISLTMLETLRDRGSKLPVEVMIPPGDEGDEDYCNVVLPKLGAKCVYMAEKLPPDVVKNVK 230

Query: 246 FTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPL 305
              YQ K + L+ SSF++V+++DAD  P+K LD +F    Y   GL+LWPD W+R T P 
Sbjct: 231 IERYQNKIVGLLLSSFKNVVYIDADCLPLKPLDDVFNSPAYKKHGLILWPDIWKRVTAPA 290

Query: 306 FYDIAGIQVDRKKRVRNCFDDLTP-----PEVYTKNLGDLSNVPFHDLEGSIPEVSTESG 360
           FY +A I +D KKRVR   DD++P     P      +  L  VPFHDLEG++ + +TESG
Sbjct: 291 FYKLANIPLDLKKRVRFGADDVSPLSRYEPSSEASEVRMLKKVPFHDLEGTMSDPTTESG 350

Query: 361 QLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKS 420
           Q++I+K  HL ++LL+ YYN++G  WYY M SQ  SGEGDKET + AA    LPYYQ+K+
Sbjct: 351 QMLINKVDHLRSLLLSAYYNIHG-KWYYKMLSQGTSGEGDKETLIAAAHALKLPYYQVKT 409

Query: 421 ATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYSL-HE 479
               +G+   D +GF G+++ Q D  QDY  YK A + +       +  +Y+ +Y +  +
Sbjct: 410 DVRFDGF--SDHEGFHGISLYQQDFQQDYEAYKKAIRWVRRHKSELS--AYEQNYDVKKQ 465

Query: 480 FYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWE-GKHIRSYTALSKINRY 538
           FY+      +     EV+ +F H    KFEP  L +    I E GKH R +     I  +
Sbjct: 466 FYEKLLKPGD----KEVESLFGHISYHKFEPIELAEKSIYIDEKGKHFRGFRRKEVIRHF 521

Query: 539 DLELENFKAINEYVCVKRTNVKYL-NENLATSAEWASMCDYIRDRLAYLQSTHVQAVS 595
           DLE+ NF+ + +Y+C K   VK++  ++   + EW  MC+Y++  ++YLQ TH +  S
Sbjct: 522 DLEMFNFEVLEKYLC-KENPVKFVYYKDRMDTPEWERMCNYLKSHVSYLQDTHEELFS 578

>TBLA0J01190 Chr10 complement(267291..269141) [1851 bp, 616 aa] {ON}
           Anc_1.150 YJL186W
          Length = 616

 Score =  344 bits (882), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 214/563 (38%), Positives = 313/563 (55%), Gaps = 65/563 (11%)

Query: 76  ANGGNAKLKKFYEQVFEDLK-----NYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKL 130
           +N  +  +  FY+ +F+ +K     +Y  +     + + QC L  DI F   +  +   +
Sbjct: 56  SNRADDSIYSFYKFLFQHIKESPLNDYKNNPLILDQLNDQCLLQNDITFDATSKEQLSTV 115

Query: 131 TERELSQCLVVSNADVAKLRQSHSDYV-KALGSLVLPKNSY------KGQGIVTVGGGKF 183
           +   L  C  +   D  K+ +S  +Y+ K +  L   K SY      KG+GIVTVGGGK+
Sbjct: 116 SYNNLKNCYSLQEHDFKKISKSQLEYINKCVTKLSKKKKSYTDILFPKGRGIVTVGGGKY 175

Query: 184 SLMALLVIKTLRNLHTTLPVEVFIPPSDE---GETDLCETVFSKYNAKCIFLSDILPAPS 240
           SL+A L+IK LR   TTLPVEV IPPSD+    +T LC  V    NAKCI+ +D LPA  
Sbjct: 176 SLLAYLMIKLLREKGTTLPVEVVIPPSDKEMYDDTWLCNDVLPTLNAKCIYFTDRLPAEI 235

Query: 241 LKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRR 300
           L+     G+Q+KSLA+  SSF+  LFLD+DNFP+K LD++F+   +   GL+ WPD WRR
Sbjct: 236 LQDLDIHGFQYKSLAIWISSFKKTLFLDSDNFPLKDLDNVFDTPAFEEVGLIFWPDLWRR 295

Query: 301 TTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKN--LGDLS-NVPFHDLEGSIPEVST 357
           T  P FYDI+ I+ D KKRVR   DDL+   +Y K+  + D   N+PFHDL+G+I + ST
Sbjct: 296 TIPPDFYDISNIKYDLKKRVRYVQDDLSSVPLYDKDNSVKDYEYNIPFHDLDGTISDPST 355

Query: 358 ESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQ 417
           E+GQ+++ K  H  T+LL++++N  G + YY MFSQ  +G GDK+TF+ AA   G PYYQ
Sbjct: 356 ETGQMLVDKETHFETLLLSIFFNYFGFAIYYDMFSQAGAGIGDKDTFIAAAHVLGQPYYQ 415

Query: 418 LKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKI-SYDSSYS 476
           +K+    +G+  P   GF+G+A+LQHD  QDY  Y+ A+  I  K G  AK  +Y + Y+
Sbjct: 416 VKTPPEFDGFWHP-TMGFQGLALLQHDFNQDYKNYQVAR--IEAK-GDDAKYENYITDYN 471

Query: 477 LHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKIN 536
           L    K +F  D  +  N +D+MFAH    K EP +L + Q  ++  ++ +    L K +
Sbjct: 472 L----KKHFEEDMMDI-NNIDVMFAHYSLHKAEPMSLLEGQ--LYFDQNGKPLKGLYKND 524

Query: 537 RYDLELEN--FKAINEYVCV-------------KRTNVKYLNENLATSA----------- 570
           +Y + LE   F  ++E++C              K TN+   N  L+ SA           
Sbjct: 525 KYGMNLEYYIFNTLHEFLCPSPEDKEFQREANDKNTNI---NTRLSISATNTTQQLGFYR 581

Query: 571 ------EWASMCDYIRDRLAYLQ 587
                  W  MC ++R R  +L 
Sbjct: 582 GQVNTNNWDFMCVFLRTRTRFLH 604

>SAKL0H22616g Chr8 complement(1966196..1968421) [2226 bp, 741 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 741

 Score =  347 bits (891), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 217/581 (37%), Positives = 326/581 (56%), Gaps = 81/581 (13%)

Query: 83  LKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVS 142
           LK FY  + +++K+YSP     R     C + GDIG    N  ++ KL+E ELS+C+ + 
Sbjct: 161 LKAFYTSILKEIKDYSPEGTLDRTKGSDCKI-GDIG--ATNIKDFGKLSESELSKCIQIP 217

Query: 143 NADVAKLRQSHSDYVKALGSLVLPK-NS----YKGQGIVTVGGGKFSLMALLVIKTLR-- 195
                 L+  H+ + + + + +LP  NS    YKG+GIV VGGGKFSL+ L  IK +R  
Sbjct: 218 KDTSDMLKDLHTRFYETVKTKILPSFNSIEAPYKGEGIVIVGGGKFSLIGLPAIKAIRVN 277

Query: 196 ---NLHTTLPVEVFIPPSDEGETDLCETVFSKYN----AKCIFLSDILPAPSLKKFQFTG 248
               L +++PVE+ IPPSD+ + + C+ V  K +     +C+F SDI     LK  +  G
Sbjct: 278 SGHRLQSSIPVEIMIPPSDDEDVEFCKNVLPKVDPTGLTRCVFFSDIFEEEILKDIK--G 335

Query: 249 YQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYD 308
           YQ K+LAL+ SSF  VL LDADN+ V ++++ F+   ++  GLVLWPDFWRR   P FY+
Sbjct: 336 YQLKALALLVSSFRKVLMLDADNYVVNSIENFFDSPVFNEKGLVLWPDFWRRLHHPKFYE 395

Query: 309 IAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSK 368
           I GI V+R + +R   D++TPPEVY  N  D  ++PFHDL  SIP++STESGQL++ K K
Sbjct: 396 IIGIDVNRNESIRYSIDNVTPPEVYRDN--DDDSIPFHDLANSIPDISTESGQLLVDKQK 453

Query: 369 HLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFY----GLPYYQLKSATGV 424
           HL T+LL+ YYN NGPS+YYP+  Q  +GEGDK+TF+ AA          Y+Q+++   V
Sbjct: 454 HLDTLLLSCYYNYNGPSFYYPLLGQGYAGEGDKDTFIAAAHVTHPSESGSYHQIQTPVRV 513

Query: 425 EGY----------HRPD-------GQGFRGVAMLQHDVTQDYMRYKTAQKAIS------- 460
           +G+            PD        + +RGVAMLQ +  +D+ R K AQ AI        
Sbjct: 514 QGHWCDEFEISIDDNPDDIIAEVKNKKYRGVAMLQSNYIEDHERLKEAQSAIPKDIKKRL 573

Query: 461 NKYGAQAKISYDSSYSLH-EFYKTYFG----ADEPNYPNEVDIMFAHSHAPKFEPYTLWK 515
           +K+  + K  +++   L+ +FY++  G     D   Y +  ++ F HSH PK++P+ + +
Sbjct: 574 DKFRQEHKDEFNNEDDLYKKFYESLRGHYSLNDYLEYFDSTEVSFIHSHLPKYDPWVISQ 633

Query: 516 NQDLIWEGK------------------HIRSY-TALSKINRYDLELENFKAINEYVCV-- 554
           ++D  ++GK                  H R Y +A  K+  YDLEL N+    E++C   
Sbjct: 634 DEDFKYDGKRAKKLRGDKDSPSSKLSGHYRIYNSAFPKVTNYDLELANWAVFQEFLCSGD 693

Query: 555 --KRTNVKYLNENLAT----SAEWASMCDYIRDRLAYLQST 589
                N KYL   ++     +    +MC YI +R+ +L+ T
Sbjct: 694 KENYKNFKYLKTQVSKADNPTVAVENMCKYIDERVEFLRKT 734

>KNAG0C00900 Chr3 (167471..169342) [1872 bp, 623 aa] {ON} Anc_1.150
           YJL186W
          Length = 623

 Score =  337 bits (864), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/525 (37%), Positives = 294/525 (56%), Gaps = 42/525 (8%)

Query: 86  FYEQVFEDLKNYSPSSK----SAREYSKQCSLSGDIGFRPENYNEWFKLTERE-LSQCLV 140
           F+  +F  LKN  P       +A +   +C L  D  F  +   E  +    + L  C+ 
Sbjct: 115 FFRNIFTTLKNAKPRDPPEDFTAFKDEARCKLR-DPMFASDGEREKLEAVSYDSLDGCMH 173

Query: 141 VSNADVAKLRQSHSDYVKALGSL-------VLPKNSYKGQGIVTVGGGKFSLMALLVIKT 193
           V +  +  L + H+ +V  + S+       + P++S    GIV VGGG++S++   ++  
Sbjct: 174 VPDQYLESLTKMHTKFVGTIKSISSSTVRQLYPEDS----GIVAVGGGRYSVLLATMLPK 229

Query: 194 LRNLHTTLPVEVFIPPSDE-GETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFK 252
           LR   T+LPVE+FIP  D  G+   C+    +YNAKCI+   I+    +K  +F   Q+K
Sbjct: 230 LRKNCTSLPVEIFIPDEDAAGDASFCQVFAPRYNAKCIYAKAIVGKIDIKLERF---QYK 286

Query: 253 SLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGI 312
            +A++ SSF++VLFLDADN+ +K +D IF  + YH TGL++WPD W+R T P FY IAGI
Sbjct: 287 PVAILLSSFKNVLFLDADNYVMKNIDKIFSAESYHDTGLIIWPDIWKRCTSPSFYKIAGI 346

Query: 313 QVDRKKRVRNCFDDLTPPEVYTKNLGD-----LSNVPFHDLEGSIPEVSTESGQLMISKS 367
             D  KRVR   D+++P   YT    +      + VPFHDL+G +P+ S+ESGQL+I+K 
Sbjct: 347 NFDLTKRVRWGGDEISPVSRYTSAEQNSPEYLKTKVPFHDLDGPMPDSSSESGQLLINKV 406

Query: 368 KHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGY 427
           KH+ T+LLALYYNV G  WY+P+ SQR  GEGDKE++++AA     P YQ+K+     GY
Sbjct: 407 KHMDTLLLALYYNVYGKQWYFPLASQRGPGEGDKESYISAAYALKKPVYQVKTPLEFSGY 466

Query: 428 HRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISN---KYGAQAKISYDSSYSL-HEFYKT 483
              +   F GV +LQHD  QDY  YK A++ ++    +YG      YD  Y+    F K 
Sbjct: 467 FTDE---FNGVGLLQHDFEQDYQLYKKAEELVAANQIRYGF-----YDPEYTYSSSFLKE 518

Query: 484 YFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINRYDLELE 543
           +F   E  +    D+MF H+   KF+P+ L +N+   + GK +R ++   +IN  D ELE
Sbjct: 519 FFHVGESAHS---DVMFIHASFFKFDPWELSQNERFTYRGKQVRGFSLRDRINGEDFELE 575

Query: 544 NFKAINEYVCVKRT-NVKYLNENLATSAEWASMCDYIRDRLAYLQ 587
            F+ + E  C+ +T    YL +   +  +W   C YI   + +L+
Sbjct: 576 VFELMKEAFCIDKTVKYGYLEKKFKSKEDWEKACSYIDKHIVFLK 620

>Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON}
           YJL186W (REAL)
          Length = 586

 Score =  333 bits (854), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/514 (36%), Positives = 299/514 (58%), Gaps = 39/514 (7%)

Query: 108 SKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKAL-GSL--V 164
           ++ C  + ++      +++   L+   LS+C  ++   +A L + H+++   L G L   
Sbjct: 81  AEGCEFADNVAAHDTTHDD--NLSYESLSRCYKLNRTLLANLAEMHNEFTDILLGKLNYS 138

Query: 165 LPKNSY---KGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETV 221
           +P+      + +GIVT+GGGK+S++A  +IK LR   TTLP+EV IPP DEG+ D C+  
Sbjct: 139 IPQREALFPESEGIVTIGGGKYSVLAHTMIKKLRETGTTLPIEVIIPPQDEGDDDFCKNW 198

Query: 222 FSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIF 281
             + N KC++ SDI+P+  L+  + T +Q K   LI S+F+ ++F+DADN+PV  LD +F
Sbjct: 199 LPRQNGKCLYFSDIVPSKPLRDLELTHFQLKVFGLIISNFKRIIFIDADNYPVTNLDLVF 258

Query: 282 EQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVY-------- 333
               +  TGL++WPD WRR T P FY+I G  ++  KRVR   DD++P   Y        
Sbjct: 259 NTTSFQDTGLIMWPDLWRRVTPPAFYNIIGSTINTSKRVRFVSDDVSPVSRYDPFVSKSK 318

Query: 334 ---TKNLGD--LSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYY 388
              ++ + D  L +VP HD++G++P++++ESGQ++I K +H  T+LLALYYNV GP+WYY
Sbjct: 319 EYTSEEMQDHFLRHVPLHDMDGAMPDLTSESGQMVIDKVRHFHTLLLALYYNVYGPTWYY 378

Query: 389 PMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQD 448
            M SQ  +GEGDKETF+ AA     PYYQ+K+    +G+   +G  ++G+A+LQH+  QD
Sbjct: 379 KMLSQGTAGEGDKETFIAAAHALNAPYYQVKTKFEFDGFFYKEGD-YKGLALLQHNFEQD 437

Query: 449 YMRYKTAQKAISNKYGAQAKISYDSSYSLH-EFYKTYFGADEPNYPNEVDIMFAHSHAPK 507
           Y +Y+ A+K +       +++  D  YSL   F K+    D+    +++DIMF H+   K
Sbjct: 438 YKQYQKAKKKVKANIDQFSQLDVD--YSLDGGFLKSLMLNDD---GSDLDIMFIHASYYK 492

Query: 508 FEPYTLWKNQDLIW-EGKHIRSYTALSKINRY--DLELENFKAINEYVCV----KRTNVK 560
            +P+ L+     I  +G+ +R +    K  RY  D EL  F  + E  C     K    K
Sbjct: 493 ADPWNLYHENRFIGPDGEQLRGF---RKPQRYAMDFELFLFDDMKESFCTPAKDKVIKFK 549

Query: 561 YLNENLATSAEWASMCDYIRDRLAYLQSTHVQAV 594
           Y  + + T  +W  MC Y+ D + YLQSTH + +
Sbjct: 550 YFEDKINT-PDWDKMCKYLADHVDYLQSTHKEIM 582

>TDEL0C03020 Chr3 (537820..539802) [1983 bp, 660 aa] {ON} 
          Length = 660

 Score =  335 bits (858), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 202/576 (35%), Positives = 311/576 (53%), Gaps = 77/576 (13%)

Query: 83  LKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVS 142
           L++    V   ++  SP  +  R     CSL GD+       +E  K+++ EL +C+ ++
Sbjct: 85  LREALGSVMNQIRELSPQGELDRSKGDDCSL-GDLNVGVPQNDE--KVSKSELLKCIQIT 141

Query: 143 NADVAKLRQSHSDYVKALGSLVLPK---NSYKGQGIVTVGGGKFSLMALLVIKTLR-NLH 198
                +L+  H  ++  L   ++PK   + Y+G GIV VGGG+F++  +  I+ +R N  
Sbjct: 142 PDAEDELKNLHKSFLSVLEKKIMPKYPISMYRGDGIVFVGGGRFTMFVMPAIQAIRANAG 201

Query: 199 TTLPVEVFIPPSDEGETDLCETVFSKYN----AKCIFLSDILPAPSLKKFQFTGYQFKSL 254
             +P+E+ IPP +  E+  CE +    +     +C+F+  +  + ++K  +  GYQ K+L
Sbjct: 202 RDIPIEIMIPPGNNHESGFCENILPLVDPSGLTRCVFMETLFDSKTMKNVK--GYQLKAL 259

Query: 255 ALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQV 314
           AL+ASSF   L LDADN+ V ++D  F+ +     G+ LWPD+W+R   P  YDI G  V
Sbjct: 260 ALLASSFRKTLLLDADNYVVNSIDSFFDSEIIEDYGMALWPDYWKRLHHPAVYDIVGSHV 319

Query: 315 DRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTIL 374
           D  +R R   D ++P ++Y  +  D+S VPFHDL+G+IP+  TESGQL++ K KHL TI+
Sbjct: 320 DSSRRARFIMDTVSPSQLYQSD--DISKVPFHDLDGTIPDGGTESGQLLVDKYKHLDTII 377

Query: 375 LALYYNVNGPSWYYPMFSQRASGEGDKETFLTAA---SFYGLP--YYQLKSATGVEGY-- 427
           L+LYYN NGPS+YYP+  Q  +GEGDK+TF  AA   S +GL   +YQL++  G  GY  
Sbjct: 378 LSLYYNYNGPSYYYPLLGQGLAGEGDKDTFALAARALSAHGLQRYFYQLRAPVGALGYWA 437

Query: 428 ------------HRPDGQ-GFRGVAMLQHDVTQDYMRYKTAQKAISNK-------YGAQA 467
                       H P+ Q  FRGVAMLQHD+  D+  YK A   I +K       +  +A
Sbjct: 438 HPKDNVPILDDEHVPEDQRSFRGVAMLQHDLDLDFKAYKKAYTEIKSKLVQDLKTFRKKA 497

Query: 468 KISYDSSYSL--------HEFYKTYFGADE-PNYPNEVDIMFAHSHAPKFEPYTLWKNQD 518
            +S D+S  L         E  K  +  +E  +Y ++V + F HSH PK+ P+   ++Q+
Sbjct: 498 TLS-DASADLANVDELFWKERRKDGYDVNEFLSYFSDVPVTFIHSHFPKYNPWEFAQDQE 556

Query: 519 LIWEGK------------------HIRSYT-ALSKINRYDLELENFKAINEYVCVK--RT 557
            I++GK                  H R Y     K++ YDLEL N+ +  E++C +   T
Sbjct: 557 FIFDGKKVMSDHKDDPNFKPTHHGHFRMYDHTFQKLSNYDLELANWLSFKEHICREDGHT 616

Query: 558 NVKYLNENLATS----AEWASMCDYIRDRLAYLQST 589
           N  YL E +  +      +  MC YI +R+  L+ST
Sbjct: 617 NFSYLAEEIEKTEHGLQRYEEMCKYIDERVKMLKST 652

>KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 607

 Score =  332 bits (850), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/538 (35%), Positives = 310/538 (57%), Gaps = 45/538 (8%)

