Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D043203.189ON24324311501e-161
ZYRO0A04928g3.189ON2512545576e-71
TBLA0F007503.189ON2342265243e-66
KAFR0A012303.189ON2202444661e-57
SAKL0C10494g3.189ON2302194471e-54
KLTH0G16060g3.189ON2131974415e-54
Smik_4.2233.189ON2322184383e-53
Skud_4.2423.189ON2321674297e-52
Kwal_56.231143.189ON2102214242e-51
YDL010W (GRX6)3.189ON2311644253e-51
Suva_4.2383.189ON2331614211e-50
YBR014C (GRX7)3.189ON2031453702e-43
KNAG0J012603.189ON1941153684e-43
NDAI0G018003.189ON2222443695e-43
AER017C3.189ON2161183678e-43
Smik_2.1333.189ON2041163642e-42
Kpol_1045.693.189ON2621843682e-42
NCAS0E016003.189ON2291213541e-40
Ecym_53133.189ON2481153542e-40
Suva_2.1413.189ON2041163442e-39
Skud_2.1263.189ON2041113414e-39
KLLA0E17733g3.189ON2111863391e-38
CAGL0I04554g3.189ON2261363235e-36
TPHA0H006303.189ON1911173041e-33
CAGL0M02167g8.679ON2331742208e-21
KAFR0A038708.679ON2671232192e-20
SAKL0H06468g8.679ON2581622147e-20
NCAS0C013408.679ON3571652072e-18
Kwal_26.88148.679ON2751981982e-17
KLTH0D11308g8.679ON2711691964e-17
Kpol_1072.148.679ON2501281936e-17
KLLA0D05973g8.679ON2811381912e-16
KNAG0G025808.679ON2781721876e-16
NDAI0K013508.679ON2711741805e-15
TPHA0B03560singletonON106881681e-14
Ecym_23948.679ON2811461762e-14
YPL156C (PRM4)8.679ON2841481762e-14
NCAS0B016408.679ON2401091708e-14
NDAI0E011508.679ON2361281682e-13
Skud_16.1268.679ON2871331692e-13
ACR146W8.679ON2131341645e-13
Kpol_2002.361.38ON109931532e-12
AFR710W1.38ON111831506e-12
Suva_16.1548.679ON2831341586e-12
Suva_2.6931.38ON143921526e-12
TPHA0G015908.679ON2971311552e-11
Smik_6.3538.679ON2861321524e-11
CAGL0K05813g1.38ON1421211464e-11
Suva_3.1781.38ON3161031517e-11
Skud_4.7881.38ON145921449e-11
YDR513W (GRX2)1.38ON143921449e-11
TPHA0E037301.38ON106831392e-10
Smik_4.7941.38ON143861412e-10
TBLA0A050801.38ON118871383e-10
Kpol_2000.991.38ON1411061403e-10
KNAG0C004501.38ON157881404e-10
KAFR0D003601.38ON109821374e-10
TBLA0B038208.679ON2511011444e-10
Ecym_10441.38ON158851404e-10
KLLA0C01298g1.38ON107841356e-10
Kwal_33.131661.38ON138821378e-10
NCAS0B088701.38ON109821331e-09
NDAI0F044301.38ON136821306e-09
KLTH0F01276g1.38ON138881272e-08
Smik_3.421.38ON110741233e-08
YCL035C (GRX1)1.38ON110741224e-08
NDAI0A003801.38ON109821191e-07
Skud_3.271.38ON110741191e-07
NCAS0A003601.38ON138861183e-07
ZYRO0F17732g1.38ON139881183e-07
SAKL0C01320g1.38ON165841168e-07
TDEL0C066401.38ON143861141e-06
TPHA0B048201.38ON138811095e-06
TDEL0E05740singletonON10881989e-05
KNAG0F002501.38ON142821009e-05
NCAS0B048908.240ON274120790.11
NCAS0B080801.216ON410895770.31
TPHA0B033408.240ON249160740.43
Suva_10.4674.211ON10997700.62
KNAG0J017308.679ON196117720.71
KAFR0B026008.240ON25997730.72
NDAI0E028908.519ON155101710.73
SAKL0H04136g4.211ON11095690.74
Suva_5.3088.240ON244128720.78
Ecym_11878.519ON139101700.83
Skud_5.3138.240ON244112720.83
TBLA0H035008.519ON149111691.3
KAFR0A023608.240ON23690701.4
YER174C (GRX4)8.240ON24480701.7
Skud_4.3568.240ON26284691.8
NCAS0B022908.519ON13941671.9
YLR364W (GRX8)4.211ON10994661.9
KLLA0C17842g8.240ON26480692.1
Smik_5.3468.240ON24480692.2
Suva_2.2578.240ON25284682.4
Kpol_1046.138.240ON24680682.6
Smik_4.3398.240ON26584682.7
YDR098C (GRX3)8.240ON28584682.8
TBLA0A082304.211ON10844652.9
ZYRO0C13860g5.321ON27280673.6
NCAS0C022408.519ON16145654.5
NDAI0J015108.240ON24584664.5
TBLA0F038608.240ON24980665.1
CAGL0G08151g8.240ON26084647.5
KNAG0A020908.519ON14945638.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D04320
         (243 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON...   447   e-161
ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {O...   219   6e-71
TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.18...   206   3e-66
KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.18...   184   1e-57
SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar...   176   1e-54
KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} simil...   174   5e-54
Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W (...   173   3e-53
Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W (...   169   7e-52
Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {O...   167   2e-51
YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-gol...   168   3e-51
Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W (...   166   1e-50
YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}  G...   147   2e-43
KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {O...   146   4e-43
NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON...   146   5e-43
AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON} Sy...   145   8e-43
Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}...   144   2e-42
Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {...   146   2e-42
NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON...   140   1e-40
Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON} ...   140   2e-40
Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}...   137   2e-39
Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}...   135   4e-39
KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa] ...   135   1e-38
CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some si...   129   5e-36
TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.18...   121   1e-33
CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {...    89   8e-21
KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.67...    89   2e-20
SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {O...    87   7e-20
NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {O...    84   2e-18
Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C ...    81   2e-17
KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some si...    80   4e-17
Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON...    79   6e-17
KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some si...    78   2e-16
KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.67...    77   6e-16
NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {O...    74   5e-15
TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON}      69   1e-14
Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON} ...    72   2e-14
YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}  ...    72   2e-14
NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679      70   8e-14
NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON...    69   2e-13
Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {O...    70   2e-13
ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic hom...    68   5e-13
Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON...    64   2e-12
AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic h...    62   6e-12
Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {O...    65   6e-12
Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W...    63   6e-12
TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON...    64   2e-11
Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C (...    63   4e-11
CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly...    61   4e-11
Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}...    63   7e-11
Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W...    60   9e-11
YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}  GRX2Cytop...    60   9e-11
TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38...    58   2e-10
Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W...    59   2e-10
TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {...    58   3e-10
Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON} (21954...    59   3e-10
KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON} ...    59   4e-10
KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON} ...    57   4e-10
TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON...    60   4e-10
Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON} si...    59   4e-10
KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {O...    57   6e-10
Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {O...    57   8e-10
NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1....    56   1e-09
NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {...    55   6e-09
KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {O...    54   2e-08
Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON} YC...    52   3e-08
YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}  GRX...    52   4e-08
NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON} ...    50   1e-07
Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON} YC...    50   1e-07
NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON} ...    50   3e-07
ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} simil...    50   3e-07
SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {O...    49   8e-07
TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1....    49   1e-06
TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1....    47   5e-06
TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {...    42   9e-05
KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON} ...    43   9e-05
NCAS0B04890 Chr2 complement(897400..898224) [825 bp, 274 aa] {ON}      35   0.11 
NCAS0B08080 Chr2 complement(1532527..1544853) [12327 bp, 4108 aa...    34   0.31 
TPHA0B03340 Chr2 (770614..771363) [750 bp, 249 aa] {ON} Anc_8.24...    33   0.43 
Suva_10.467 Chr10 (813773..814102) [330 bp, 109 aa] {ON} YLR364W...    32   0.62 
KNAG0J01730 Chr10 (316411..317001) [591 bp, 196 aa] {ON} Anc_8.6...    32   0.71 
KAFR0B02600 Chr2 complement(522861..523640) [780 bp, 259 aa] {ON...    33   0.72 
NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519      32   0.73 
SAKL0H04136g Chr8 complement(386608..386940) [333 bp, 110 aa] {O...    31   0.74 
Suva_5.308 Chr5 complement(506262..506996) [735 bp, 244 aa] {ON}...    32   0.78 
Ecym_1187 Chr1 (384530..384949) [420 bp, 139 aa] {ON} similar to...    32   0.83 
Skud_5.313 Chr5 complement(523537..524271) [735 bp, 244 aa] {ON}...    32   0.83 
TBLA0H03500 Chr8 complement(857008..857457) [450 bp, 149 aa] {ON...    31   1.3  
KAFR0A02360 Chr1 (488402..489112) [711 bp, 236 aa] {ON} Anc_8.24...    32   1.4  
YER174C Chr5 complement(538434..539168) [735 bp, 244 aa] {ON}  G...    32   1.7  
Skud_4.356 Chr4 complement(621126..621881,621915..621947) [789 b...    31   1.8  
NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519      30   1.9  
YLR364W Chr12 (854062..854391) [330 bp, 109 aa] {ON}  GRX8Glutar...    30   1.9  
KLLA0C17842g Chr3 complement(1588951..1589745) [795 bp, 264 aa] ...    31   2.1  
Smik_5.346 Chr5 complement(538041..538775) [735 bp, 244 aa] {ON}...    31   2.2  
Suva_2.257 Chr2 complement(443608..444366) [759 bp, 252 aa] {ON}...    31   2.4  
Kpol_1046.13 s1046 complement(27947..28687) [741 bp, 246 aa] {ON...    31   2.6  
Smik_4.339 Chr4 complement(610713..611480,611484..611513) [798 b...    31   2.7  
YDR098C Chr4 complement(644178..645035) [858 bp, 285 aa] {ON}  G...    31   2.8  
TBLA0A08230 Chr1 complement(2028254..2028580) [327 bp, 108 aa] {...    30   2.9  
ZYRO0C13860g Chr3 complement(1092005..1092823) [819 bp, 272 aa] ...    30   3.6  
NCAS0C02240 Chr3 (417174..417659) [486 bp, 161 aa] {ON} Anc_8.519      30   4.5  
NDAI0J01510 Chr10 (348743..349480) [738 bp, 245 aa] {ON} Anc_8.240     30   4.5  
TBLA0F03860 Chr6 complement(955792..956541) [750 bp, 249 aa] {ON...    30   5.1  
CAGL0G08151g Chr7 complement(775053..775835) [783 bp, 260 aa] {O...    29   7.5  
KNAG0A02090 Chr1 (175247..175696) [450 bp, 149 aa] {ON} Anc_8.51...    29   8.2  

>TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON}
           Anc_3.189 YDL010W
          Length = 243

 Score =  447 bits (1150), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 225/243 (92%), Positives = 225/243 (92%)

Query: 1   MSVSLKKRNXXXXXXXXXXXXXXXXXXQNANSISFGEEELKAATFVNPVASGLTSAGTAV 60
           MSVSLKKRN                  QNANSISFGEEELKAATFVNPVASGLTSAGTAV
Sbjct: 1   MSVSLKKRNLRVLSVTALLLLLVFFVVQNANSISFGEEELKAATFVNPVASGLTSAGTAV 60

Query: 61  HNNDEIVVDKESGKKGKDQESALVDAEIDKIKQEVNSGSGASKDNSISQKAGSGSKDGTV 120
           HNNDEIVVDKESGKKGKDQESALVDAEIDKIKQEVNSGSGASKDNSISQKAGSGSKDGTV
Sbjct: 61  HNNDEIVVDKESGKKGKDQESALVDAEIDKIKQEVNSGSGASKDNSISQKAGSGSKDGTV 120

Query: 121 SEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGV 180
           SEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGV
Sbjct: 121 SEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGV 180

Query: 181 ALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKP 240
           ALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKP
Sbjct: 181 ALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKP 240

Query: 241 SNN 243
           SNN
Sbjct: 241 SNN 243

>ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {ON}
           weakly similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 251

 Score =  219 bits (557), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 121/254 (47%), Positives = 160/254 (62%), Gaps = 14/254 (5%)

Query: 1   MSVSLKKRNXXXXXXXXXXXXXXXXXXQNANSISFGEEELKAATFVNPVASGLTSAGTAV 60
           M V+L KRN                  QNANS+S GE    A    N   + LTSAGT++
Sbjct: 1   MGVTLNKRNLRVLSITSLLLLLVFFVVQNANSVSIGESSSLANANSNEDQT-LTSAGTSI 59