Query: 85  KFYEQVFEDLKNYSPSSKSAREY------SKQCSLSGDIGFRPENYNEWFKLTERELSQC 138
           +F++ +F  L+  +P     RE+      +K+C + GD+GF     +E  +L+   L++C
Sbjct: 70  EFFKTLFAQLEGAAPMK---REFGWGDIKAKECDM-GDVGFDSNGRDE--RLSYDNLAKC 123

Query: 139 LVVSNADVAKLRQSHSDYVKALGSL-----VLPKNSYKGQGIVTVGGGKFSLMALLVIKT 193
           L +  ++   L+  H  +VK L ++      L +     +GIVTVGG ++SL++ L+I  
Sbjct: 124 LQLPESNYNSLKNGHEKFVKYLSTVDTSASQLEQIYATKRGIVTVGGRRYSLLSYLMINM 183

Query: 194 LRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKS 253
           +R   + LP+EV IPP DE ET+ CE++  ++NA+CI+  D LP   L       YQ K 
Sbjct: 184 VRRSGSKLPIEVVIPPDDEPETEFCESIL-QFNARCIYFKDRLPTSLLANLSVKSYQVKG 242

Query: 254 LALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQ 313
           +AL+ SSF++ + +D+DN P+K +D +F+ + +   G+V+WPD WRR T P FY +A + 
Sbjct: 243 IALLLSSFQEFVLIDSDNMPLKNIDEVFDYNVFRDHGMVIWPDIWRRMTSPQFYQLAEVP 302

Query: 314 VDRKKRVRNCFDDLTPPEVYTKNLGDLS----NVPFHDLEGSIPEVSTESGQLMISKSKH 369
           +D  KRVRN  D+L+P   Y K    +S     VP HD  G++P+ +TESGQ++++K  H
Sbjct: 303 IDFTKRVRNAGDELSPVSRYDKLENTVSENKAKVPMHDFLGTLPDPTTESGQMIVNKKTH 362

Query: 370 LPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHR 429
           L  +LLALYYN  GP +YY +FSQ  SG+GDKETF  AA     P+YQ+K   G   Y  
Sbjct: 363 LKMLLLALYYNQYGPEYYYQLFSQGTSGQGDKETFAMAAHILKEPFYQVKKTFGFAAYMD 422

Query: 430 P-DGQG-FRGVAMLQHDVTQDYMRY----KTAQKAISNKYGAQAKISYDSSYSLHE-FYK 482
           P +G+  F+G  +LQHD  QDY RY    KT  +    KYG     ++D  Y + + FY 
Sbjct: 423 PREGKSEFQGAGLLQHDPEQDY-RYWNILKTEIEGQQEKYG-----TFDEDYHIKKTFYD 476

Query: 483 TYFG--ADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIW-EGKHIRSYTALSKINR-Y 538
              G   D+P      + +F H+   K++P+ L+  ++L+  +GK  R+Y   S   + +
Sbjct: 477 KMLGKVGDQPR-----EHLFLHASYHKYDPWNLYNEKNLMHSDGKQFRAYPCSSTAFKGF 531

Query: 539 DLELENFKAINEYVCVKR-TNVKYLNENLATSAEWASMCDYIRDRLAYLQSTHVQAVS 595
           D+EL  ++ +N+ VC +    + Y+++    + ++ ++C + +DR+ +L  TH + VS
Sbjct: 532 DVELFLWEIVNKIVCSENPVKMAYIDKLKEDTDKFKAVCQFTKDRVNHLNETHDEYVS 589

>Smik_10.46 Chr10 (78173..79933) [1761 bp, 586 aa] {ON} YJL186W
           (REAL)
          Length = 586

 Score =  330 bits (847), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/487 (36%), Positives = 278/487 (57%), Gaps = 35/487 (7%)

Query: 130 LTERELSQCLVVSNADVAKLRQSHSDYVKALG---SLVLPKNSY---KGQGIVTVGGGKF 183
           L+   LS+C  + +     L + H+ +   L    +  +P+      + +GIVT+GGGK+
Sbjct: 101 LSYESLSKCYRLDSTVQENLVEMHNQFTDVLSGRLNFSIPQREALFPESEGIVTIGGGKY 160

Query: 184 SLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKK 243
           S++A  +IK LR   TTLP+EV IPP DEG+ + C      +N +C++ SDI+P   L  
Sbjct: 161 SVLAYTMIKNLRKTGTTLPIEVIIPPQDEGDDEFCNNWLPNFNGRCLYFSDIVPPKPLGD 220

Query: 244 FQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQ 303
            + T +Q K   L+ S+F+ ++F+DADN+ VK LD  F    +  TGL+LWPD+WRR T 
Sbjct: 221 LKLTHFQLKVFGLLISNFKRIIFMDADNYAVKNLDLAFNATSFQDTGLILWPDYWRRVTP 280

Query: 304 PLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGD-------------LSNVPFHDLEG 350
           P FY+I G  ++  KRVR   DD++P   Y   + +             L +VP HDL+G
Sbjct: 281 PAFYNIIGSSINTGKRVRFISDDISPVSRYDSFISNSEDYTSEEMQDHFLRHVPLHDLDG 340

Query: 351 SIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASF 410
           ++ ++++ESGQ++I K +H  T+LLALYYNV GP+WYY + SQ  +GEGDK+TF+ AA  
Sbjct: 341 TMSDLTSESGQMVIDKIRHFHTLLLALYYNVYGPTWYYNIISQGTAGEGDKDTFIAAAHA 400

Query: 411 YGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKIS 470
               YYQ+K+    +G+       ++G+A+LQHD  QDY +Y+ AQ+ +       +K+ 
Sbjct: 401 LNASYYQVKTKFEFDGFFYKKND-YKGIALLQHDFEQDYKQYQKAQQKVKADVEKFSKL- 458

Query: 471 YDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWK-NQDLIWEGKHIRSY 529
            D  Y+L + +      +E     ++DIMF H+   K +P+TL++ N+    +GK +R +
Sbjct: 459 -DPDYTLDKGFLKSLMLNEDG--TDLDIMFIHASFYKADPWTLYRENRFTDPDGKQLRGF 515

Query: 530 TALSKINRY--DLELENFKAINEYVCVKRTN----VKYLNENLATSAEWASMCDYIRDRL 583
               K  RY  D E+  F+ + E  C    N     KY N+ L T  EW  MC Y+ + L
Sbjct: 516 ---RKPYRYAMDFEMFLFRDMKESFCTPPKNQVIKFKYFNDKLNT-PEWDKMCQYLTNHL 571

Query: 584 AYLQSTH 590
            YL++TH
Sbjct: 572 DYLEATH 578

>ZYRO0F13244g Chr6 (1084412..1086406) [1995 bp, 664 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 664

 Score =  322 bits (824), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 215/587 (36%), Positives = 321/587 (54%), Gaps = 87/587 (14%)

Query: 82  KLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVV 141
           KL +  +   E ++++S ++   R  +K C L GD+G      +++ K+T+ +L +C+  
Sbjct: 79  KLTEMMKYTMERVRSHSSTAVVDRTKNKGCQL-GDVG--ANAVDKFSKVTKEQLLKCIDF 135

Query: 142 SNADVAKLRQSHSDYVKALGSLVL---PKNSYKGQGIVTVGGGKFSLMALLVIKTLR-NL 197
                 +L+ SH+ ++  L + +L   P + Y G+GIV VGGGK++L A+  IK +R N 
Sbjct: 136 PQETFEQLKDSHTTFLDTLTNDILDEYPTDLYGGKGIVIVGGGKYTLYAMPAIKAVRTNG 195

Query: 198 HTTLPVEVFIPPSDEGETDLCETVFSKYN----AKCIFLSDILPAPSLKKFQFTGYQFKS 253
             T+P+E+ IPP ++GE   CE V  + +     +CI+++ +    +LK  +  GYQ K+
Sbjct: 196 DPTIPIELMIPPENDGEDAFCENVLPELDPSGLTRCIYMNQVFDEQTLKDVK--GYQLKA 253

Query: 254 LALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQ 313
           LAL+ASSFE VL LDADN+ V ++  IFE D +   GL+LWPD+WRR   P  YDI GI 
Sbjct: 254 LALLASSFEKVLLLDADNYVVNSIRDIFELDVFKEFGLILWPDYWRRLHHPRLYDIVGIS 313

Query: 314 VDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTI 373
           V+  KRVR   DD++P E+Y +   D S +PFHD EG+IP+  TESGQL++ KSKHL TI
Sbjct: 314 VNENKRVRYSMDDVSPTELYEEK--DQSKIPFHDFEGAIPDGGTESGQLLVDKSKHLGTI 371

Query: 374 LLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFY---GL--PYYQLKSATGVEGYH 428
           +L+LYYN NGPS YYP+  Q  +GEGDK+TF  AA+     G+   Y+Q+K+  G  GY 
Sbjct: 372 ILSLYYNYNGPSQYYPLLGQGFAGEGDKDTFALAATALTQRGIVSAYHQVKTPVGTSGYW 431

Query: 429 R------------PDGQ-GFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISY---- 471
                        PD Q  +RGVAMLQHD+  D+  Y  A   +S+ Y    KI Y    
Sbjct: 432 ANSKDETPFEKGLPDAQRSYRGVAMLQHDLLGDFEAYMNAIHDLSDSYDEDFKIYYHRRL 491

Query: 472 -------DSSYSLHE-------FYKTYFGADEPNYP--------NEVDIMFAHSHAPKFE 509
                  D+S S  +         + ++ + + +Y          +V ++F HSH PK+ 
Sbjct: 492 GQRPLEEDNSESREKVANWEKKIREDFWKSHKVDYDLKSFLQHFKDVPVLFVHSHLPKYN 551

Query: 510 PYTLWKNQDLIWEGK------------------HIRSYTA--LSKINRYDLELENFKAIN 549
           P+ L +  DL ++GK                  H R Y      KIN YDLEL NF  + 
Sbjct: 552 PWLLSQFGDLKYDGKRVLEKHADDPNFKPSRHGHYRMYGDEFKEKIN-YDLELANFITMR 610

Query: 550 EYVCVKR---TNVKYLNENLATS----AEWASMCDYIRDRLAYLQST 589
           +++C       N  YL++ +        ++ +MCDYI +R+  L  T
Sbjct: 611 DHICAVEDGYKNFSYLSKEVNQEDKGFEKYRAMCDYIAERVDMLSDT 657

>KLLA0F24574g Chr6 complement(2285387..2287522) [2136 bp, 711 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 711

 Score =  308 bits (789), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 209/613 (34%), Positives = 325/613 (53%), Gaps = 115/613 (18%)

Query: 75  IANGG--NAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTE 132
           ++NG   ++ LK FY+++   LK  +   K   +  + C LS D G    +  +   LT+
Sbjct: 105 VSNGVTISSDLKDFYQEIMTTLKETALKGKLEVKKPEGCKLS-DTGVENTDSEKLSTLTK 163

Query: 133 RELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPK----NS-----YKGQGIVTVGGGKF 183
             L +CL +S+ DV +++++H+++ K L   ++P     N+     YKG+GI  VGGGK+
Sbjct: 164 DNLLKCLPISDEDVKEVKEAHNNFKKLLQDKLMPNFKKLNTEKDPVYKGEGISIVGGGKY 223

Query: 184 SLMALLVIKTLR-----NLHTTLPVEVFIPPSDEGETDLCETVFSKYN----AKCIFLSD 234
           +LMAL VIK++R      L +++P+E+ IPPSD  +  +CE +    +     KC++LS+
Sbjct: 224 TLMALPVIKSIRMNSGLTLKSSVPIEIVIPPSDNADRKVCENIIPTIDPSGLTKCVYLSE 283

Query: 235 ILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLW 294
              +  LK    TGYQ KSL+L+ SSFE VL LDADN+ + +L + F+ D +  TGL+LW
Sbjct: 284 FFDSEILK--DITGYQLKSLSLLISSFEKVLLLDADNYVINSLGNFFDGDIFRETGLILW 341

Query: 295 PDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPE 354
           PD+WRR   P  YDI  I+V + K  R   D +T   ++ ++  D + +PFHDLEG+IP+
Sbjct: 342 PDYWRRVHSPKLYDIVDIKV-QDKLARYSTDYITNSRLFPES--DPAKIPFHDLEGAIPD 398

Query: 355 VSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLP 414
            STESGQL+++K+ HL  ++L+LYYN NGPS+YY +  Q  SGEGDK+TF+ AA+     
Sbjct: 399 GSTESGQLLVNKASHLDALILSLYYNYNGPSYYYRLLGQGISGEGDKDTFILAATVLKHR 458

Query: 415 YYQLKSATGVEGY----------------HRPDGQ-GFRGVAMLQHDVTQDYMRYKTAQK 457
           YYQ+++    +GY                  P  +  +RG+AM+QHD  +D      A+ 
Sbjct: 459 YYQVRTPVRPQGYWGKIENEVRIQDDLVDDTPSNEKKYRGIAMIQHDYNEDRTFDSIARD 518

Query: 458 AIS-------------------------NKYGAQAKIS---------YDS---SYSLHEF 480
           AI                          N+  A  K+S         +DS    Y++ +F
Sbjct: 519 AIRGSVNNKLKAHRLEYIKNHKSEFKDMNEKDALEKVSKMSEVSDKFWDSMKGKYTIKDF 578

Query: 481 YKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGK---------------- 524
           + T F    P        +F HS+ PK+ P+ L  + DL+++GK                
Sbjct: 579 F-TIFQFTTP--------VFLHSNLPKYNPWELSISGDLLYDGKKATKKMDDPSKYVPNG 629

Query: 525 --HIRSYTALSK-INRYDLELENFKAINEYVCVKRT---NVKYLNENLATSA----EWAS 574
             H R Y+   K +  YDLEL N+K  ++ +C       N  YL+E +  +     E  +
Sbjct: 630 KGHHRMYSPTFKDLTNYDLELANWKLFDDVLCKNPDDYLNFSYLSEVIGATEKPEQEVKN 689

Query: 575 MCDYIRDRLAYLQ 587
           MC YI+DR+ YL+
Sbjct: 690 MCKYIKDRVEYLK 702

>TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}
           Anc_3.188 YBR015C
          Length = 957

 Score =  307 bits (786), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 195/570 (34%), Positives = 304/570 (53%), Gaps = 30/570 (5%)

Query: 44  YIKSYLGN--AQPADTISRNPAVDVGLNAGREPIANGGNAKLKKFYEQVFEDLKNYSPSS 101
           Y+ + L N    P  TIS+     +  NA R+ +   G   LK  ++++   + + S S 
Sbjct: 67  YLNNKLSNDVQIPDKTISKE-NTKLDWNARRKLLKKSGKPILKSIFQKL---IISSSSSG 122

Query: 102 KSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALG 161
           ++  + S  C +   +  +    +EW  LT   L+QCL++ +  +  L+  H +++++L 
Sbjct: 123 QNNIQLSPNCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLN 182

Query: 162 SLV-LPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPS---------- 210
            L  LP N Y G+GIV +GGGK +L A +V K +R+    +PVE+FIPP+          
Sbjct: 183 ILQDLPINMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFD 242

Query: 211 -DEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDA 269
             + E+D C  +  + N  CIF+SDI+        + T      LAL+ SSF+D L L  
Sbjct: 243 FKQSESDFCNKISKELNTNCIFISDIIDEEDFHLPELTESTTLLLALLTSSFDDTLVLSP 302

Query: 270 DNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTP 329
            NFP+K LD IF+  PY  TG + WP FWRR   P  YDI G Q++  KR+R   DD+TP
Sbjct: 303 KNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITP 362

Query: 330 PEVYT----KNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPS 385
           P+VYT    KN    +++P HDLEG++P+  T   Q +I KSK++ TILLALYY+VNGPS
Sbjct: 363 PKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPS 422

Query: 386 WYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDV 445
           WYY ++ Q+ S    K+    AA     P+YQ+K+   ++G  +   +     + L HD 
Sbjct: 423 WYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFS-STLYHDF 481

Query: 446 TQDYMRYKTAQKAISNKYGAQAK--ISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHS 503
            QD+  Y  A+  I + Y  +    I +D SY+  +F   Y         N   +MFAHS
Sbjct: 482 QQDFAFYTFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHS 541

Query: 504 HAPKFEPYTLWKNQDLIWEG---KHIRSYTALSKINRYDLELENFKAINEYVCVKRTNVK 560
           +    +P  L KN+ L+ +    + +     ++   + ++ELE+FK ++EY+C K     
Sbjct: 542 NLFDGDP-KLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFD 600

Query: 561 YL-NENLATSAEWASMCDYIRDRLAYLQST 589
           YL +E +  +     MC +I+ RL +LQS+
Sbjct: 601 YLEDEYVDETNALPGMCLFIKQRLDFLQSS 630

>Kwal_56.22779 s56 complement(277096..279183) [2088 bp, 695 aa] {ON}
           YBR015C (MNN2) - putative Golgi
           alpha-1,2-mannosyltransferase [contig 184] FULL
          Length = 695

 Score =  274 bits (701), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 206/610 (33%), Positives = 295/610 (48%), Gaps = 97/610 (15%)

Query: 67  GLNAGREPIANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNE 126
           GL+A  E +    + + +K +    E +K YSP  K        C + GDI  R  + ++
Sbjct: 87  GLDAESEGLGVAISNETRKAFNDALELVKKYSPDGKLDTTKGDDCEI-GDI--RITDTSQ 143

Query: 127 WFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLP---------KNSYKGQGIVT 177
           + KLT+  L +CL V +  V KL + H D+  A+   +LP           ++KG GIV 
Sbjct: 144 FHKLTKESLEKCLNVPDETVKKLNKLHEDFKGAIRKSILPSFDVLEAQGNPAFKGDGIVI 203

Query: 178 VGGGKFSLMALLVIKTLR-----NLHTTLPVEVFIPPSDEGETDLCETVFSKYN----AK 228
           VGGG+FS+ AL  IK +R         T+P+E+ IPP D+G+   CE V  K +     K
Sbjct: 204 VGGGRFSVFALPAIKAIRENSGVKTKNTIPIEIIIPPHDKGDRGFCENVLPKVDPSGLTK 263

Query: 229 CIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHS 288
           C+FL +IL   +L   +  GYQ K++AL  S FE VL LDADN+ V +LD  F       
Sbjct: 264 CVFLDEILSPETLSHIE--GYQIKAVALFVSQFERVLMLDADNYVVNSLDEYFTHQKLKE 321

Query: 289 TGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDL 348
            GL+LWPD+WRR   P  YDI  + V  K + R   D+ TP  VY K   D    PFHD 
Sbjct: 322 KGLILWPDYWRRLHHPKTYDIVNLGVSTKSQ-RYSIDNATPDFVYKK---DAKETPFHDF 377

Query: 349 EGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAA 408
             ++P+ STESGQ++I K KHL ++L+ LYYN NG S++YP+  Q  +GEGDK+TF    
Sbjct: 378 FDALPDGSTESGQVLIDKKKHLDSLLMTLYYNFNGKSYFYPLLGQGFAGEGDKDTFALGC 437

Query: 409 SFYGLP--YYQLKSATGVEGY---------------HRPDGQGFRGVAMLQHDVTQDYMR 451
                P  YYQ+K+     G+                  DG+ FRG AM+QHD T D   
Sbjct: 438 RVMHGPEAYYQVKTPVDTLGHWADKDEIRIPDEDLEKSIDGKQFRGTAMIQHDFTDDVRF 497

Query: 452 YKTAQKAISNKY-------------GAQAKISYDSSYSLH------EFYKTYFGADEPNY 492
              A++ I N                 + K+S D            E  K +   + P+Y
Sbjct: 498 SSLAREVIGNAIRDRFHSFCDEWARSHEGKLSKDQKERREQCDKSDEVKKAFNDKESPSY 557

Query: 493 PNE--------VDIMFAHSHAPKFEPYTLWKNQDLIWEGK------------------HI 526
             +          + F HSH PK++P+      D+++ G                   H 
Sbjct: 558 GLKDYLSFFHFTKVSFIHSHLPKYDPWEWSHTGDMMFNGAKALKNHKDEPEYSPMHAGHY 617

Query: 527 RSY-TALSKINRYDLELENFKAINEYVCVKRTN-------VKYLNENLATSAEWASMCDY 578
           R Y + +S++  YDLEL N+ A  +Y+C  +         V+ L E         +MC+Y
Sbjct: 618 RMYDSKISQLTSYDLELANWSAFKDYLCDIKDGYKNFGYLVQVLEETEFPHQSNENMCNY 677

Query: 579 IRDRLAYLQS 588
           IR+R+ YLQS
Sbjct: 678 IRERVEYLQS 687

>SAKL0C08888g Chr3 (814687..816726) [2040 bp, 679 aa] {ON} weakly
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 679

 Score =  273 bits (697), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 190/611 (31%), Positives = 297/611 (48%), Gaps = 107/611 (17%)

Query: 75  IANGGNA---------KLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYN 125
           I+NG +A         +LKKFY  + + +K  SP+ +   +  K C L G+IG       
Sbjct: 73  ISNGTSALQQQGVISDELKKFYRNITQLVKQNSPTGELDAKKQKWCDL-GNIGL--TETT 129

Query: 126 EWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLP------KNSYKGQGIVTVG 179
           ++ KLT+ ELS+C+ V    V+ L+  H  + K +   +LP      K +Y+G+GIV +G
Sbjct: 130 KFDKLTKLELSKCINVPADTVSHLKDLHLKFQKLIKDEILPAASRLSKPAYEGEGIVILG 189

Query: 180 GGKFSLMALLVIKTLRN-----LHTTLPVEVFIPPSDEGETDLCETVFSKYN----AKCI 230
           GG+ +L+AL  I  +R      +  T PVE+ IPP  + ET  C+ +  + +     +C+
Sbjct: 190 GGQKTLLALPAINAIRTSGGVTIRNTTPVELVIPPRYKNETAFCQHLLPQLDPTGLTRCV 249

Query: 231 FLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTG 290
            LSD+    +L+  +    Q K LAL+ SSF+  L LD D++ V +LD  F+ + +   G
Sbjct: 250 LLSDLYDGEALEHLE--DQQLKPLALLVSSFQKALLLDCDSYVVNSLDGYFDGEIFRDKG 307

Query: 291 LVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEG 350
           LVLWPD WRR   P  Y++  I+VD   + RN  D +TP EV+   + +  +VP+HDLE 
Sbjct: 308 LVLWPDAWRRLHHPALYEVLNIKVDENNQPRNSIDIVTPREVF--QVENKLSVPYHDLEH 365

Query: 351 SIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASF 410
           +IP+ ST++GQL+I K KHL T+++++YYN NGPS+YY +  Q  +  GDK T+ TAA+ 
Sbjct: 366 TIPDGSTDTGQLLIDKDKHLDTLIMSVYYNFNGPSYYYLLLEQGCNVNGDKNTY-TAAAH 424

Query: 411 YGLP----YYQLKSATGVEGYH-RPDG----------QGFRGVAMLQHDVTQDYMRYKTA 455
              P    YY +++  G++G+    DG          Q  R VA LQHD  +DY  YK +
Sbjct: 425 AMHPNDGSYYHVRTPIGMQGHWVDEDGARLADPNQKSQTRRVVAGLQHDYNEDYKYYKWS 484

Query: 456 QKAISNKYGAQAKISYDSSYSLHEFYKTYFGADEPNYPNEVD------------------ 497
           ++ I N +  +        Y  H   K+ F  DE     E++                  
Sbjct: 485 REVIGNNFREKLAQFRKKWYQAH---KSDFSEDEKKRQKELENNKELNAKFWSQFTGSYK 541

Query: 498 ------------IMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTA-------------- 531
                       + F HS  P ++P+ L +  DL ++G  I    A              
Sbjct: 542 LEDYLSFFDFTPVTFVHSRQPSYDPWQLSQIGDLKFDGARITDQHADDEEYKPSSSGHYR 601

Query: 532 -----LSKINRYDLELENFKAINEYVCVKR----TNVKYLNENLATSAE----WASMCDY 578
                 +    +DLEL ++       C       T + YL E ++ + +       MC Y
Sbjct: 602 MYGPEFTDQTNFDLELSSWLLFQRLFCSSDREAYTQLAYLQEQISNTPDPDKSVQEMCKY 661

Query: 579 IRDRLAYLQST 589
           +  R  YL+ T
Sbjct: 662 VGARAQYLRDT 672

>KLTH0C08976g Chr3 (751731..753839) [2109 bp, 702 aa] {ON} weakly
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 702

 Score =  273 bits (698), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 190/605 (31%), Positives = 305/605 (50%), Gaps = 94/605 (15%)

Query: 70  AGREPIANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFK 129
            GR+P     +   KK +++V + ++  SP  +       +C+L  DIG    + +++ +
Sbjct: 100 VGRKPDDPQVSEATKKAFKEVLDAIQANSPEGQLQVSKGSECNLM-DIGVT--DTSKFDR 156

Query: 130 LTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLP------KNSYKGQGIVTVGGGKF 183
           LT+  L +CL +       L ++H  +  A+G  ++P        ++ G GI+ VGGGK+
Sbjct: 157 LTKESLEKCLQIPEEMTKTLHEAHKKFRAAIGEKLMPMFRKLDTPAFSGDGILIVGGGKY 216

Query: 184 SLMALLVIKTLR-----NLHTTLPVEVFIPPSDEGETDLCETVFSKYN----AKCIFLSD 234
           S+ AL  IK +R      L +++P+E+ IPPSD+ +   C+ V  K +     KC+FL +
Sbjct: 217 SVFALPAIKAIRENSGFKLKSSIPIEIIIPPSDKADRGFCDNVLPKVDPLGLTKCVFLDE 276

Query: 235 ILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLW 294
           +  A +L   +  GYQ K+LAL+ S FE VL LDADN+ V +++  F     +  GL+LW
Sbjct: 277 MFDADTLSHIE--GYQIKALALLVSRFERVLMLDADNYVVNSINDYFTSSALNDKGLILW 334

Query: 295 PDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPE 354
           PD+WRR   P  Y I  + V      R   DD++P  +Y K++ D    PFHD   ++P+
Sbjct: 335 PDYWRRLHHPKLYGIVDLGVSPDHISRYSVDDVSPDYMYKKSVTD---TPFHDFRDALPD 391

Query: 355 VSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLP 414
             TESGQL++ K KHL +I+++LYYN NG S+YYP+  Q  +GEGDK+TF  A+     P
Sbjct: 392 GGTESGQLLVDKKKHLDSIIMSLYYNYNGKSYYYPILGQGFAGEGDKDTFALASRVMHGP 451

Query: 415 --YYQLKSATGVEGYHRPDGQG---------------FRGVAMLQHDVTQDYMRYKTAQK 457
             +YQ+K+     G H  D +                FRG AMLQHD  +D      A++
Sbjct: 452 GSFYQVKTPVDTLG-HWADAKDEIRLLEEEYENVEKKFRGCAMLQHDYIEDSKFSSLARE 510

Query: 458 AISN-------------------KYGAQAKI-------SYDSSYSLHEFYKTYFGADE-P 490
            + N                   K+ A+ K        S +   +LHE  +  +  D+  
Sbjct: 511 VLGNTIRNNEEKFCDEWAAKNKGKFSAEEKARREECKKSKEVQDALHEKMRASYKLDDYL 570

Query: 491 NYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGK---------------HIRSY----TA 531
            + +   + F HSH PK++P+  ++N D++++GK               H  +Y    + 
Sbjct: 571 AFFSFTGVSFVHSHLPKYDPWEWYENGDMMFDGKKAKKNHKNDPDYVPAHSGNYRMYDSK 630

Query: 532 LSKINRYDLELENFKAINEYVCVKR---TNVKYLNENLATSA----EWASMCDYIRDRLA 584
            ++I+ YDLEL N+ A   Y+C       N  YL+  + ++         MC YI +R+ 
Sbjct: 631 FNQISSYDLELANWSAFKSYLCDLEGGYKNFGYLSNKIDSTKSPKQSNKDMCKYIEERVE 690

Query: 585 YLQST 589
           YL+ST
Sbjct: 691 YLKST 695

>Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {ON}
           similar to Ashbya gossypii AEL082W
          Length = 670

 Score =  240 bits (612), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 180/598 (30%), Positives = 276/598 (46%), Gaps = 99/598 (16%)

Query: 84  KKFYEQVFEDLKNYSPSSKSAREYSKQCS---LSGDIGFRPENYNEWFKLTERELSQCLV 140
           K+F  QV   ++  +P  +        C    +S D G     +    +LTE ELS+CL 
Sbjct: 73  KEFINQVVTAVQESAPVDELKLLQDDNCQHRRVSIDEG----KHEVLLQLTEAELSKCLH 128

Query: 141 VSNADVAKLRQSH---SDYVKA--LGSLV-LPKNSYKGQGIVTVGGGKFSLMALLVIKTL 194
           VS+   +K+  SH    +YV+   + SL  L    YKG G++ + GG+ +L A+  IK +
Sbjct: 129 VSDDIKSKMMASHLQFKEYVQGTLMKSLANLESYPYKGDGVIIMAGGEHTLSAMASIKAI 188

Query: 195 RN-----LHTTLPVEVFIPPSDEGETDLCETVFSKYN----AKCIFLSDILPAPSLKKFQ 245
           R      +  ++P+++ IP   + +   C  V    +    + C+F  DI  +  L K +
Sbjct: 189 RQNGGIIMRRSVPIQIVIPSKKQDDEVFCTKVLPMLDPTGLSTCLFFEDIFDSDVLNKIE 248

Query: 246 FTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPL 305
            +  Q+KSLALI SSF  VL LD+D F V ++D  F        G++LWPD+WRR   P 
Sbjct: 249 SS--QYKSLALIVSSFRRVLLLDSDTFVVNSIDGYFHHSQLKENGMILWPDYWRRLHHPD 306

Query: 306 FYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMIS 365
            Y I GI V    R+R   DD +P  +Y    GD S  PFHD E +IP+ ST SG L+I 
Sbjct: 307 LYKIVGINVHADTRLRFSVDDSSPKVLYESPKGD-SPFPFHDSENAIPDGSTASGPLLID 365

Query: 366 KSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAAS--FYGLP-YYQLKSAT 422
           K  HL TI+++LYY+ NGPS YYP+       E +K+TF  AA   +   P YYQ+K+ +
Sbjct: 366 KQIHLDTIIMSLYYSFNGPSLYYPLLGCDQGSECEKDTFALAAHALYPDTPKYYQVKTPS 425

Query: 423 GVEGY------------------HRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYG 464
             EG+                  +  +G+ FR VAML +D  +D    + A++ I     
Sbjct: 426 AHEGHWENITTGVRILDEELASTNSDEGKTFRKVAMLLYDYIEDTEFARLAREIIKENAD 485

Query: 465 AQAKISYDSSYSLHEFYKTYFGAD----EPNYPNEVD----------------------I 498
              +   +   + H   KT+   D    E N     D                      +
Sbjct: 486 TLLESFKNDGNAHHANRKTFKPRDINDLETNDELRADFWKKHNDVYHIQDFLLFFDFIPM 545

Query: 499 MFAHSHAPKFEPYTLWKNQDLIWEGK------------------HIRSYTA-LSKINRYD 539
            F  S +P + P+ L    D+ ++                    H R Y++ +S +  YD
Sbjct: 546 KFIRSLSPSYNPWKLLTTGDMQFDAARALKGHENDPKYKPAHSGHYRMYSSGISTVTNYD 605

Query: 540 LELENFKAINEYVCVKRT----NVKYLNENLATSA----EWASMCDYIRDRLAYLQST 589
           LEL N+     +VC  +     +  YL + +  +     E+  MC YIR+R+ YL++T
Sbjct: 606 LELANWSLFENFVCNSKAFTYRDYGYLKQQIENTKDPALEYKKMCKYIRNRVKYLRNT 663

>CAGL0L08096g Chr12 complement(886827..888521) [1695 bp, 564 aa]
           {ON} some similarities with uniprot|P46982 Saccharomyces
           cerevisiae YJL186w or uniprot|P38069 Saccharomyces
           cerevisiae YBR015c
          Length = 564

 Score =  220 bits (560), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 149/541 (27%), Positives = 257/541 (47%), Gaps = 56/541 (10%)

Query: 78  GGNAKLKKFYEQVFEDLKNYSPSSKSARE----YSKQCSLSGDIGFRPENYNEWFKLTER 133
           G +A +++FY  +F  +  Y P +  A++    +  +C+L   I     + +   +L+  
Sbjct: 48  GLDAAVEQFYLDLFRSINQYRPMNPPAKKQKLVFKDKCTLVAPISVEETSDDTLKQLSYM 107

Query: 134 ELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSY-------KGQGIVTVGGGKFSLM 186
            L  C  +S      L+ +H+ Y + + +L    + Y       + +GIVT+GG + +L 
Sbjct: 108 TLDYCFHLSPTQTNNLKTAHNGYCRRVETLFGSLDEYLRDSLMPRYKGIVTLGGNERTLS 167

Query: 187 ALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPSLKKFQF 246
            L  I  LR + +TLP+EV  PP    E   C+    +YN KCI++S  LP   LK  +F
Sbjct: 168 LLASIPRLRKMGSTLPIEVIFPPYVSNEDKFCDDFLPRYNGKCIYMSKALPEYVLKAHKF 227

Query: 247 TGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLF 306
                +    + S+F+ +L++++++F    +D  F+   +  TGLVLWP   RR+T P F
Sbjct: 228 DEKMIRMFTPLVSTFKSILYMESNDFANTNVDKAFDSKSFTDTGLVLWPGRSRRSTSPAF 287

Query: 307 YDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGD------LSNVPFHDLEGSIPEVSTESG 360
           Y I   ++D   R RN  DD++ P  YT    +      L++ P HDL+G+IP+  T  G
Sbjct: 288 YQIVNRKIDLNNRTRNLADDVSRPTRYTSQALENIQFNLLAHTPMHDLDGAIPDAVTHVG 347

Query: 361 QLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQL-- 418
             MI K KH  T++LA+YY V+G  W+  MF+      G +E  + AA    L YYQ+  
Sbjct: 348 HYMIDKQKHFKTLMLAMYYAVHGEMWFDMMFAPEKGSSGYRENIVAAAHALELSYYQVHL 407

Query: 419 --KSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYGAQAKISYDSSYS 476
             +S  G        G+ F     +  D   DY +++     + +K       S+D  Y+
Sbjct: 408 IPRSMRGGSKDTLQSGETF-----MHFDPDFDYRKHQALADKVKSKLIDVH--SFDRKYT 460

Query: 477 -LHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKI 535
            +  F K     ++     +V  +F    +P+F+P  L+      ++ K      +L K+
Sbjct: 461 AIRTFEKDLLAGNQ-----DVKSIFIEMPSPQFDPLALF------FKAK------SLQKL 503

Query: 536 NRYD-------LELENFKAINEYVCVKRTN--VKYLNENLATSAEWASMCDYIRDRLAYL 586
           +R D       LE +N+  + E +C + T+  V  +  N  +  +   MC Y++  +  L
Sbjct: 504 DRKDKVDDLMALERQNYSNLMEVLC-RDTDPLVLQMMVNHPSKYKMKDMCVYLKKIVTSL 562

Query: 587 Q 587
           +
Sbjct: 563 K 563

>AEL082W Chr5 (474072..476117) [2046 bp, 681 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR015C (MNN2)
          Length = 681

 Score =  202 bits (515), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 163/599 (27%), Positives = 280/599 (46%), Gaps = 107/599 (17%)

Query: 84  KKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVSN 143
           + F E++   ++ Y P +  A +    C L      R  +  ++  LT  +L  C+ +S 
Sbjct: 89  RTFVEEILRTVQAYPPGA--ALQVQADCLLER---VRATDERKFGSLTASKLQGCVDLSG 143

Query: 144 ADVAKLRQSHSDYVKALGSLVLPKN-------SYKGQGIVTVGGGKFSLMALLVIKTLR- 195
              A  ++ H+  +K +    LP++        Y   GIV +GGG  ++ A+  I+++R 
Sbjct: 144 DAFAHAKEQHALMMKVIQK-SLPEHLSDLDHYPYISDGIVILGGGHKTIAAIPAIRSIRE 202

Query: 196 ----NLHTTLPVEVFIP-PSDEGETDLCETVFSKYN----AKCIFLSDILPAPSLKKFQF 246
                +  ++P+EV IP P+DE E   C  +    +     +C+ L D + +  L K + 
Sbjct: 203 NSGITVRNSMPIEVVIPGPADE-EKVFCSKILPVLDPSGLTRCVHLGDTISSSLLSKVKP 261

Query: 247 TGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLF 306
           + +  ++LAL+ASSF  VL+LD+    +  +D  F  + ++  GLVLWPD+WRR   P  
Sbjct: 262 SDH--RTLALLASSFSRVLYLDSSVQVINAIDGYFHHELFNERGLVLWPDYWRRLHHPKL 319

Query: 307 YDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISK 366
           Y++AG +VD  +R R   D  +P E+Y    G+    P HD + SIP+ S+ SG L+I K
Sbjct: 320 YELAGSKVDTGRRERYSIDKGSPIELYGGKDGEW---PMHDCKDSIPDASSSSGVLLIDK 376

Query: 367 SKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFY----GLPYYQLKSAT 422
            KH  T+ LALYYNV+G  ++YP+   +A  E +K+T + AA       G  Y+Q+ +  
Sbjct: 377 KKHFKTLALALYYNVHGEPFFYPLLDPKAPREAEKDTIVFAAHVLSRGGGPLYHQVTTPK 436

Query: 423 GVEGYHRPDGQG------------------FRGVAMLQHDVTQDYMRYKTAQKAISNKYG 464
             EG HR D                     +R  A   HD   D+     A + I++ + 
Sbjct: 437 RSEG-HRKDKASSKPILEDTVDTSTIITSTYRHGAASYHDFFADHNFELLAGEIINSNFD 495

Query: 465 AQAKISY----------DSSYS-------------LHEFYKTYFG----ADEPNYPNEVD 497
           ++ +++Y          D++Y                +FY ++ G    A+  N+     
Sbjct: 496 SR-RLAYVKWWRQNHSDDTTYKDKSDEDLSNDASVKADFYTSFHGNYTLAEYLNFFEFTP 554

Query: 498 IMFAHSHAPKFEPYTLWKNQDLIWEG--------------------KHIRSYT-ALSKIN 536
           + F  +      P+ + +++DL ++G                     H R ++    K+ 
Sbjct: 555 VSFVETDVLTCNPWIVAQSRDLTFDGASAVGAQPANQQTQYKAGPPTHHRLFSDHFQKLT 614

Query: 537 RYDLELENFKAINEYVCVKRT--NVKYLNENL----ATSAEWASMCDYIRDRLAYLQST 589
            YDLEL  + A  E++C K +  +  YL E+L    + +  +  MC YI  R+++LQST
Sbjct: 615 TYDLELATWSAYAEFLCSKFSYKDYPYLKEHLGLTDSPTTAYKMMCKYISARVSHLQST 673

>CAGL0C03938g Chr3 complement(386673..388586) [1914 bp, 637 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 or uniprot|P39106 Saccharomyces
           cerevisiae YER001w MNN1
          Length = 637

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 87/306 (28%), Positives = 128/306 (41%), Gaps = 56/306 (18%)

Query: 167 KNSYKGQGI-VTVGGGKFSLMALLVIKTLRNLHTTLPVEVF-----IPPSDEGETDLCET 220
           K   +G+GI +TV      L+  L  K L  L    PVEV      + P  E   DL   
Sbjct: 242 KAEARGRGITLTVAPDDIKLLRSL-FKVLEKLGNEYPVEVVHKGGEMTPKME---DLIRQ 297

Query: 221 VFSKYNAKC--IFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLD 278
              + N +   I LS IL  P         ++ K  A + ++FE+ + LD D     + +
Sbjct: 298 YAEETNQEVYVINLSPILD-PDFASQNIKSFKNKWFAAMFNTFEEAILLDVDVVLYASPE 356

Query: 279 HIFEQDPYHSTGLVLWPDFWRRTTQ-----------PLF------YDIAG-IQVDRKKRV 320
           + FE D Y  TGL+LW D  R  T+           P F      +++ G IQ  R    
Sbjct: 357 YFFELDGYKKTGLMLWKD--REYTEVETSDRCASMAPYFEPSEEEHELLGTIQKYR---- 410

Query: 321 RNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYN 380
                 LT P++ T N  + + +  +D   +      +SG ++I+K + L  +LLA YY+
Sbjct: 411 ------LTGPDLETHNESEATTL--NDFFNNKLATIIDSGVVLINKKQKLNALLLAAYYH 462

Query: 381 VNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYY---QLKSATGVEGYHRPDGQGFRG 437
           +   S Y+          GDKE F  AA   G  YY       A G  GYH P  + +  
Sbjct: 463 M---SKYFG-----GCTYGDKELFEIAALAAGEDYYVDPNKAGAIGPIGYHPPREKYYVC 514

Query: 438 VAMLQH 443
            A + H
Sbjct: 515 SAQMGH 520

>TDEL0B00160 Chr2 (29809..31497) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 132/303 (43%), Gaps = 37/303 (12%)

Query: 164 VLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPP--SDEGETDLCETV 221
           +L K+S KG  +++VG G+ S  A  +IK LR     LP+E+      S++ +  L +  
Sbjct: 170 LLSKSSSKGI-VISVGAGQIS-DATKLIKVLRYQMNALPIEIIHRGDLSEDQQQLLIQAA 227

Query: 222 FSKYNAK-------CIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPV 274
            S ++A         + +S++L     +  QF  Y  K LA+I SSFE  + +DAD  P 
Sbjct: 228 RSAHSASYPAQELWFVNVSNVLNPRHAE--QFATYSNKWLAIIFSSFESPILVDADTIPF 285

Query: 275 KTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYT 334
            +L+  ++   Y   GL+ + D  R  T  L   +   Q++  K++      L       
Sbjct: 286 ISLEKYYDFQQYKEMGLLFFKD--RAITSDL---LNKEQLNTLKQIALSTIKLGSAAADL 340

Query: 335 KN---LGDLSNVPFHDLEGSIPEVS---TESGQLMISKSKHLPTILLALYYNVNGPSWYY 388
            N   LG   N+    +   + E      ESG +++ KS HL  +L ++    +  S Y+
Sbjct: 341 NNAIELGIKDNIAAETVMSMLVEGQKHHMESGLVLLDKSLHLVNLLTSVSLQFSSISSYF 400

Query: 389 PMFSQRASGEGDKETFLTAASFYGLPY-YQLKSATGVEGYHR---PDGQGFRGVAMLQHD 444
                     GDKE F  A      P+ +  K A+ V    R    DG+ F  +  +Q  
Sbjct: 401 ---------HGDKEWFWIAYLLRNRPFTFHPKQASNVGKLGRVQSEDGKEFYQICSVQVS 451

Query: 445 VTQ 447
            T+
Sbjct: 452 HTE 454

>CAGL0C04004g Chr3 complement(394614..396512) [1899 bp, 632 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 632

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 108/263 (41%), Gaps = 18/263 (6%)

Query: 172 GQGI-VTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETV--FSKYNAK 228
           G+GI +TV       M  L  + L+ L  T P++V I    E  + L E +   +    +
Sbjct: 246 GKGIAITVNPDDVEFMIRL-FRVLKELGNTYPIQV-IQKGGELTSPLIEQIKKTAIETNQ 303

Query: 229 CIFLSDILPAPSLK--KFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPY 286
            + + D+ P    K  + Q T +  K  A + ++FE+VL LDAD  P  +LD  F    Y
Sbjct: 304 AVSIVDLSPILDEKFAREQITSFHNKFFAAMFNTFEEVLLLDADVVPYVSLDEFFNLKGY 363

Query: 287 HSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFD---DLTPPEVYTKNLGDLSNV 343
             TGL  W D  R +    F    G+ ++      N            +  K +      
Sbjct: 364 KDTGLQFWRDRNRGSDTHKFCSNLGVYLEPSLEEHNLLGTELKFRINSLAKKKVRSSEER 423

Query: 344 PFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKET 403
            FH     +   + +SG ++++K + L ++++   +  NG       F + A   GDKE 
Sbjct: 424 AFHRFFNELKVHNIDSGIIVLNKKQKLHSLIMGEIFYTNG------RFGRCAY--GDKEM 475

Query: 404 FLTAASFYGLPYYQLKSATGVEG 426
           F+  A   G  +       G+ G
Sbjct: 476 FMMGAFATGADFIIDPRDAGIIG 498

>AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YIL014W (MNT3)
          Length = 645

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 111/258 (43%), Gaps = 23/258 (8%)

Query: 171 KGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVF----IPPSDEGETDLCETVFSKYN 226
           KG+GI    G +   M   ++  L ++  TLP+E+     +PP+   +  + + V  K N
Sbjct: 243 KGRGITITAGAEHVEMLPRLLNVLDHIGNTLPIELINAADLPPTTIDK--IAKYVQMKSN 300

Query: 227 AKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPY 286
                +          +   TG++ K LA I ++FE+ +F+D D  P   L+ +FE + Y
Sbjct: 301 QTVRLVDCGKTLEHSYRSLITGFRHKWLAYIFNTFEEAVFIDLDAVPFVDLEKLFEVEGY 360

Query: 287 HSTGLVLWPDFWRRTTQP------LFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDL 340
            S G++++ D      +P      +   +   +     +  + +D     +  TK   D 
Sbjct: 361 KSEGILMFRDRSYDGEKPDDCPKAMRIMMPSPKEHTMWQHGSNYDKQVAEDELTKKPRDA 420

Query: 341 SNVPFHD--LEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGE 398
               F+   +EG    ++ ESG +++ K+K LP++L++L  ++         F       
Sbjct: 421 GAATFYIKYMEGKSFHMA-ESGLIVMHKNKKLPSLLISLMLHMT--------FETHLCSH 471

Query: 399 GDKETFLTAASFYGLPYY 416
           GDKE         G  YY
Sbjct: 472 GDKEYLWLGQLVSGENYY 489

>TBLA0G03680 Chr7 complement(975688..977943) [2256 bp, 751 aa] {ON} 
          Length = 751

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 105/278 (37%), Gaps = 55/278 (19%)

Query: 173 QGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSK-------- 224
           +G++   G K    AL +I  LR    TLP+++ I  +D  +  + + +F+         
Sbjct: 322 RGVILSFGDKHLKWALKLIMALRYRQNTLPIQIIITKNDLSKNSMEKILFAAQSDEVQIK 381

Query: 225 ----------YNAKCIFLSDILPAPSLKKF-QFTGYQFKSLALIASSFEDVLFLDADNFP 273
                     +  + I   D+      + F  FTG++ K LA I + FE+ +FLDAD   
Sbjct: 382 DKKGNVMKDVFTKQEIIFVDVTNIIDPEFFDNFTGWKSKWLASIFNLFEEYIFLDADAIS 441

Query: 274 VKTLDHIFEQDPYHSTGLVLWPD-----FWRRTTQPLFYDIAGI-----------QVDRK 317
              L+H F    Y+ TG + + D     +  RT   L   +  +            +D +
Sbjct: 442 YVDLNHYFNTKEYNETGTIFFRDRMLEHYLPRTCNALLESVHPMLPESKYFDNHKYIDEE 501

Query: 318 KRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLAL 377
             +  C   L P E   K     ++   H +         ESG   I K+ H+  +++ +
Sbjct: 502 HVLNECEQYLDPNEKIYKQF--FADNLLHQM---------ESGLYAIDKTSHIIPLIMGM 550

Query: 378 YYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPY 415
             +         M        GDKE F       G PY
Sbjct: 551 TLH---------MLPIEKCSYGDKEFFWLGFLASGHPY 579

>Kwal_23.2926 s23 complement(78806..80512) [1707 bp, 568 aa] {ON}
           YGL257C (MNT2) - Mannosyltransferase [contig 247] FULL
          Length = 568

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 100/236 (42%), Gaps = 35/236 (14%)

Query: 189 LVIKTLRNLH---TTLPVEVFIPPSDEGETD---LCETVFSKYNAKCIFLSDILPAPSLK 242
           LVI+ L+ LH     LP++V I   D  E     + E +    N   + +S +L    ++
Sbjct: 194 LVIRLLKVLHHQKNELPIQV-IHKGDLSEASKNLISEALSPSQNLWFVDVSSMLNKRFVR 252

Query: 243 KFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTT 302
              F+GY+ K LA+I ++F + +F+DAD   + + +  FE   Y+ TG + + D  R   
Sbjct: 253 --DFSGYKNKWLAMILNTFSEAVFIDADAVSMMSFEDYFEMGLYNQTGALFFKD--RAFD 308

Query: 303 QPLFYDIA---------GIQVDRKKRVRNCFDDLTPPEVYTKNLGDLS--NVPFHDLEGS 351
               YD           G    R  + R    DL       +N  D S       D    
Sbjct: 309 HKFDYDFCVPMIKSLQPGKHETRYFQHRKRLIDLQ-----LRNTQDPSTEQTIIKDFFEG 363

Query: 352 IPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTA 407
                 +SG ++I K KHL  +L A++ N+       P  S+     GDKETF  A
Sbjct: 364 YQRHQMDSGLVLIEKGKHLTPLLAAVFLNLA------PKLSK--CTHGDKETFWLA 411

>NDAI0A08550 Chr1 complement(1967085..1969079) [1995 bp, 664 aa]
           {ON} 
          Length = 664

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 114/285 (40%), Gaps = 22/285 (7%)

Query: 167 KNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSD-EGETDLCETVFSKY 225
           K +  G+GIV         M   ++     +   LP+++     D   ET      F+K 
Sbjct: 257 KKAAHGKGIVVTMKDLDKNMFEGLVTVFEEMGNKLPIQLVSTGKDFTKETMDHLQNFAKN 316

Query: 226 NAKCIFLSDILPA--PSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQ 283
             + ++  D  P       +     Y  K + ++ ++FE+++F DAD+ P    +   E 
Sbjct: 317 AKQDVYYVDCSPMLDQDFVEKNIKSYVNKWIGVLFNTFEELVFFDADSVPFIAPEKFLEN 376

Query: 284 DPYHSTGLVLWPDFWRRTTQPLFYDIAGIQV-----DRKKRVRN--CFDDLTPPEVYTKN 336
             Y  TG   + D      +   Y I  IQV     + KK +++   F+ L PPE  + +
Sbjct: 377 SEYKKTGAYFFRDRSLGNDRTFQYCIDMIQVMEPSKEEKKLIKSKTKFETLNPPETKSSS 436

Query: 337 LGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRAS 396
              + N  F + + +    + +SG +M++K + +  +L+  + +++           +  
Sbjct: 437 EAAIFNSFFQNFQHN----NVDSGVVMLNKKQKMGGLLMGFFLHLDA--------KMKKC 484

Query: 397 GEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAML 441
             GDKE F       G  Y   KS   + G     G G  G + L
Sbjct: 485 VSGDKEMFWLGNLLAGQDYSIAKSYGSIAGNVGSMGDGKEGESTL 529

>NDAI0H01270 Chr8 (306136..308106) [1971 bp, 656 aa] {ON} Anc_7.123
          Length = 656

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 115/284 (40%), Gaps = 39/284 (13%)

Query: 172 GQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPP---SDEGETDLCETVFSKYNAK 228
           G+GIV       S M    +K L +L+  LP+++       S E   DL   V  +   K
Sbjct: 270 GKGIVVTMSEGDSYMFKKQLKVLDHLNNELPIQIITKGNEFSTEFINDLSNFVQKETKQK 329

Query: 229 CIFL--SDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPY 286
              L  S +L      K+    Y  K LA+I ++F++++ LDAD  P   ++  FE+  +
Sbjct: 330 VAILNISSMLDPAFADKYIVNFYN-KWLAVIFNTFQEIIILDADVVPFVPINDFFEEKKF 388

Query: 287 HSTGLVLWPDFWRRTTQPLFYDIAGIQ-----------VDRKKRVRNCFDDLTPP--EVY 333
            ++G++L+ D          Y I  ++           ++ K  V +  +   PP  E  
Sbjct: 389 KNSGMLLYKDRLMVNEHTFSYCIDSMKFLEPSSLELKYLNTKLLVDSNTEIAIPPSSEEL 448

Query: 334 TKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQ 393
           +       N+  H +         +SG ++I+K + L  +LL+   +++G          
Sbjct: 449 SVYYNFFKNLRLHHI---------DSGLVVINKQEKLNGLLLSFALHLDG--------KL 491

Query: 394 RASGEGDKETFLTAASFYGLPYYQLKSATGVE---GYHRPDGQG 434
           R    GDKE F     F G  Y       GV    G   PDG+ 
Sbjct: 492 RRCVYGDKEFFWLGQLFIGQDYSIYSMDGGVSGPLGETNPDGKN 535

>CAGL0C03960g Chr3 complement(389250..391121) [1872 bp, 623 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 623

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 114/277 (41%), Gaps = 36/277 (12%)

Query: 171 KGQGI-VTVGGGKFSLMALLVIKTLRNLHTTLPVEVF-----IPPSDEGETDLCETVFSK 224
           +G+GI +TV      L+  L  K L  L    PVEV      + P  E   DL      +
Sbjct: 233 RGRGITLTVAPDDIKLLRSL-FKVLEKLGNEYPVEVVHKGGEMTPKME---DLIRQYAEE 288

Query: 225 YNAKC--IFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFE 282
            N +   I LS IL  P   +     +  K LA + ++FE+V+ LDAD       DH FE
Sbjct: 289 TNQEVYVINLSPILD-PDFAEENIKRFSNKWLAAMFNTFEEVMLLDADVVLYNHPDHFFE 347

Query: 283 QDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQ-------VDRKKRVRNCFD-DLTPPEVYT 334
              Y  TGL+LW D  R  T    YD            ++  K +       LT P +  
Sbjct: 348 LKGYQDTGLMLWKD--REITDTDVYDKCTAMAPFFEPSLEEHKLLGTTQKYRLTGPSLEA 405

Query: 335 KNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQR 394
            N  + + +  +  +  +  +  +SG ++ +K + L  ++L+ YY++N            
Sbjct: 406 HNESEATTLIDYFRKKRLNVI--DSGVVIFNKKQKLHALVLSNYYHINRKFL-------- 455

Query: 395 ASGEGDKETFLTAASFYGLPYY---QLKSATGVEGYH 428
               GDKE F       G  Y+   Q  +A G  G+H
Sbjct: 456 GCVHGDKEFFEFGVLAAGEDYHIAPQRAAALGPIGFH 492

>Suva_5.322 Chr5 (525925..527586) [1662 bp, 553 aa] {ON} YGL257C
           (REAL)
          Length = 553

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 110/248 (44%), Gaps = 43/248 (17%)

Query: 187 ALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETV-------FSKYNAKCIFLSDI--LP 237
            L ++K LR++    P+E+ +   D  +  +   V         +Y A+ I+  ++  + 
Sbjct: 184 TLRLLKVLRSIKNNFPIEI-VHKGDLSKDSIGSLVKYARNQDALEYPAQEIWFLNVHSVL 242

Query: 238 APSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDF 297
           +P   + +F  Y  K LALI SSFE  + LD+D  P  ++D +++ + +  TG++ + D 
Sbjct: 243 SPGYSE-KFEAYSNKWLALIFSSFEIPILLDSDTVPFVSIDKLYKLEEFQRTGVLFFKD- 300

Query: 298 WRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPF-------HDLEG 350
             R      ++++ + V  K+ +  C            NL D SN+           LE 
Sbjct: 301 --RIISDDLFELSQVDV-LKEVIYGCVG---------LNLTDESNINHIKDPMVAQALEN 348

Query: 351 SIPEV---STESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTA 407
            + +      ESG +++ K +HL ++L +L    +  + Y+          GDKE F   
Sbjct: 349 MLVKKYKHHLESGLVILDKKRHLFSVLTSLALQFSPIAEYF---------HGDKEWFWLG 399

Query: 408 ASFYGLPY 415
           A   G P+
Sbjct: 400 ALLSGNPF 407

>CAGL0C03982g Chr3 complement(391909..393798) [1890 bp, 629 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P53745 Saccharomyces cerevisiae
           YNR059w MNT4
          Length = 629

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 66/137 (48%), Gaps = 11/137 (8%)

Query: 167 KNSYKGQGI-VTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGE-TDLCETVFSK 224
           K   KG+GI +T+  G   L+  L  K L+      PV++       GE T   E++  K
Sbjct: 233 KRESKGKGITLTIAPGDIKLLRSL-FKVLQRQGNEYPVQII---QKGGEMTPKMESLIKK 288

Query: 225 YNAKC---IFLSDILPA--PSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDH 279
           Y  +    +++ D+ P   P+    + T +Q K  A + ++FE+ L LDAD       +H
Sbjct: 289 YALETEQDVYIIDLAPILDPAFAIQRITKFQNKWFASMFNTFEEALLLDADVVLYTEPEH 348

Query: 280 IFEQDPYHSTGLVLWPD 296
            F+   Y  TGL+LW D
Sbjct: 349 FFKMKGYQDTGLLLWRD 365

>NCAS0F00780 Chr6 (156307..158226) [1920 bp, 639 aa] {ON} Anc_7.123
          Length = 639

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 113/273 (41%), Gaps = 27/273 (9%)

Query: 167 KNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSD---EGETDLCETVFS 223
           K S  G+GIV   G +   M    ++ L +L   LP+++    S+   E   DL  T F 
Sbjct: 236 KQSSHGKGIVLTMGERDVDMFKKQLRVLDHLGNKLPIQLVTAGSEYSPEFLKDL--TDFL 293

Query: 224 KYNAKCIFLSDILPA--PSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIF 281
           K   + ++L +  P   P         +  K +A++ ++FE+++ +DAD  P   L   F
Sbjct: 294 KTTNQEVYLVEASPILDPEFVSKYIVFFFHKWIAILLNTFEELVLIDADVVPFVPLKSFF 353

Query: 282 EQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVR------NCFDDLTP--PEVY 333
           + + Y +TGL+L+ D   +      Y +  ++     R        N   D T   P   
Sbjct: 354 KSEGYKTTGLLLFKDRNMKGEHTFTYCMESLKYMEPSRQETEYIQTNLLIDSTKELPSPT 413

Query: 334 TKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQ 393
           +     + N  F DL         +SG + ++K++ +  +L++   ++NG         Q
Sbjct: 414 SSEEAAVYNHFFKDLRLH----HVDSGLVTVNKNEKMNGLLMSFMLHLNGK-------IQ 462

Query: 394 RASGEGDKETFLTAASFYGLPYYQLKSATGVEG 426
           R    GDKE F     F G  Y       GV G
Sbjct: 463 RCV-YGDKEFFWLGQLFAGQDYSIHPMDAGVAG 494

>Kpol_298.4 s298 (12426..14321) [1896 bp, 631 aa] {ON}
           (12426..14321) [1896 nt, 632 aa]
          Length = 631

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 109/263 (41%), Gaps = 18/263 (6%)

Query: 172 GQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYN--AKC 229
           G+GIV   G +   M   +++ L       P+++ +   +E   +    +  +     + 
Sbjct: 239 GKGIVITMGERDKPMLFKLLRVLEFQDNKYPIQI-VTSGNELSREFINEIHDELQRIKQD 297

Query: 230 IFLSDI--LPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYH 287
           ++L D   L  P   K     +  K LA+I ++FE+V+FLD D  P   +D+ F+ + Y 
Sbjct: 298 VYLVDCGSLLDPHYSKDLIINFLNKWLAVIFNTFEEVIFLDVDVIPFVDMDYFFDNEEYK 357

Query: 288 STGLVLWPD--FWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVP- 344
           S+ L+L+ D      +T P   D+   +V+  +            +  TK     S V  
Sbjct: 358 SSNLLLYKDRVMLHESTYPHCIDMFH-EVEPSREESAVLGTKILFDSRTKEFDHNSQVAM 416

Query: 345 -FHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKET 403
            F +    +     +SG ++++K + L  +L +   +++           R    GDKE 
Sbjct: 417 TFRNFFRKLQLHHVDSGLIVVNKMEKLNGLLFSFMLHLDAKV--------RRCVYGDKEL 468

Query: 404 FLTAASFYGLPYYQLKSATGVEG 426
           F     F G  Y   K  +G+ G
Sbjct: 469 FWIGQLFAGQTYSIDKIDSGLIG 491

>CAGL0C03916g Chr3 complement(383989..385875) [1887 bp, 628 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 or uniprot|P39106 Saccharomyces
           cerevisiae YER001w MNN1
          Length = 628

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 113/281 (40%), Gaps = 32/281 (11%)

Query: 167 KNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYN 226
           K   KG+GI      K   +   + K    L  T P+++     +   T   E++   Y 
Sbjct: 233 KQESKGRGIALTAAPKDVKLLRSLFKVFEKLGNTYPIQIVQKGGEMSPT--MESLIKDYA 290

Query: 227 AKC---IFLSDILPA--PSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIF 281
            +    +F+ D+ P   P         +Q K  A I ++FE+V+ +DAD       +  F
Sbjct: 291 IETNQNVFIVDLSPVLDPDFATDHIRKFQNKWFASIFNTFEEVMLIDADVVIYTEPESFF 350

Query: 282 EQDPYHSTGLVLWPD-------FWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYT 334
             D Y +TGL+LW D          R T    Y    ++  R       +  LT P + T
Sbjct: 351 NLDGYKNTGLLLWRDREIVDAKTHERCTDMAPYFEPALEEHRLLGTVQKY-RLTGPSLET 409

Query: 335 KNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQR 394
            +  +   + F      I  +  +SG ++ +K + L  ++LA Y++           S++
Sbjct: 410 HDEPEAETL-FDFFHRRIVTI-IDSGVVIYNKKQKLHGLILAEYFHN----------SKQ 457

Query: 395 ASG--EGDKETFLTAASFYGLPYY---QLKSATGVEGYHRP 430
            +G   GDKE F   A   G  Y+   +   A G  GYH P
Sbjct: 458 FAGCVYGDKEYFEFGALVAGEDYHVEAEKAVAIGAVGYHPP 498

>KNAG0D05360 Chr4 (981032..982633) [1602 bp, 533 aa] {ON} 
          Length = 533

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 115/278 (41%), Gaps = 40/278 (14%)

Query: 168 NSYKGQGIVTV-GGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYN 226
           N  +G+GIVT     KFS      +K L+  +  LP+++ +  ++  +  + E   +   
Sbjct: 155 NMAQGRGIVTTFSAKKFSDFFFRQLKVLQYHNNELPIQIIVQDNEFSDDFIAEIAAAGER 214

Query: 227 AK-CIFLSDI--LPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQ 283
            K  ++L  I  L  P+ +K+  +G+  K LA + ++FE+ + LDAD  P       F  
Sbjct: 215 TKQSLYLVKISKLLDPANQKY-LSGWINKLLANLFNTFEEFILLDADVVPYAAPHTYFST 273

Query: 284 DPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGD-LSN 342
             Y STGL ++ D      + L  +   I  D         + L P +   + LG  L  
Sbjct: 274 KEYTSTGLYMFQD------RALLSETETICTD-------TLNSLEPSKQEVELLGSYLQF 320

Query: 343 VPFHDLEGSIPEVST-------------ESGQLMISKSKHLPTILLALYYNVNGPSWYYP 389
               DL+G   E ST             E+G +  +K   +  ++ +L  N+N       
Sbjct: 321 THTMDLQGKTQEESTYTALFKKKLPHNVETGLVTANKKSKMFGLVTSLMLNLNT------ 374

Query: 390 MFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGY 427
               RA   GDKE +     F G+ Y    +   + G+
Sbjct: 375 --KLRACFWGDKEFYWLGPLFAGVSYTIEPTPAALTGF 410

>KNAG0G01070 Chr7 complement(232251..234149) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 74/329 (22%), Positives = 135/329 (41%), Gaps = 59/329 (17%)

Query: 172 GQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETV--FSKYNAKC 229
           G+G+V   G     M   +++ L NL   +P++V +    E +    + +  ++    + 
Sbjct: 234 GRGVVITMGDNDVDMFGRLVRVLENLENDIPIQV-VTTGKEMKPQFIQQLREYTVQTGQR 292

Query: 230 IFLSDILPAPSLKK----FQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDP 285
           I L D   +P L +    F+ T +  K +A I ++FE+ + +D D+ P   L   FE + 
Sbjct: 293 IQLVD--SSPMLDRLYVAFKITRFLNKWVATIFNTFEEAILIDVDSIPFVPLSTFFEIES 350

Query: 286 YHSTGLVLW---------------PDFWRRTTQP-----------LFYDIAGIQVDRKKR 319
           Y +TG+ ++                DF  R  +P           L +D++  Q +  +R
Sbjct: 351 YKTTGIYMYRDRDIKHEHAPEKCIADF--RNLEPSVQETDLIGTSLRFDLS--QSNDLQR 406

Query: 320 VRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYY 379
            +   + +T  EV  KN     N   H ++         SG ++I+K K L ++LLA   
Sbjct: 407 QQQNGESITIEEVIYKNF--FHNYNLHQVD---------SGLVVINKHKQLHSLLLAFQL 455

Query: 380 NVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEG-YHRPDGQGFRGV 438
           +++G      +F +     GDKE F       G+ Y      + V G ++  +G+     
Sbjct: 456 HLSG------VFEKCV--HGDKEFFWLGPLLSGVDYTIDPLGSSVIGQFYEDNGKTGICA 507

Query: 439 AMLQHDVTQDYMRYKTAQKAISNKYGAQA 467
             + H    D + +      I    GA A
Sbjct: 508 PQMSHLNDFDQLMWTNGGLKICKFKGAAA 536

>AFL235W Chr6 (2..1147) [1146 bp, 381 aa] {ON} Non-syntenic homolog
           of Saccharomyces cerevisiae YIL014W (MNT3) and YER001W
           (MNN1)
          Length = 381

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 107/251 (42%), Gaps = 49/251 (19%)

Query: 190 VIKTLRNLHTTLPVEVFI--PPSDEGETDLCETVF--SKYNAKCIFLSDILPAPSLKKFQ 245
           ++  L +   TLP+E+ +   PS E    +   +   +K + + +    IL  PS +   
Sbjct: 1   LLAVLDHHGNTLPIELVLTESPSHERIQKIAHYLRDKTKQSLRIVDCKKIL-EPSYRPLI 59

Query: 246 FTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPD--------- 296
           F  +++K LA + +S E+V+F+D D  P  ++D  FE + Y STG++++ D         
Sbjct: 60  F-DFRYKWLAYLLNSSEEVVFIDLDVVPFVSIDKFFEMEGYKSTGILMFQDRVFNSIKNS 118

Query: 297 ---------FWRRTTQPLFYDIAGIQVDR-KKRVRNCFDDLTPPEVYTKNL-GDLSNVPF 345
                          Q L+   A    ++ K R++N  DD     VY + L GD  ++  
Sbjct: 119 KCRTAIHHILPSHAEQTLWKHQAKYTKEKAKHRLKNFPDDAGAASVYDRYLEGDRMHM-- 176

Query: 346 HDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFL 405
                       ESG +++ K K + +++++L  ++N     Y          GDKE   
Sbjct: 177 -----------VESGLVVVDKRKKISSLIISLMLHMNIAECSY----------GDKEYLW 215

Query: 406 TAASFYGLPYY 416
                 G  YY
Sbjct: 216 LGQLVSGEDYY 226

>CAGL0C03894g Chr3 complement(381514..383397) [1884 bp, 627 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2
          Length = 627

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 100/257 (38%), Gaps = 15/257 (5%)

Query: 167 KNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETD---LCETVFS 223
           K   +G+GIV     + + M + +I  L +L   LP+++ I  +  G      L E    
Sbjct: 217 KKHARGRGIVVTFKEEEANMMMKLIAVLGHLKNRLPIQIVIQGNKFGSRTIEMLKEKAIE 276

Query: 224 KYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQ 283
           K     I  +  L      +    GY  K +A I ++FE+ + LD D  P       FE+
Sbjct: 277 KKQQIYIVDATKLLMEKYAEVHIQGYTNKWIASIFNTFEEFILLDVDTVPFINPKKFFEK 336

Query: 284 DPYHSTGLVLWPD---FWRRTTQPLFYDIAGIQVDR-KKRVRNCFDDLTPPEVYTKNLGD 339
             Y +TG  ++ D      +  +     I+G Q+   + RV N     +P      +   
Sbjct: 337 KGYRTTGFYMYQDRNLVNEKLGRKCVDIISGAQLSGYEARVLNTGFLYSPYFAREDDYTT 396

Query: 340 LSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEG 399
            S   ++ L  +      ES  ++I+K + L  +L++   N           + +    G
Sbjct: 397 ASARAYYKLFNNWTLHQAESVLVVINKKQKLGGLLMSFMLNTQ--------IALKQCFLG 448

Query: 400 DKETFLTAASFYGLPYY 416
           DKE F         PYY
Sbjct: 449 DKEFFWIGQLMNNSPYY 465

>Smik_9.180 Chr9 (300789..302681) [1893 bp, 630 aa] {ON} YIL014W
           (REAL)
          Length = 630

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 111/264 (42%), Gaps = 40/264 (15%)

Query: 171 KGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCE-TVFSKYNAKC 229
           +G+G V     K   + L  +K +  L   LP ++           + E +  +K   + 
Sbjct: 233 EGRGFVLTFAEKDVPLFLKQLKVMDFLRNELPFQIITTGEGLSTESIAEISKIAKEAKQK 292

Query: 230 IFLSD---ILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPY 286
           ++L D   +L     KK+  + +Q K +A + ++F++ + LDAD  P    D+ F+   Y
Sbjct: 293 VYLVDCSTVLDTEFSKKY-ISFFQNKWVATLFNTFKEYILLDADVVPFVESDYFFDSPSY 351

Query: 287 HSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDL----SN 342
             +G++L+ D   ++ Q   Y I  ++            ++ P     K++G      S+
Sbjct: 352 RQSGILLFKDRVMKSEQTFSYCIEMLR------------EVEPSGQERKSIGSKLIFDSS 399

Query: 343 VPFHDLEGSIPEV-----------STESGQLMISKSKHLPTILLALYYNVNGPSWYYPMF 391
           +PF  +      V             +SG ++++K + L  +L++  +N+NG        
Sbjct: 400 LPFSSINSEEASVYYNFFKKLQLHHVDSGLVVVNKLEKLNGLLMSFMFNLNGK------- 452

Query: 392 SQRASGEGDKETFLTAASFYGLPY 415
            QR    GDKE F     + G  Y
Sbjct: 453 LQRCV-YGDKEIFWLGQLYAGQDY 475

>KNAG0G01060 Chr7 complement(228987..231071) [2085 bp, 694 aa] {ON}
           Anc_7.123 YIL014W
          Length = 694

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 95/227 (41%), Gaps = 15/227 (6%)

Query: 171 KGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETV--FSKYNAK 228
           +G+GIV       S M    + T + L   LP++V +    E      ET+   +K   +
Sbjct: 285 EGKGIVLTMRESDSGMFYKQLNTFKELGNKLPIQV-VTTGKEATNKFVETLGKLAKKTEQ 343

Query: 229 CIFLSDI--LPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPY 286
            I+L D+  L  P   + +   +  K +A I ++FE+ +F+D D      +   F+ + Y
Sbjct: 344 KIYLVDVSKLLKPDFVQDKIINFLNKWIATIFNTFEEEVFIDVDAISYVPMQDYFQTENY 403

Query: 287 HSTGLVLWPD-------FWRRTTQPLFYDIAGIQVDRKKRVRNCFDDL---TPPEVYTKN 336
             TG++++ D        ++R T  L       +  R    R  FD L      +V  K 
Sbjct: 404 KDTGILMFRDRTLLQENTFKRCTDLLIEAEPTKEEVRLIGSRQMFDSLWLKKNDDVPDKE 463

Query: 337 LGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNG 383
           L       + +    +     +SG + I K   L  +L++ ++N++ 
Sbjct: 464 LMSTEAEVYRNFYERLKLHHVDSGLIAIHKKYKLTGVLMSFFFNLDA 510

>TBLA0A00640 Chr1 (128803..131046) [2244 bp, 747 aa] {ON} 
          Length = 747

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 68/147 (46%), Gaps = 26/147 (17%)

Query: 173 QGI-VTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVF--------- 222
           +GI + +G G+  L AL +I TLR    TLP+++ +   +  +  + + +F         
Sbjct: 320 RGISMCIGDGQLKL-ALKLITTLRYSGNTLPIQIIMKKGELSKGSIEKLIFAAQGNNFKF 378

Query: 223 ----------SKYNAKCIFLSDI---LPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDA 269
                     S Y  + I  +DI   L    L  FQ+  ++ K LA I + FE+ +FLDA
Sbjct: 379 RIDKDEYKPASSYMPQEILFTDITDLLDPEFLNDFQW--FKNKWLASIFNVFEENIFLDA 436

Query: 270 DNFPVKTLDHIFEQDPYHSTGLVLWPD 296
           D  P   L+  F    Y+ TG + + D
Sbjct: 437 DVVPYVDLNFFFNTKEYNETGTIFFKD 463

>ABR245C Chr2 complement(854587..856512) [1926 bp, 641 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YIL014W
           (MNT3)
          Length = 641

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 62/129 (48%), Gaps = 5/129 (3%)

Query: 172 GQGI-VTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPP---SDEGETDLCETVFSKYNA 227
           G+GI ++VG G   ++ L ++  L  L   LP+E+       S +    L E V +K   
Sbjct: 244 GKGITMSVGDGHLEML-LRMLTVLDYLGNELPIEIVEKGGELSQQFRDKLTEFVRNKSKQ 302

Query: 228 KCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYH 287
           K   +S              G+  K +AL+ ++FE+ +FLD D  P    +  F+ + Y 
Sbjct: 303 KVRIISCARTLDETHARLIFGFSCKWVALMFNTFEEAIFLDVDAVPYILPEQFFDMEGYK 362

Query: 288 STGLVLWPD 296
           STG++L+ D
Sbjct: 363 STGIMLFRD 371

>KAFR0K01240 Chr11 complement(258683..260683) [2001 bp, 666 aa] {ON}
           Anc_7.123 YIL014W
          Length = 666

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 62/132 (46%), Gaps = 9/132 (6%)

Query: 171 KGQGIVT---VGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCE-TVFSKYN 226
           KG+GIVT   +G  K     L V+  L N   TLP+++        E  + E   +SK  
Sbjct: 263 KGRGIVTTLPIGDIKLFYKQLKVLDYLNN---TLPIQIVTTGGASVELFIEELKSYSKST 319

Query: 227 AKCIFLSDILPA--PSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQD 284
            + I L D  P    S        +  K ++++ ++FE+++F+D D  P    +  FE D
Sbjct: 320 HQKILLIDTSPMLNTSFASLYIRFFSNKWISILFNTFEEMIFMDVDVVPFVNPNEFFEID 379

Query: 285 PYHSTGLVLWPD 296
            Y  TG+ ++ D
Sbjct: 380 GYKETGIFMYKD 391

>KLLA0E09813g Chr5 (867899..870139) [2241 bp, 746 aa] {ON} similar
           to uniprot|P39106 Saccharomyces cerevisiae YER001W MNN1
           Alpha-1 3-mannosyltransferase integral membrane
           glycoprotein of the Golgi complex required for addition
           of alpha1 3-mannose linkages to N-linked and O- linked
           oligosaccharides one of five S. cerevisiae proteins of
           the MNN1 family
          Length = 746

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 113/288 (39%), Gaps = 65/288 (22%)

Query: 173 QGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPS-DEGETDLCE-----TVFSKYN 226
           +GI+   G       + +I TLR     LP+++      +E    L       T FS   
Sbjct: 335 RGIILAAGDGQVDQCIRLIATLRAQGNALPIQIIHNNQLNEKSVKLLSEAAKSTEFSSGR 394

Query: 227 AKCIFLSDILPA-PSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDP 285
           A+ ++L ++ P   S  K  F  ++ K L++I ++FE+ +F+D D      +   F    
Sbjct: 395 AQSLWLVNVGPTLESSMKSNFGRFKNKWLSVIFNTFEEFIFIDTDAISYINMADYFNFKE 454

Query: 286 YHSTGLVLWPDF-----WRRTTQPLFYD----------------IAGIQVDRKKRVRNCF 324
           Y STG + + D        +   PLF                  I G  V+++     C 
Sbjct: 455 YKSTGTLFFKDRSLAIGTEQKCGPLFETLEPRILEMYYFNTLPMINGDYVEQQ-----CM 509

Query: 325 DDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYN---- 380
             LTP E   K   ++ +   H+LE         SG L I+K++H+  ++ A   N    
Sbjct: 510 GMLTPEEKVYKRFFEVGHQ--HNLE---------SGLLAINKNEHIMGLVTATVLNIAPK 558

Query: 381 VNGPSWYYPMFSQRASGEGDKETF----LTAASFYGLPYYQLKSATGV 424
           V G  W            GDKE F    L A   Y + Y    SA GV
Sbjct: 559 VGGCGW------------GDKEFFWLGLLVAGQRYSI-YDIDASAIGV 593

>KAFR0K01260 Chr11 complement(261190..263076) [1887 bp, 628 aa] {ON}
           
          Length = 628

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 64/135 (47%), Gaps = 15/135 (11%)

Query: 171 KGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETD---------LCETV 221
           KG+GIVT    K        +K L+ L   LP+  +I  SD   TD         + ET 
Sbjct: 238 KGKGIVTTLHSKELDFFYRQLKVLQKLDNKLPI--YIVSSDGDITDNHKNELFTQVKETT 295

Query: 222 FSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIF 281
              Y   C   S IL  PS  +     +  K +A++ +  E+V+F+DAD  P+ +++  F
Sbjct: 296 QQVYVVGC---SQIL-NPSFSQKHLKSFLNKWVAILFNPLEEVIFMDADAVPLISVEDYF 351

Query: 282 EQDPYHSTGLVLWPD 296
           + + Y  +GL ++ D
Sbjct: 352 KYEDYKESGLYVFKD 366

>NCAS0I00480 Chr9 (77950..79923) [1974 bp, 657 aa] {ON} 
          Length = 657

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 101/256 (39%), Gaps = 24/256 (9%)

Query: 171 KGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSD-EGETDLCETVFSKYNAKC 229
           KG+GIV         + + +I TL+ +  TLP+++     D E ET      F +   + 
Sbjct: 248 KGKGIVINMKETEKDLFMSLIATLQEVKNTLPIQIITTGQDFEKETFESMNRFLQTTDQQ 307

Query: 230 IFLSD---ILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPY 286
           + L D   IL A  +K+     +  K    + ++FE+V+ LDAD+ P    +  F+   Y
Sbjct: 308 VSLIDCSSILDADFVKE-HIASHLHKWFGTLFNTFEEVVILDADSVPFVAPETFFKNKEY 366

Query: 287 HSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNC-------FDDLTPPEVYTKNLGD 339
              G   + D      +   Y I  I+     +  +        F    PPE  +     
Sbjct: 367 KDAGSFFFRDKTLGNERTYQYCIEMIEAMEPSKAESGLINTKLKFTSNNPPEDNSSPAAS 426

Query: 340 LSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEG 399
           + N  F    G     + +SG +++ K + L ++L+    N++          Q  SGE 
Sbjct: 427 VYNTFF----GKYKHKNLDSGVVVLKKKEKLTSLLMGFMMNLDAK------MKQCVSGE- 475

Query: 400 DKETFLTAASFYGLPY 415
            KE F       G  Y
Sbjct: 476 -KELFWLGHLIAGQDY 490

>YGL257C Chr7 complement(12481..14157) [1677 bp, 558 aa] {ON}
           MNT2Mannosyltransferase involved in adding the 4th and
           5th mannose residues of O-linked glycans
          Length = 558

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/268 (22%), Positives = 115/268 (42%), Gaps = 59/268 (22%)

Query: 124 YNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGGGKF 183
           +  W     +  S+ +V+S +DV +L ++    ++ L  L   KN Y  Q +      + 
Sbjct: 162 WENWLHTVTQSGSKGIVISASDV-QLNET----IRLLKVLRFIKNDYPIQIVHNADLSQD 216

Query: 184 SLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDI--LPAPSL 241
           S+ +  +IK  R+L T                       ++Y A+ ++  ++  L  P  
Sbjct: 217 SMKS--IIKYARSLDT-----------------------AEYPAQELWFLNVHSLLNPKY 251

Query: 242 KKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRT 301
            K +FT Y  K LAL  SSFE  + +D+D  P  +++  +E + +  TG++ + D  R  
Sbjct: 252 SK-KFTTYSNKWLALTFSSFEIPILMDSDTVPFVSIEKFYELEEFQKTGVLFFKD--RVI 308

Query: 302 TQPLF------------YDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLE 349
           +  LF            Y   G+ ++ + ++    +D    +V       L N+     +
Sbjct: 309 SDDLFESSELKILREIVYGCIGLDLEDESKIHEQVEDPVVAQV-------LENMFIKKYK 361

Query: 350 GSIPEVSTESGQLMISKSKHLPTILLAL 377
             +     ESG +++ K KHL ++L ++
Sbjct: 362 HHL-----ESGLVILHKGKHLFSMLTSI 384

>Kwal_55.20984 s55 complement(634833..636692) [1860 bp, 619 aa] {ON}
           YIL014W (MNT3) - Product of gene unknown [contig 135]
           FULL
          Length = 619

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 69/133 (51%), Gaps = 5/133 (3%)

Query: 168 NSY-KGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPP---SDEGETDLCETVFS 223
           NS+ KG+G+V   G +     L ++K L   + +LP+++   P   SD    +L E + S
Sbjct: 217 NSFSKGKGLVFSLGERHLDPFLRLLKILDQQNNSLPIQIVQQPHELSDAFLGNLTEFLQS 276

Query: 224 KYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQ 283
            +        + L   + K +  T +  K LA I ++F +V+ +DAD  P   ++  F++
Sbjct: 277 SHQEVYYIDCEALLDTTYKAY-MTYFVNKWLASIFNTFSEVVLMDADVVPFVPVESFFQE 335

Query: 284 DPYHSTGLVLWPD 296
           + Y +TG++L+ D
Sbjct: 336 EQYKATGVLLYKD 348

>Smik_7.4 Chr7 complement(8045..9733) [1689 bp, 562 aa] {ON} YGL257C
           (REAL)
          Length = 562

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 74/312 (23%), Positives = 127/312 (40%), Gaps = 70/312 (22%)

Query: 108 SKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPK 167
           SK  +   D+ F    +  W     +  S+ +VVS +D     Q H + ++ L  L   K
Sbjct: 149 SKPVNFKTDLSF----WENWLHSIIQSGSRGIVVSASDA----QVH-EIIRLLRILRFLK 199

Query: 168 NSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNA 227
           N Y  Q +      + S+   L+ K  RN  +T                       KY +
Sbjct: 200 NDYPIQIVYNADLSQDSIK--LITKYARNQDST-----------------------KYPS 234

Query: 228 KCIFLSDI--LPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDP 285
           + I+  +I  L +P     +F  Y  K LALI SSFE  + LD+D  P  ++D  ++ + 
Sbjct: 235 QEIWFLNIHNLLSPKYSD-KFATYSNKWLALIFSSFEIPILLDSDTVPFVSIDKFYKLEE 293

Query: 286 YHSTGLVLWPDFWRRTTQPLF------------YDIAGIQVDRKKRVR-NCFDDLTPPEV 332
           +  TG++ + D  R  +  LF            +   GI +  + ++R N  + +  P V
Sbjct: 294 FQKTGVLFFKD--RVISDDLFDPPQLEVLKDIIHGCTGINLLDESKIRDNIAEHIREPTV 351

Query: 333 YTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFS 392
                  L N+     +  +     ESG +++ K KHL ++L ++    +  S Y+    
Sbjct: 352 ARV----LENMLIKKYKHHL-----ESGLVVLHKGKHLFSMLTSISLQFSPISEYF---- 398

Query: 393 QRASGEGDKETF 404
                 GDK+ F
Sbjct: 399 -----HGDKDFF 405

>TDEL0F05640 Chr6 complement(1055778..1057442) [1665 bp, 554 aa]
           {ON} 
          Length = 554

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/291 (20%), Positives = 119/291 (40%), Gaps = 37/291 (12%)

Query: 175 IVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKC----- 229
           ++++G G+ +   + +I  LR L  TLP+++ +   D     + E   +    +      
Sbjct: 180 VISIGDGQVA-DTIRLIHVLRYLDNTLPIQL-VHKGDLSSAKVEELFKAARERRSDGSPP 237

Query: 230 --IFLSDI--LPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDP 285
             +++ D+  L  P++  ++F  +  K LAL+  SFE  + LDAD  P   L+  ++ D 
Sbjct: 238 QELWIVDVKNLLNPAMI-YEFKRFSNKWLALLFCSFEKPILLDADTVPFTKLEEYYDTDQ 296

Query: 286 YHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPF 345
           +   G V + D  R  T  +      +   +++ ++  FD L        +      +  
Sbjct: 297 FKKYGTVFFKD--RTLTAHM------LNRGQRRTLKRIFDGLLTSSDRQSSADSYYGIQD 348

Query: 346 HDLEGSIPEV-------STESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGE 398
             ++ ++  +         ESG +   K KHL  +L +L    +  + Y+          
Sbjct: 349 PIVQKALERILKKRQKHIMESGLVAYDKKKHLFGLLTSLALQFSPLNEYF---------H 399

Query: 399 GDKETFLTAASFYGLPY-YQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQD 448
           G+KE F  +    G+P+ +    A+ V    +     FR  ++      QD
Sbjct: 400 GEKEWFWISQLIRGVPFSFHPVEASSVGRIEKTSEDEFRVCSVQLSHTEQD 450

>TBLA0C06250 Chr3 (1512916..1515126) [2211 bp, 736 aa] {ON} 
          Length = 736

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 112/301 (37%), Gaps = 69/301 (22%)

Query: 173 QGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNA----- 227
           +GI+       +  AL +I TLR +   LP+++ I  +D  +  + +  +   N      
Sbjct: 305 RGIILSFSDGQTETALRLISTLRFMGNRLPIQI-IFKNDISDKSIEQVFYVATNKNYKPF 363

Query: 228 -------------KCIFLSDI--LPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNF 272
                        + ++  DI  L  P  K  +F+ ++ K LA   + FE+ LF+D D  
Sbjct: 364 NDQVNWEHKNDVKQNVYFVDIENLLDPKYKD-KFSRFKNKWLASNFNMFEEFLFIDTDAI 422

Query: 273 PVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEV 332
                +  FE   Y  +G V + D   RT    + D A           +    L PP +
Sbjct: 423 TYIDPNDYFELQEYKESGTVFFRD---RTWPKQWGDEAKC---------SSLMSLLPPRI 470

Query: 333 YTKNLGDLSNVPFHDLE-----------------------GSIPEVSTESGQLMISKSKH 369
                   +N P  D++                       G I ++  ESG   I+K+KH
Sbjct: 471 LESKY--FNNYPLFDVDYIKETPSTRLSIEEKIYKRYFENGRIHQM--ESGVFAINKNKH 526

Query: 370 LPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHR 429
           + +IL     N++  +         + G GDKE F       G  Y    +  GV G + 
Sbjct: 527 IISILTGTILNIDHVT--------ESCGYGDKEFFWFGFMISGHKYRFYNTTVGVIGNYD 578

Query: 430 P 430
           P
Sbjct: 579 P 579

>TBLA0H00130 Chr8 complement(8943..11006) [2064 bp, 687 aa] {ON} 
          Length = 687

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 65/145 (44%), Gaps = 24/145 (16%)

Query: 173 QGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNA----- 227
           +GI+     K    A+ ++ +LR    TLP+++     D  + ++   +F+  N      
Sbjct: 257 RGIIMSFTDKEVDWAIRLLVSLRYQGNTLPIQIIYTDGDLTDENIQRLIFAAQNGNVRVP 316

Query: 228 --------------KCIFL--SDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADN 271
                         + +FL  + +L +  ++ F+F G   K LA   + FE+ +FLDAD 
Sbjct: 317 YKNGAPRPGQLTVQEIMFLDVTKMLDSNFVEDFKFKG---KWLASFFNLFEEHIFLDADT 373

Query: 272 FPVKTLDHIFEQDPYHSTGLVLWPD 296
            P   L++ F    Y+ TG + + D
Sbjct: 374 VPYVDLNYFFNTQEYNQTGTLFFRD 398

>Kwal_23.5454 s23 (1171360..1173111) [1752 bp, 583 aa] {ON} YGL257C
           (MNT2) - Mannosyltransferase [contig 9] FULL
          Length = 583

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 123/290 (42%), Gaps = 62/290 (21%)

Query: 167 KNSYKGQGIV-TVG-GGKFSLMALLVIKTLRNLHTTLPVEV------------FIPPSDE 212
           K  Y G+GIV ++G GG   ++ LL  + LR L  TLP+++             I  +  
Sbjct: 183 KERYSGKGIVISIGEGGVDEVIRLL--RVLRALKNTLPIQLVHKGDVSASSMNMIIQAGR 240

Query: 213 GETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIAS---SFEDVLFLDA 269
           G+ +  + ++S  +     +  +  A S+KK     +Q  S   IAS   SFE+++ +D+
Sbjct: 241 GKIEDKQGIYSDISEHPQEIWFVNAARSIKKGNLDLFQRFSNKWIASLFNSFEEMILMDS 300

Query: 270 DNFPVKTLDHIFEQDPYHSTGLVLWPDF----WRRTTQPLFYDIAGIQVDRKKRVRNCFD 325
           D  P      +F+   Y  TG   + D     + R++   FY         +K + + ++
Sbjct: 301 DVVPFLNPKELFDATEYRETGAYFFKDRPIDEFLRSSDLSFY---------RKLLPSEWE 351

Query: 326 ----DLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLA----L 377
               ++ P   +T   G L +   H +         ESG +++++  H+P +L++    L
Sbjct: 352 YTAFEMQPLTDHTYGNGFLKHGYKHFM---------ESGVVVLNRRNHMPGLLISATMQL 402

Query: 378 YYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQL-KSATGVEG 426
           +   + P +            GDKE F    S  G   Y+  K+  G  G
Sbjct: 403 WKETSQPIY------------GDKELFWLGQSIAGNENYRFNKNEAGAIG 440

>TBLA0A01160 Chr1 complement(267341..269332) [1992 bp, 663 aa] {ON} 
          Length = 663

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 60/140 (42%), Gaps = 2/140 (1%)

Query: 172 GQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIP--PSDEGETDLCETVFSKYNAKC 229
           G+GIVT        +    +  L +L+   P+++     P+ E    L  TV        
Sbjct: 271 GKGIVTTFKESDLPLFRKQLAVLEHLNNKHPIQIISAKAPTQEFLDSLILTVQKTTQKVY 330

Query: 230 IFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHST 289
           +     +      K     +  K +A++ ++F++ +FLD D  P   +D+ FE + +  T
Sbjct: 331 LLDCSTMLDEEFSKNYIVNFLNKWVAMLFNTFKEAIFLDVDAIPFIGMDYFFENEGFEET 390

Query: 290 GLVLWPDFWRRTTQPLFYDI 309
           G++++ D   RT     Y I
Sbjct: 391 GILMYKDRVMRTEHTFQYCI 410

>Kpol_1015.13 s1015 complement(31451..33682) [2232 bp, 743 aa] {ON}
           complement(31451..33682) [2232 nt, 744 aa]
          Length = 743

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/245 (21%), Positives = 97/245 (39%), Gaps = 51/245 (20%)

Query: 170 YKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKC 229
           +  +GI          MAL +I TLR     LP+++    ++  +  + + +   ++++ 
Sbjct: 312 FAKRGIALSFADSHLEMALKLIATLRFQGNKLPIQIIYKDNELSKDTMSKILQVAHSSEL 371

Query: 230 IFL-----SDILPA--------------PSLKKFQFTGYQFKSLALIASSFEDVLFLDAD 270
            F        I P               PSL + ++T ++ K LA I + FE+ +F+D D
Sbjct: 372 KFPGTPIDESIKPVKQDVWFLDVTNTVDPSLIE-RYTDFKNKWLACIFNLFEEFIFMDID 430

Query: 271 NFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPP 330
                 +++ FE D Y  TG V + D   R +              K+     F+ LTP 
Sbjct: 431 AVNYVPMEYFFEMDEYKRTGTVFFRDRMLRASV-------------KRECVPIFETLTPN 477

Query: 331 EVYTKNLGDLSNVPFHDLEGSIPEVST------------------ESGQLMISKSKHLPT 372
            + +K  G+   +    +E    +  T                  ESG   I+K+KH+  
Sbjct: 478 YMESKYFGNFPFINKDYVEEQCDKYLTPEELIYKRYFINHKLHQMESGLFAINKTKHVIP 537

Query: 373 ILLAL 377
           ++ ++
Sbjct: 538 LIFSM 542

>SAKL0D15180g Chr4 complement(1259592..1261325) [1734 bp, 577 aa]
           {ON} similar to uniprot|P53059 Saccharomyces cerevisiae
           YGL257C MNT2 Mannosyltransferase involved in adding the
           4th and 5th mannose residues of O-linked glycans
          Length = 577

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 13/134 (9%)

Query: 173 QGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVF----IPPSDEGET--DLCETVFSKYN 226
           +GIV   G   +   + +I+ LR L   LP+EV     + P  +        E +  +Y 
Sbjct: 185 RGIVLSIGQFQTADTIRLIRILRFLKNNLPIEVVHKGDLSPHHQSVLIGAAREDLSDEYP 244

Query: 227 AKCIFLSDIL----PAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFE 282
            + ++  D+     P  S K   FT Y  K LAL+  SFE  + LDAD  P  T +  ++
Sbjct: 245 GQELWFLDVTNMLNPQYSAK---FTRYSNKWLALLFCSFEQPILLDADTVPFTTFERYYQ 301

Query: 283 QDPYHSTGLVLWPD 296
            + + ++G   + D
Sbjct: 302 SEQFKNSGTFFFKD 315

>Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON}
           YGL257C (REAL)
          Length = 566

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 88/188 (46%), Gaps = 24/188 (12%)

Query: 224 KYNAKCIFLSDI--LPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIF 281
           +Y A+ I+ S++  L +P     +F  Y  K LALI S FE  + LD+D  P   +D  +
Sbjct: 239 EYPAQEIWFSNVRNLLSPKYSN-KFATYSNKWLALIFSFFEVPILLDSDTVPFVPIDEFY 297

Query: 282 EQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVD-RKKRVRNCFD-DLTPPEVYTKNLGD 339
           + + +  TG + + D  R  +  LF      Q+D  K+ +  C   +LT      + + D
Sbjct: 298 KLEEFQRTGALFFKD--RIISNDLF---ESSQLDVLKEIIHGCIGLNLTDESDIHEKIED 352

Query: 340 LSNVPFHDLEGSIPEVST---ESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRAS 396
            + V    LE  + +      ESG +++ K KHL ++L+++    +  S Y+        
Sbjct: 353 PTVVQV--LENMLIKKHKHHLESGLVVLHKDKHLFSVLISVALQFSPISEYF-------- 402

Query: 397 GEGDKETF 404
             GDK+ F
Sbjct: 403 -HGDKDWF 409

>CAGL0C04026g Chr3 complement(397303..399213) [1911 bp, 636 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3
          Length = 636

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 59/136 (43%), Gaps = 13/136 (9%)

Query: 167 KNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGET------DLCET 220
           +N  KG+GI      K   M   +   L      LP+++     D+GET      +L ++
Sbjct: 244 RNMAKGKGIAVSVSPKEIRMLHSLFAVLNQQGNKLPIQII----DKGETLTLADKELIKS 299

Query: 221 VFSKYN--AKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLD 278
              K N     + LS I+ A    +    G   K  A + ++FE+VL LD D  P    +
Sbjct: 300 YAVKTNQDVSVVDLSPIIDAEYADE-NIIGMHNKWFAAMFNTFEEVLLLDVDVIPFVGTE 358

Query: 279 HIFEQDPYHSTGLVLW 294
             F+ +PY S  ++ W
Sbjct: 359 KFFQLEPYTSRHILFW 374

>YNR059W Chr14 (736803..738545) [1743 bp, 580 aa] {ON}  MNT4Putative
           alpha-1,3-mannosyltransferase, not required for protein
           O-glycosylation
          Length = 580

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 112/258 (43%), Gaps = 40/258 (15%)

Query: 165 LPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSK 224
           L +NS   +G+V           + +I+ LR L+ +LP+E+ +  SD  E+     + + 
Sbjct: 193 LQRNS---KGVVMSVSEYLVADTIRLIRVLRLLNNSLPIEI-VHKSDLHESSQQLLIAAA 248

Query: 225 YNAKCI--------FL--SDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPV 274
             +  +        FL   D+L    L +F+   +  K LA+   SF+  +FLD+D  P 
Sbjct: 249 RESGSLNYPPQELWFLDVKDMLNDEYLARFK--RFSNKWLAITFCSFQIPIFLDSDTVPF 306

Query: 275 KTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPP---- 330
             LD ++E D +  TG + + D    T++     ++ +QV   K++ N   D++      
Sbjct: 307 VPLDTLYEIDGFKRTGTLFFKDRSFPTSK-----LSPLQVKVLKQIINNSLDVSSDSEQG 361

Query: 331 -EVYTKNLGDLSNVPFHDLEGSIPEVS---TESGQLMISKSKHLPTILLALYYNVNGPSW 386
            E+   NL D   +    +E  I +      +SG ++  K KH   + +A+    +    
Sbjct: 362 FEILKHNLND--EMAIDAIEALIFKKQKHYMDSGLVIFDKQKHFFCLPIAIMLQFSPIQE 419

Query: 387 YYPMFSQRASGEGDKETF 404
           ++          GDKE F
Sbjct: 420 FF---------HGDKEWF 428

>KNAG0E03170 Chr5 complement(632635..634875) [2241 bp, 746 aa] {ON} 
          Length = 746

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/279 (21%), Positives = 116/279 (41%), Gaps = 24/279 (8%)

Query: 172 GQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCE-TVFSKYNAKCI 230
           G+G++T       ++    ++ L+     LP++V    S+  +  + +  + ++ + + I
Sbjct: 208 GRGLITTMKSDDIVLYEKQMRILKEFDNKLPLQVITTGSEMRDEFVKQLQIIAEIHNQEI 267

Query: 231 FL---SDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYH 287
           +L   SDI+    +   +   ++ K L+++ ++FE+ +F+D D  P       FE   Y 
Sbjct: 268 YLVDLSDIIDRRFVND-KIDRFKHKFLSVLFNTFEEAIFMDVDAVPFVETTEFFEIQAYK 326

Query: 288 STGLVLWPDF-----WRRTTQPLFYDIA-GIQVDRKKRVRNCFDDLTPPE---VYTKNLG 338
            TG+ L+ D           +PL   +       R    R  FD L   E   + TK + 
Sbjct: 327 DTGMYLYRDRSLDEGGEGNCRPLMRQLEPSFAESRLLNNRLKFDLLWAIEHNGMSTKYMT 386

Query: 339 DLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGE 398
               V F ++         ESG ++I++ K +  ++ A+ + ++         S      
Sbjct: 387 SEEAV-FKNMYVYGRRHHIESGLMVINRRKQMAGLIGAMLFGLSN--------SGSKCSW 437

Query: 399 GDKETFLTAASFYGLPYYQLKSATGVEGYHRPD-GQGFR 436
           GDKE F     + G  Y       G+ GY + D G  F+
Sbjct: 438 GDKEFFWLGNLYAGKDYAVNPMEGGIVGYLKEDPGNNFK 476

>Suva_9.191 Chr9 (314586..316463) [1878 bp, 625 aa] {ON} YIL014W
           (REAL)
          Length = 625

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 63/130 (48%), Gaps = 5/130 (3%)

Query: 171 KGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCE-TVFSKYNAKC 229
           K +G V   G K   + L  +K +  L   LP ++    ++     + + +  +K   + 
Sbjct: 232 KERGFVLTMGEKDVPLFLKQLKVMELLENVLPFQIITTGNELSPESIAKISKVAKEGGQK 291

Query: 230 IFLSD---ILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPY 286
           ++L D   +L A   K F  + +Q K +A + ++FE+ + LDAD  P    D+ F+   Y
Sbjct: 292 VYLMDCSTVLDAEFSKTF-ISFFQNKWVATLFNTFEEFILLDADVVPFVKSDYFFDSPSY 350

Query: 287 HSTGLVLWPD 296
             +G++L+ D
Sbjct: 351 KRSGILLFKD 360

>KNAG0J02990 Chr10 (576491..578425) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/266 (20%), Positives = 108/266 (40%), Gaps = 25/266 (9%)

Query: 172 GQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSD---EGETDLCETVFSKYNAK 228
           G+GIVT     FS      +K L+     LP+++ +   +   E  + L E    +   +
Sbjct: 271 GKGIVTTFSEPFSDFFFRQLKVLQYQENKLPIQIVVKNGEFTKEFLSKLSER--GRQTGQ 328

Query: 229 CIFL---SDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDP 285
            +FL   S+IL   ++   +   Y  K +A I ++FE+ + LDAD  P   ++   E   
Sbjct: 329 RLFLVEYSEILEEKNVNLIR--KYFNKLIANIFNTFEEFVLLDADAVPYSPIESFMELPE 386

Query: 286 YHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYT----KNLGDLS 341
           Y +TG+ ++ D   R       D   + ++  +      + L    ++T    K  G + 
Sbjct: 387 YKNTGIYMFRD---RVVDNELDDTCLVTLEHLEPTIEEVELLGSTLLFTSEMQKTTGSVE 443

Query: 342 NVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDK 401
              +  +     + + E+G ++++K +    +++ L  + N           +A   GDK
Sbjct: 444 ESIYRKMMEDRMKENVETGLVVVNKKEKFAGLVMTLMLSFN--------HKLQACFHGDK 495

Query: 402 ETFLTAASFYGLPYYQLKSATGVEGY 427
           E +     F G  Y        + G+
Sbjct: 496 EFYWLGPLFAGQSYSIEPKGAALTGF 521

>KNAG0D03070 Chr4 (552018..553970) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 117/279 (41%), Gaps = 28/279 (10%)

Query: 172 GQGIVTV----GGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETV-FSKYN 226
           G+GI+T       G + L  L +++  +N   TLP+++ +   D  ++ + +    ++  
Sbjct: 273 GKGIITTFNPKAHGDYFLRQLKILQYQKN---TLPIQILVRDGDFSDSFVRKLADAARRT 329

Query: 227 AKCIFLSD---ILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQ 283
            + I+L +   IL   ++ +F+   Y  K  A + ++FE+ + LDAD  P   L+   E 
Sbjct: 330 NQKIYLVNYTAILDKSNMGEFK--SYINKLAANLFNTFEEFILLDADAVPYFPLESYLEL 387

Query: 284 DPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNV 343
             Y  TG+ ++ D   R       D     ++  +        L    +YT +   +   
Sbjct: 388 PDYQKTGMYMFRD---RILDHRIDDACTTTLEHLEPSMEEAVLLGTSIMYTVSSNVVPTT 444

Query: 344 PFHDL-EGSIPE---VSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEG 399
           P   +  G + E    + E+G +++ K   LP +L+AL  N++            A   G
Sbjct: 445 PEEKVYVGMVREHIRENVETGLVVVDKKNKLPGLLMALALNLSK--------KLNACMYG 496

Query: 400 DKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGV 438
           +KE +     F G+ Y        + G+      GF+ V
Sbjct: 497 EKEFYWLGPYFSGMSYSIEAKGAALTGFPEKMYDGFQYV 535

>YER001W Chr5 (153520..155808) [2289 bp, 762 aa] {ON}
           MNN1Alpha-1,3-mannosyltransferase, integral membrane
           glycoprotein of the Golgi complex, required for addition
           of alpha1,3-mannose linkages to N-linked and O-linked
           oligosaccharides, one of five S. cerevisiae proteins of
           the MNN1 family
          Length = 762

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 112/286 (39%), Gaps = 70/286 (24%)

Query: 172 GQGIV-TVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKC- 229
           G+GIV ++G  +F L A+  I +LR    TLP++V +   DE   +L + +   Y A+  
Sbjct: 317 GRGIVLSLGSNQFPL-AVKFIASLRFEGNTLPIQV-VYRGDELSQELVDKLI--YAARSP 372

Query: 230 ------------------IFLSDILPAPSLK-KFQFTGYQFKSLALIASSFEDVLFLDAD 270
                             I+  D+      K +  F  Y+ K L ++ +  ++ +FLD D
Sbjct: 373 DFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDID 432

Query: 271 NFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPP 330
               + +D+ F+   Y  TG V             FY    ++ +  +R    ++ L P 
Sbjct: 433 AISYEKIDNYFKTTEYQKTGTV-------------FYRERALRENVNERCIARYETLLPR 479

Query: 331 EVYTKNLGD-LSNVPFHDLEGSIPEVST-----------------ESGQLMISKSKH-LP 371
            + +KN  + L   P H L      ++T                 E+G   + KSKH +P
Sbjct: 480 NLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIP 539

Query: 372 TILLALYYNVNGPSWYYPMFSQRASGEGDKET----FLTAASFYGL 413
            +L A+ +     +             GDKE     FL A   Y L
Sbjct: 540 LVLAAMIHLAKNTA---------HCTHGDKENFWLGFLAAGHTYAL 576

>Smik_14.393 Chr14 (693641..695383) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 101/231 (43%), Gaps = 33/231 (14%)

Query: 190 VIKTLRNLHTTLPVEVFIPPSDEGE-------TDLCETVFSKYNAKCIFLSDI---LPAP 239
           +I+TLR L+ +LP+E+ +  SD  E           E+    Y  + ++  D+   L   
Sbjct: 215 LIRTLRLLNNSLPIEI-VHKSDLDERYQQLLIISARESASLDYPPQELWFLDVQSMLSDD 273

Query: 240 SLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWR 299
            L KF+   +  K LA+  SSF+  +FLD+D  P   +D +++ D +  TG +    F+R
Sbjct: 274 YLGKFK--RFSNKWLAITFSSFQVPIFLDSDTVPFAPVDTLYQTDEFIRTGTL----FFR 327

Query: 300 RTTQPLFYDIAGIQVDRKKRVRN-----CFDDLTPPEVYTKNLGD-LSNVPFHDLEGSIP 353
             + P    ++ +Q+   K++ N       D     E+   +L D ++      L     
Sbjct: 328 DRSFP-NSKLSLLQIKVLKQIINNSLGISLDSGQDFELLKNSLNDKIATNAIESLIFKQQ 386

Query: 354 EVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETF 404
           +   +SG L+  K KH   + +A+    +    Y+          GDKE F
Sbjct: 387 KHHMDSGLLIFDKQKHFFCLPIAIMLQFSPIQEYF---------HGDKEWF 428

>YIL014W Chr9 (326103..327995) [1893 bp, 630 aa] {ON}
           MNT3Alpha-1,3-mannosyltransferase, adds the fourth and
           fifth alpha-1,3-linked mannose residues to O-linked
           glycans during protein O-glycosylation
          Length = 630

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 108/257 (42%), Gaps = 26/257 (10%)

Query: 171 KGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSD---EGETDLCETVFSKYNA 227
           KG+G V     K   + L  +K +      LP ++    ++   E    + ET  +K   
Sbjct: 233 KGRGFVLTIAEKDVPLFLKQLKVMEFSKNELPFQIVSTGNELSAESIAKISET--AKETE 290

Query: 228 KCIFLSDI--LPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDP 285
           + ++L D   +   +      + +Q K +A + ++FE+ + LDAD  P    D+ F+   
Sbjct: 291 QRVYLVDCSTVLDTNFANTYISFFQNKWVATLFNTFEEYILLDADVVPFVGSDYFFDSPS 350

Query: 286 YHSTGLVLWPDFWRRTTQPLFYDIAGI-------QVDRKKRVRNCFDDLTPPEVYTKNLG 338
           Y  +G++L+ D      Q   Y I  +       Q  R    R  FD   P   ++    
Sbjct: 351 YRESGILLFKDRVMENEQTFQYCIEMLNEVEPSAQERRFIGSRLVFDSSLP---FSSETS 407

Query: 339 DLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGE 398
           + ++V +++    +     +SG ++++K + L  +L++   N++G         QR    
Sbjct: 408 EEASV-YYNFFKKLRLHHVDSGLVVVNKLEKLNGLLMSFMLNLDGK-------LQRCV-Y 458

Query: 399 GDKETFLTAASFYGLPY 415
           GDKE F     + G  Y
Sbjct: 459 GDKEIFWLGQLYAGQDY 475

>KLTH0F13486g Chr6 complement(1108786..1110657) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014W MNT3 Alpha-1 3-mannosyltransferase
           adds the fourth and fifth alpha-1 3-linked mannose
           residues to O-linked glycans during protein
           O-glycosylation
          Length = 623

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 62/127 (48%), Gaps = 2/127 (1%)

Query: 172 GQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDL--CETVFSKYNAKC 229
           G+G+V   G +     +  +K L +L   LP+++    ++  E  L    +   + + + 
Sbjct: 222 GRGLVFSLGERHLDPFIRHLKILDHLGNKLPIQIVQRENELSEQFLNALSSFLQRSHQRV 281

Query: 230 IFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHST 289
            +++       L   + T +  K +A I ++F +V+ +DAD  P   L+  F+ D Y+ +
Sbjct: 282 YYINCGAILEPLYGLEMTYFVNKWIASIFNTFSEVILMDADVIPFIPLEEFFDDDQYNRS 341

Query: 290 GLVLWPD 296
           G++L+ D
Sbjct: 342 GVLLYKD 348

>TPHA0L00820 Chr12 complement(162210..164402) [2193 bp, 730 aa] {ON}
           
          Length = 730

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 59/275 (21%), Positives = 116/275 (42%), Gaps = 40/275 (14%)

Query: 167 KNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGE-----TDLCETV 221
           K+  K +GI      +  +M   +I  L   + TLP+++    ++E        +L   +
Sbjct: 302 KSILKDKGISMTMRSEDLMMFKKMINVLDFQNNTLPIQIITKGNNELTKENFINELQSFL 361

Query: 222 FSKYNAKCIFLSDI--LPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDH 279
            +  + + +F+ ++  L      +     +  K +++I S+F++ +FLD D+ P   LD 
Sbjct: 362 QNNNSTQTVFIVNVETLLNKHYVENMLNFFYNKWVSIIFSTFKETIFLDVDSIPFVNLDE 421

Query: 280 IFEQD--------PYHSTGLVLWPDFWRRTTQPLFYDIAGI----------QVDRKKRVR 321
            + Q+         Y  TG++++ D          Y +  +          Q+     + 
Sbjct: 422 FYFQENNINNDYKNYKDTGMLMYKDRMLINEFTFGYCMDALKFVEPSLQESQLINSNILF 481

Query: 322 NC----FDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLAL 377
           N      DD+T  E    N  ++ N+ +++    I  + + SG ++I+K K L +++ +L
Sbjct: 482 NSTSPKIDDITSIE--NTNDREIYNI-YNNFLTKIFAIISISGLVVINKDKKLFSLIFSL 538

Query: 378 YYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYG 412
             N+NG         QR    GDKE F     F G
Sbjct: 539 MMNLNGK-------LQRCV-YGDKEFFWLGQLFAG 565

>CAGL0C04048g Chr3 complement(399734..401596) [1863 bp, 620 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 620

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 60/131 (45%), Gaps = 7/131 (5%)

Query: 171 KGQGIV-TVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETV--FSKYNA 227
           +G+GIV TV      L+     +  + L   LP++V +    E   +L + +  ++    
Sbjct: 231 RGKGIVLTVSQSDVPLLRQQ-FRVWKELGNKLPIQV-VHKGTEINAELEQKIKEYAIEME 288

Query: 228 KCIFLSDILPA--PSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDP 285
           + +++ D+ P   P   +     +  K  A I ++FE+++ +DAD  P    +   +   
Sbjct: 289 QDVYVVDLSPVIDPDFAENSIQNFHNKWYAAIFNTFEELILIDADAIPYVPAEDFLKSKS 348

Query: 286 YHSTGLVLWPD 296
           Y  TGL LW D
Sbjct: 349 YKKTGLRLWRD 359

>TPHA0F00130 Chr6 (14360..16636) [2277 bp, 758 aa] {ON} 
          Length = 758

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 77/205 (37%), Gaps = 47/205 (22%)

Query: 232 LSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGL 291
           +S++L    +KKF    ++ K LA + + FE+ +FLD D      +   FE   Y  TG 
Sbjct: 413 VSNVLDPAFMKKFD--RFKNKWLAEMLNLFEEFIFLDTDAISYIHMSEYFEFPEYKDTGT 470

Query: 292 VLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGS 351
           + + D   RT +             KK     F  L P  + T N G   N P  D    
Sbjct: 471 LFFKD---RTLEDY----------NKKSCTAAFRTLPPKMLETINFG---NFPVIDDSYV 514

Query: 352 IPEVS---------------------TESGQLMISKSKHLPTILLALYYNVNGPSWYYPM 390
             E +                      ESG ++I+KS+H+  I+++   ++ G       
Sbjct: 515 AEECNKYLTVEEKIYKHYFFDNWLHQMESGLIVINKSRHIMPIVISTMLHMTG------- 567

Query: 391 FSQRASGEGDKETFLTAASFYGLPY 415
               +   GDKE         G PY
Sbjct: 568 -QLNSCSYGDKEFLWLGFLISGTPY 591

>Smik_5.115 Chr5 (157563..159851) [2289 bp, 762 aa] {ON} YER001W
           (REAL)
          Length = 762

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 77/200 (38%), Gaps = 41/200 (20%)

Query: 246 FTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPL 305
           F  Y+ K L ++ + F++ +FLD D    + +D  F+   Y  TG V + +  R  T+ L
Sbjct: 410 FGSYKSKWLVVLFNLFQEFVFLDIDAISYQEIDKYFDTPEYQKTGTVFYRE--RALTETL 467

Query: 306 FYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVST-------- 357
                G  V R       ++ L P ++ +KN  +L  +    +     E+ T        
Sbjct: 468 ----DGRCVAR-------YETLLPRKLESKNFQNLLTIDPDTVLNKCDELLTTEEYIFKS 516

Query: 358 ----------ESGQLMISKSKH-LPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLT 406
                     E+G   I KSKH LP +L ++ +                   GDKE F  
Sbjct: 517 MFRHKGQHQLEAGLFAIDKSKHVLPLVLASMIHLARDTG---------GCTHGDKENFWL 567

Query: 407 AASFYGLPYYQLKSATGVEG 426
                G PY   +  +G  G
Sbjct: 568 GFLASGHPYALQEVYSGAIG 587

>CAGL0G04279g Chr7 complement(404144..406126) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3
          Length = 660

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 65/134 (48%), Gaps = 5/134 (3%)

Query: 167 KNSYKGQGIV-TVGGGKFSLMALLVIKTLRNLHTTLPVE-VFIPPSDEGETDLCETVFSK 224
           +N  KG+G+V T+      ++  L  K L+    TLP++ VF               +++
Sbjct: 250 RNEAKGKGLVITIESNNLHILRKL-FKFLKENGNTLPIQLVFKRNVTLARFKDAIISYAE 308

Query: 225 YNAKCIFLSDI--LPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFE 282
            + + + + +I  L   S  K  F GY  K LA I ++FEDV+ +D +  P    + + E
Sbjct: 309 ESDQHVTIIEIEALIDDSFNKGTFVGYDDKFLASIFNTFEDVVMMDIEVIPYVNPEELLE 368

Query: 283 QDPYHSTGLVLWPD 296
            + Y ++GL +W D
Sbjct: 369 NEEYKNSGLYMWRD 382

>CAGL0H09262g Chr8 complement(908258..910135) [1878 bp, 625 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3
          Length = 625

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 108/274 (39%), Gaps = 51/274 (18%)

Query: 167 KNSYKGQGIV---TVGGGKFSLMALLVIKTLRNLHTTLPVEVF-----IPPS-----DEG 213
           KN  KG+GIV   +V   +F      V K L N   T P++V      +PP       E 
Sbjct: 230 KNEAKGRGIVVTASVNDCRFLRSQFFVWKELGN---TYPIQVVTKGKEMPPELIAKIKEY 286

Query: 214 ETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFP 273
            T+  + V+       + L ++L     +K+    +  K  A + ++FE+ + +DAD   
Sbjct: 287 ATEADQEVY------IVDLQNVLDPNYAEKY-IENFHNKWYAAMFNTFEEAILVDADVVS 339

Query: 274 VKTLDHIFEQDPYHSTGLVLWPD---------FWRRTTQPLFYDIAGIQVDRKKRVRNCF 324
               D  FE   +  TGL LW D          +     P F             ++   
Sbjct: 340 YVHPDEYFESADFKKTGLKLWRDRDIPDIHVHIYCLNMAPYFLPSKEEHRTLGTTLKYRL 399

Query: 325 DDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNG- 383
           ++ +  +  T     L    F +  GSI     +SG ++ +K K L +++++ +++ +  
Sbjct: 400 EEESLKDAGTSEADGLHKF-FFEKSGSI----VDSGLVVFNKKKKLHSLIISEFFHTDAK 454

Query: 384 --PSWYYPMFSQRASGEGDKETFLTAASFYGLPY 415
             P  Y           GDKE F+  A   G+ Y
Sbjct: 455 FKPCTY-----------GDKEIFMLGAYSAGVDY 477

>Suva_14.418 Chr14 (721586..723328) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 97/237 (40%), Gaps = 39/237 (16%)

Query: 187 ALLVIKTLRNLHTTLPVEVFIPPSDEGE-------TDLCETVFSKYNAKCIFLSDILPAP 239
           ++ +I+ LR L+ +LP+E+ +  SD  E           E+    Y  + ++    L   
Sbjct: 212 SIRLIRVLRLLNNSLPIEI-VHKSDLSEYYQQLLIASARESASLDYPPQELWF---LNVK 267

Query: 240 SLKK----FQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWP 295
           SL K     +F  +  K LA+   SF+  + LD+D  P   LD  +E D +  TG + + 
Sbjct: 268 SLLKDDYAAKFKRFSNKWLAITFCSFQKPILLDSDAVPFVPLDTFYEADEFKKTGTLFFK 327

Query: 296 DFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEV 355
           D   R+       +  I V  KK + +C   L  P    K L  L N    D+     E 
Sbjct: 328 D---RSFPTSKLSLRKINV-LKKVIGDC---LGIPLDSKKGLELLKNRLNDDMAMDAVES 380

Query: 356 S--------TESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETF 404
                     ESG L++ K KH   +L+++    +    Y+          GDKE F
Sbjct: 381 LFIKHQKHYMESGLLVLDKQKHFFGLLVSIMLQFSPIREYF---------YGDKEWF 428

>CAGL0H09240g Chr8 complement(905670..907598) [1929 bp, 642 aa] {ON}
           some similarities with uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3
          Length = 642

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 50/247 (20%), Positives = 103/247 (41%), Gaps = 21/247 (8%)

Query: 172 GQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSD-EGETDLCETVFSKYNAKCI 230
           G+GIV         M    +   + L    P++V     +   + ++    F++   + I
Sbjct: 243 GRGIVLSAKPDDIDMLRQQLSVWKELGNKYPIQVVHKGGELTRDNEISLKQFAEETDQNI 302

Query: 231 FLSDILPA--PSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHS 288
           ++ D  P    +      T +  K + ++ ++FE+ + +DAD  P  + +  FE + +  
Sbjct: 303 YIVDAGPVLDKNFADEHITKFHNKWVGVLFNTFEEYIMVDADTVPFISAEDFFESENFKK 362

Query: 289 TGLVLWPD--FWRRTTQPLFYDIA-----GIQVDRKKRVRNCFDDLTPPEVYTKNLGDLS 341
           +G+ +W D     R  +    D+A      ++  R       F  L P     K   + +
Sbjct: 363 SGMRMWRDRTLTNRHIREHCPDLALKLEPSLEEHRILGTTLRFKLLDPDLKQEKTSEERA 422

Query: 342 NVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDK 401
              F+ +  ++     +SG ++I+K + L ++LL+ ++        + +F  R    GDK
Sbjct: 423 ---FNQMRTNLALHHVDSGLVVINKKEKLHSLLLSEFFQ------NHALF--RRCSYGDK 471

Query: 402 ETFLTAA 408
           E F  AA
Sbjct: 472 ELFWYAA 478

>Skud_14.395 Chr14 (704847..706589) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 104/252 (41%), Gaps = 41/252 (16%)

Query: 173 QGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETD-------LCETVFSKY 225
           +G+V           + +++ LR L+ +LP+E+ +  SD  ++          E+  S Y
Sbjct: 198 KGLVMSASDALVSDTIRLMRILRLLNNSLPIEI-VHKSDLSKSSQQLLIASARESASSNY 256

Query: 226 NAKCIFLSDILPAPSLKKFQ----FTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIF 281
             + ++  D+    SL K +    F  +  K LA+  SSF+  +FLD+D  P   LD  +
Sbjct: 257 PPQELWFLDV---KSLIKDEYLNRFKRFSNKWLAITFSSFQMPIFLDSDTVPFVPLDGFY 313

Query: 282 EQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDD-LTPPEVYTKNLGDL 340
               +  TG + + D   R+     + ++ +   + K +R   ++ L       +    L
Sbjct: 314 RTGEFERTGTLFFKD---RS-----FPLSKLSSQQTKALRQIINNSLGISSNSEQGFESL 365

Query: 341 SNVPFHDLE-GSIPEVS-------TESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFS 392
            N    D   G+I  V         +SG L+I K KH   + +A+    +    Y+    
Sbjct: 366 KNSSKDDTAIGAIDSVIFKQQKHYMDSGLLVIDKQKHFFCLPIAIMLQFSPIQEYF---- 421

Query: 393 QRASGEGDKETF 404
                 GDKE F
Sbjct: 422 -----HGDKEWF 428

>ZYRO0G04048g Chr7 complement(328792..330717) [1926 bp, 641 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014W MNT3 Alpha-1 3-mannosyltransferase adds the
           fourth and fifth alpha-1 3-linked mannose residues to
           O-linked glycans during protein O-glycosylation
          Length = 641

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 74/181 (40%), Gaps = 18/181 (9%)

Query: 252 KSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFY---D 308
           K LA + ++FE+VL LD D  P   ++  F++  Y +TG+ L+ D          Y    
Sbjct: 322 KWLAALFNTFEEVLLLDVDTVPFVDVEEFFKEPQYRATGMALFKDRAMMDEHTYGYCLET 381

Query: 309 IAGIQ---VDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMIS 365
           +AG++    + K        + T  E+       +    FHD  G +  V  +SG + ++
Sbjct: 382 LAGLEPSHEENKLMGTKLLFESTQKELPQTEAASVYRRFFHD--GVLHHV--DSGLVPVN 437

Query: 366 KSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKSATGVE 425
           K K+   +L +   N++           +    GDKE F     + G  Y       GV 
Sbjct: 438 KVKNFGGLLFSFMINLDTKI--------QGCVHGDKEFFWLGQLYAGKNYAIYPQDAGVI 489

Query: 426 G 426
           G
Sbjct: 490 G 490

>TPHA0H00240 Chr8 (40339..42828) [2490 bp, 829 aa] {ON} 
          Length = 829

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 89/213 (41%), Gaps = 39/213 (18%)

Query: 230 IFLSDILPAPSLKKF-QFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHS 288
           I+  D+ P+    K  +FT Y+ K LAL+ +  ++VLFLD D       +  FE + + +
Sbjct: 414 IWFIDLKPSIETSKVNEFTKYKNKWLALLLNPLKEVLFLDTDTVNYMDPNFYFETEQFKN 473

Query: 289 TGLVLWPDFWRRTT----------------QPLFYDIAGIQVDRKKRVRNCFD-DLTPPE 331
           TG + + D +                    Q  FY       D    ++N  + DLT  E
Sbjct: 474 TGTLFFRDRFLNIGKSEVCSQISETLSPNFQESFYFGKLPLFDNNYILKNLTETDLTTEE 533

Query: 332 VYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMF 391
           +  K+  D +N+  H+L         ESG + + K  H+  +L++   N+     Y P  
Sbjct: 534 LVFKSYFD-NNIQ-HEL---------ESGLMALDKENHIIPLLISRNLNL-----YKPF- 576

Query: 392 SQRASGEGDKETFLTAASFYGLPY--YQLKSAT 422
                  GDKE F       G P+  Y +++ T
Sbjct: 577 --AGCSHGDKEFFWLGFVASGAPFSIYPVRAGT 607

>Kpol_1057.22 s1057 complement(42104..44398) [2295 bp, 764 aa] {ON}
           complement(42104..44398) [2295 nt, 765 aa]
          Length = 764

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 80/206 (38%), Gaps = 46/206 (22%)

Query: 246 FTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPL 305
           +  Y+ K LA+  + FE+ +F+D D      +++ FE + Y  TG + + D      + L
Sbjct: 418 YKKYKNKWLAVTFNLFEEFIFMDIDAISYVDMNYYFETEEYKKTGTIFFRD------RIL 471

Query: 306 FYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLE---------GSIPEV- 355
            ++          R    FD L P     K  G   N PF D +          S+ EV 
Sbjct: 472 LFNTVD-------RCVPIFDTLQPKIKEAKYFG---NFPFIDRDYVTDECEKNLSVEEVI 521

Query: 356 -----------STESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETF 404
                        E+G L + K++H+  +++A   +++  +             GDK+ F
Sbjct: 522 FKRYFDDHYQHQMEAGLLAVDKTRHVIPMVIASMLHMSKKT--------EICNYGDKDFF 573

Query: 405 LTAASFYGLPY-YQLKSATGVEGYHR 429
                  G PY +   +A  V  Y R
Sbjct: 574 WIGFVVAGHPYSFHSVNAGTVGKYER 599

>Skud_5.100 Chr5 (150236..152524) [2289 bp, 762 aa] {ON} YER001W
           (REAL)
          Length = 762

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 109/283 (38%), Gaps = 64/283 (22%)

Query: 172 GQGIV-TVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFS------- 223
            +GIV ++G  +F L A+  I  LR    TLP+++    ++  +  + + +F+       
Sbjct: 319 NRGIVLSLGSNQFPL-AVKFIAALRFQGNTLPIQIVYRGNELSQELVDKLIFAARSPDFK 377

Query: 224 ----KYNAKC-----IFLSDILPAPSLK-KFQFTGYQFKSLALIASSFEDVLFLDADNFP 273
               KY+        I+  D+      K +  F  Y+ K L ++ + F++ +FLD D   
Sbjct: 378 PVENKYDNSTNVPQEIWFLDVSNTIHPKWQNDFDSYKSKWLVVLFNLFKEFVFLDIDAIS 437

Query: 274 VKTLDHIFEQDPYHSTGLVLWPD------------------FWRRTTQPLFYDIAGIQVD 315
            + +D  FE   Y  TG V + +                    R+     F   + + +D
Sbjct: 438 YQEIDKYFETAEYQKTGTVFYRERALKENVHERCIARYETLLPRKLESKNFK--SSLLID 495

Query: 316 RKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKH-LPTIL 374
             + +  C +DL P E   K         FH       +   E+G   I KS+H +P IL
Sbjct: 496 ADRVLSGCDNDLKPEEHIFKAF-------FHHRR----QHQLEAGLFAIDKSEHTIPLIL 544

Query: 375 LALYYNVNGPSWYYPMFSQRASGEGDKET----FLTAASFYGL 413
            ++ +     S             GDKE     FL +   Y L
Sbjct: 545 ASMIHLAKHTS---------HCTHGDKENFWLGFLASGHHYAL 578

>AAR183C Chr1 complement(672091..674037) [1947 bp, 648 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YIL014W
           (MNT3)
          Length = 648

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 60/136 (44%), Gaps = 9/136 (6%)

Query: 167 KNSYKGQGIV-TVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCET----- 220
           + S  G+GIV TV       +  L +  L  L   LP+E+    +D     +        
Sbjct: 252 RRSSSGRGIVATVADIHLDQLKRL-LHVLDELGNKLPIELVYKGNDFSRLPIKRLKRYVR 310

Query: 221 VFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHI 280
             +K   + +  S +L +  + K +   +  K LA I +SFE+++ LD D  P+  +D  
Sbjct: 311 QHTKQRVRLVDCSRVLRSTHIPKIK--RFMNKWLATIFNSFEEIILLDVDVVPLVPIDSY 368

Query: 281 FEQDPYHSTGLVLWPD 296
           F+   Y  TG + + D
Sbjct: 369 FKLPGYTKTGALFFKD 384

>TDEL0H03260 Chr8 complement(542810..544735) [1926 bp, 641 aa] {ON}
           Anc_7.123 YIL014W
          Length = 641

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 60/130 (46%), Gaps = 7/130 (5%)

Query: 172 GQGIV-TVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCE----TVFSKYN 226
           G GIV T+  G  +L+    +K   +   TLP+++    +D  +  + E       SK N
Sbjct: 251 GSGIVITLNEGSKNLL-YKQLKVFDHSDNTLPIQIITTGNDFSDGFIEELKAKVAASKQN 309

Query: 227 AKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPY 286
              +  S IL +    K        K +A+I ++FE+ + LD D  P   +D    +  Y
Sbjct: 310 VYLVDCSPILDS-EFAKEHIGDIINKWIAVIFTTFEESILLDVDAVPFVPMDDFLTEKSY 368

Query: 287 HSTGLVLWPD 296
            ++G++++ D
Sbjct: 369 KASGILMYKD 378

>Suva_5.87 Chr5 (129322..131622) [2301 bp, 766 aa] {ON} YER001W
           (REAL)
          Length = 766

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 65/144 (45%), Gaps = 27/144 (18%)

Query: 173 QGIV-TVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKC-- 229
           +GIV ++G  +FSL A+  I +LR    TLP+++ I   DE   ++ E +   Y A+   
Sbjct: 323 RGIVLSLGSNQFSL-AVKFIASLRFQGNTLPIQI-IYRGDELPQEMVEKLM--YAARSPE 378

Query: 230 -----------------IFLSDILPA--PSLKKFQFTGYQFKSLALIASSFEDVLFLDAD 270
                            ++  D+     P  K   F  Y+ K L ++ + F++ +FLD D
Sbjct: 379 FKPIENSYDNSTNVPQELWFLDVSNTVHPDWKG-DFGSYKSKWLVVLFNLFQEFVFLDID 437

Query: 271 NFPVKTLDHIFEQDPYHSTGLVLW 294
               + +D  FE   Y  TG V +
Sbjct: 438 AISYQEIDKYFESPEYQKTGTVFY 461

>KLTH0G19690g Chr7 complement(1704559..1706325) [1767 bp, 588 aa]
           {ON} weakly similar to uniprot|P53059 Saccharomyces
           cerevisiae YGL257C MNT2 Mannosyltransferase involved in
           adding the 4th and 5th mannose residues of O-linked
           glycans
          Length = 588

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 80/195 (41%), Gaps = 35/195 (17%)

Query: 246 FTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDF----WRRT 301
           F  +  K +A + +SF++++ +D+D  P    +  F+   Y  TG   + D     + +T
Sbjct: 280 FKRFSNKWIASLFNSFDEMILMDSDAVPFMNPERFFDLVGYQETGAFFFKDRLIDEYLKT 339

Query: 302 TQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQ 361
           +   FY    +  + + +V   F   +  E  T+N  D     +  L         ESG 
Sbjct: 340 SDLKFYKKL-LPTEEESKV---FGIPSSTEKTTQN--DFFKAGYKHL--------MESGV 385

Query: 362 LMISKSKHLPTIL----LALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQ 417
           ++I +S HLP +L    L L+   + P +            GDKE F    S  G   Y+
Sbjct: 386 VVIKRSDHLPGLLISTALQLWKETSEPVY------------GDKELFWLGQSISGNENYR 433

Query: 418 L-KSATGVEGYHRPD 431
             K+A G  G    D
Sbjct: 434 FNKNAAGALGILNRD 448

>Skud_9.158 Chr9 (296090..297979) [1890 bp, 629 aa] {ON} YIL014W
           (REAL)
          Length = 629

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 74/175 (42%), Gaps = 19/175 (10%)

Query: 248 GYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFY 307
            +Q K +A + ++FE+ + LDAD  P    D+ F+   Y  +G++L+ D   R      Y
Sbjct: 312 SFQNKWVASLFNTFEEYILLDADVVPFVKSDYFFDSPSYKGSGILLFKDRVMRNELTFKY 371

Query: 308 DIAGIQVDRKKRVRN-------CFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESG 360
            I  + +    R  +        FD  +     +     +    +++   ++     +SG
Sbjct: 372 CIELLGLVEPSREEHRLIGSKLVFDSSSLLSSSSSEEASV----YYNFFKNLRLHHVDSG 427

Query: 361 QLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPY 415
            ++++K + L  +L++   N++G         QR    GDKE F     + G  Y
Sbjct: 428 LVVVNKLEKLNGLLMSFMLNLDGK-------MQRCV-YGDKEIFWIGQLYAGQDY 474

>YMR264W Chr13 (795805..796416) [612 bp, 203 aa] {ON}
           CUE1Endoplasmic reticulum membrane protein that recruits
           the ubiquitin-conjugating enzyme Ubc7p to the ER where
           it functions in protein degradation; contains a CUE
           domain that binds ubiquitin to facilitate intramolecular
           monoubiquitination
          Length = 203

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 42/102 (41%), Gaps = 19/102 (18%)

Query: 414 PYYQLKSATGVEGYHRPDG---QGFRGVAMLQ--HDVTQDYMRYKTAQKAISNKYGAQAK 468
           P  Q  SATGV  + RP G      R    +   H VT   +  +T Q    N +  Q +
Sbjct: 29  PSAQRLSATGVNAHGRPQGSTQNALRRTGRVNGGHPVTTQMV--ETVQNLAPNLHPEQIR 86

Query: 469 ISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEP 510
            S +++ S+ E  + Y   DE ++P            P FEP
Sbjct: 87  YSLENTGSVEETVERYLRGDEFSFP------------PGFEP 116

>Suva_13.448 Chr13 (775127..775741) [615 bp, 204 aa] {ON} YMR264W
           (REAL)
          Length = 204

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 43/102 (42%), Gaps = 19/102 (18%)

Query: 414 PYYQLKSATGVEGYHRPDGQ---GFR--GVAMLQHDVTQDYMRYKTAQKAISNKYGAQAK 468
           P  Q  SATGV  + RP G      R  G A   H VT   +  +T Q    N +  Q +
Sbjct: 29  PSAQRLSATGVNTHGRPQGPTHGALRRAGRANAGHPVTAQMV--ETVQNLAPNLHPEQIR 86

Query: 469 ISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEP 510
            S +++ S+ E  + Y   DE ++P            P FEP
Sbjct: 87  YSLENTGSVEETVERYLHGDEFSFP------------PGFEP 116

>KLLA0D13376g Chr4 (1150858..1152849) [1992 bp, 663 aa] {ON} similar
           to uniprot|P40549 Saccharomyces cerevisiae YIL014W MNT3
           Alpha-1 3-mannosyltransferase adds the fourth and fifth
           alpha-1 3-linked mannose residues to O-linked glycans
           during protein O-glycosylation
          Length = 663

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 79/205 (38%), Gaps = 48/205 (23%)

Query: 252 KSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAG 311
           K +AL+ ++F + + LDAD+    +L+  F+   Y  TG++L+ D           +I G
Sbjct: 351 KWMALLFNTFSECILLDADSVSFASLESYFDFKGYQDTGMLLFRD----------RNIIG 400

Query: 312 IQVDRKKRVRNCFDDLT---PPEVYTKNLGDLSNVPFHDLEGSIPEVST----------- 357
                +K    C D L    P    T  +   S  P   +E     + T           
Sbjct: 401 -----EKTFIYCTDTLKKLFPSVEETHFMSHRSTFPLELVENDNINIDTLSMEEQIYYKF 455

Query: 358 ---------ESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAA 408
                    +SG +++ + K L ++L++   N++G         QR    GDKE F    
Sbjct: 456 FHNLQLHHIDSGLVVVDRVKKLSSLLISTMMNIDGK-------LQRCV-YGDKEIFWLGQ 507

Query: 409 SFYGLPYYQLKSATGVEGY--HRPD 431
              G  Y    +   + G   ++PD
Sbjct: 508 LLAGEKYSIYPTEGSIMGTVKNKPD 532

>KLTH0H07964g Chr8 complement(698453..700618) [2166 bp, 721 aa] {ON}
           weakly similar to uniprot|P39106 Saccharomyces
           cerevisiae YER001W MNN1 Alpha-1 3-mannosyltransferase
           integral membrane glycoprotein of the Golgi complex
           required for addition of alpha1 3-mannose linkages to N-
           linked and O-linked oligosaccharides one of five S.
           cerevisiae proteins of the MNN1 family
          Length = 721

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 94/240 (39%), Gaps = 49/240 (20%)

Query: 173 QGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVF---------------IPPSDEGETDL 217
           +G+V   G +   MA   I  LR +  TLP++V                I  SD+     
Sbjct: 301 RGLVLGFGDQQLEMASKFIAQLRFIGNTLPIQVVHKGDLSRESIDALLKIAQSDKLTFPK 360

Query: 218 CETVFSKYNAKCIFLSDILPA--PSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVK 275
            E   ++   + ++  D+ P   P +    F+ ++ K LA   + FE+ +F+D D     
Sbjct: 361 TEYPNAQNVKQELWFVDMGPVLDPDVLN-SFSRFKNKWLAQSFNLFEEYVFMDIDAISYV 419

Query: 276 TLDHIFEQDPYHSTGLVLWPDFWR------------RTTQPLF------YDIAGIQVDRK 317
            L++ FE   Y  TG + + D +R             T  P F      +  A + +D  
Sbjct: 420 DLNYYFETHEYRQTGTLFFRDRYRGEPISEKCPAMAETLFPSFLENFYWHHYAAVDLDYV 479

Query: 318 KRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLAL 377
           +    C   L P E   KN    +N           +   ESG +++ K+ H   ++L+L
Sbjct: 480 E--DQCDKYLRPHEKVVKNYFIDNN-----------QHQMESGLVVVHKTSHCVALMLSL 526

>TPHA0F00700 Chr6 (158182..160752) [2571 bp, 856 aa] {ON} 
          Length = 856

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 76/193 (39%), Gaps = 46/193 (23%)

Query: 245 QFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRRTTQP 304
           +F  ++ K LA   +  +++LFLD D    K  +  FE   Y ++G              
Sbjct: 434 EFITFKNKWLASTLNPCKEILFLDTDTINYKDPNFYFETKGYKNSGT------------- 480

Query: 305 LFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVS-------- 356
           LF+    ++VD+K+   +  D L+P   + ++      +P  D +  +  V+        
Sbjct: 481 LFFRDRYLKVDKKEICSSFHDTLSPS--FQESFY-FDKLPLFDKQYIVDNVAKNELTTEE 537

Query: 357 --------------TESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKE 402
                          ESG + I K+ H+  + ++  +N+  P      FS+     GDKE
Sbjct: 538 HIFKSYFHLDIQHEMESGLMAIDKATHIIPMQMSANFNLFKP------FSK--CSHGDKE 589

Query: 403 TFLTAASFYGLPY 415
            F       G P+
Sbjct: 590 FFWLGFMASGTPF 602

>Kpol_2001.8 s2001 (24348..25994) [1647 bp, 548 aa] {ON}
           (24348..25994) [1647 nt, 549 aa]
          Length = 548

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 15/117 (12%)

Query: 214 ETDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFP 273
           E DL ++ + + N++ + L   L  P L    FT ++      I   +  +++LDAD  P
Sbjct: 75  EDDLDQSHYDEINSENLKL---LQRPELS---FTFFKLNLWQQIK--YAKIIYLDADTLP 126

Query: 274 VKT-----LDHIFEQDPYHSTGL--VLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNC 323
           +K+     LD   EQ+ +   G   + WPD +      L  D+   Q  +   V NC
Sbjct: 127 LKSTFLDILDLTSEQNKHEIAGAPDIGWPDMFNSGVLSLIPDLQIYQDLKAFTVENC 183

>KAFR0B00800 Chr2 complement(152478..154505) [2028 bp, 675 aa] {ON}
           Anc_5.328 YDR307W
          Length = 675

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 75/185 (40%), Gaps = 33/185 (17%)

Query: 103 SAREYSKQCSLSGDIGFRPENYNEW-FKLTE-------RELSQCLVVSNADVAKLRQSHS 154
           S  +Y K+ S +GDI +  +N   W F +T        R L   + V N        SH 
Sbjct: 393 SEHDYDKEVSCTGDISYNGKNDEFWKFDVTTLDEKRPVRPLEDTIQVRNIGQRCTLMSHD 452

Query: 155 DYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGE 214
             +  + ++ L +     Q ++ +     +  +L  +  +RN H+  P E F  PS E E
Sbjct: 453 IKLPEVWNIDLSEVDNYLQEVICIESAVHA-RSLFQVILVRNAHSE-PYEKFFYPS-ENE 509

Query: 215 TDLCETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIA-SSFEDVLFLDADNFP 273
           +     +F +   K                     QFKS + I  S  E+V +++  N+P
Sbjct: 510 SFKFSKLFYEIVVK---------------------QFKSDSYIGKSGTEEVDYIEVGNWP 548

Query: 274 VKTLD 278
            KTLD
Sbjct: 549 FKTLD 553

>NCAS0B03920 Chr2 (699812..703438) [3627 bp, 1208 aa] {ON} Anc_8.248
           YDR104C
          Length = 1208

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 3/34 (8%)

Query: 257 IASSFE---DVLFLDADNFPVKTLDHIFEQDPYH 287
           I SSF+   D+  LD D   + +L +I+EQDPYH
Sbjct: 787 IESSFDNLGDLCQLDRDKEIIDSLPYIYEQDPYH 820

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,585,279
Number of extensions: 2997260
Number of successful extensions: 8242
Number of sequences better than 10.0: 135
Number of HSP's gapped: 8163
Number of HSP's successfully gapped: 139
Length of query: 598
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 483
Effective length of database: 40,294,809
Effective search space: 19462392747
Effective search space used: 19462392747
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)