Query: 61  H--NNDEIVVDKESGKKGKDQESALVDAEIDKIKQEVNSGSGASKD---------NSISQ 109
           +  + +E+V +K+  K+ + +  ++VDAEI KIKQEV  G G + D         +    
Sbjct: 60  NKESKEEVVTEKQKAKEKQPEGDSVVDAEIGKIKQEV--GIGKTDDLETGSSGSISGGGV 117

Query: 110 KAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYV 169
               GS      + EFDP KEY+MIL  SP+IVFSKS CPYS +LKELL KEY+ TPSY 
Sbjct: 118 VGKGGSASEHAQQTEFDPVKEYAMILDFSPIIVFSKSTCPYSKKLKELLDKEYSFTPSYF 177

Query: 170 VIELDKHKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGD 229
           VIELD+H +G  LQK++E+KTGR+TVPN++INGKSRGG D+ ++LH++G+LL S   W  
Sbjct: 178 VIELDRHHNGAELQKYVEQKTGRSTVPNVIINGKSRGGNDEFRSLHNEGKLLSSFKDWSQ 237

Query: 230 GDFTVKQLEKPSNN 243
           G FTV QL++PSNN
Sbjct: 238 GTFTVLQLDRPSNN 251

>TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.189
           YDL010W
          Length = 234

 Score =  206 bits (524), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 112/226 (49%), Positives = 149/226 (65%), Gaps = 15/226 (6%)

Query: 28  QNANSISFGEEELKAATFVNPVASGLTSAGTAVHNNDEIVVDK------ESGKKGKDQES 81
           QNANSISF  + +   + V+   +  T   +    N+ I  DK      +S +KG D   
Sbjct: 14  QNANSISFNADSI-TNSLVSSTGNSNTHPDSNALKNNNIKDDKTRKISDKSSEKGND--- 69

Query: 82  ALVDAEIDKIKQEVNSGSGASKDNSISQKAGSGSKDGTVSE----GEFDPAKEYSMILGI 137
           A VDA+ DKIKQEV   +G +    +    G+ + D  +S     G FD AKEY+MIL +
Sbjct: 70  AGVDAQFDKIKQEVGLDTGKTTQGGLPSSIGTAT-DNKISNNDENGTFDAAKEYAMILDL 128

Query: 138 SPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPN 197
           SPVI+FSKS+CP+SS LK+LL+KE++ TP+Y VIELD+H HG  LQ +I KKT R+TVPN
Sbjct: 129 SPVIIFSKSYCPFSSNLKQLLSKEFSFTPNYYVIELDRHSHGAELQAYIAKKTDRSTVPN 188

Query: 198 LMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSNN 243
           +++NG SRGG D+I AL+ +G+LLE+LN W D  FTVKQ EKPSNN
Sbjct: 189 MIVNGISRGGRDEIVALNDEGKLLEALNDWSDNTFTVKQAEKPSNN 234

>KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.189
           YDL010W
          Length = 220

 Score =  184 bits (466), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 147/244 (60%), Gaps = 25/244 (10%)

Query: 1   MSVSLKKRNXXXXXXXXXXXXXXXXXXQNANSISFGEEELKAATFVNPVASGLTSAGTAV 60
           M+V L KRN                  ++ANSI+  +           +++  T A T +
Sbjct: 1   MAVILNKRNIRIVSVTSILLLLVFFVIRDANSITLSQS----------ISNSETVAKTDL 50

Query: 61  HNNDEIVVDKESGKKGKDQESALVDAEIDKIKQEVNSGSGASKDNSI-SQKAGSGSKDGT 119
                   D  S    K  +++    EID+IKQE+    G + D+ + +  A   +++ T
Sbjct: 51  --------DGASASNKKKTDNSEATEEIDRIKQEI----GITDDSPVPATNANEQNEENT 98

Query: 120 VSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHG 179
                F+ AKEY+ IL +SP++VFSKSFCP+S++LKEL   EY  TP++ ++ELDKH+HG
Sbjct: 99  AVT--FNAAKEYASILELSPMVVFSKSFCPFSAKLKELFANEYQFTPNFYIVELDKHQHG 156

Query: 180 VALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEK 239
             LQ +I++KTGR TVPN++ING SRGG DD++ALH+ G+LL+SL  WG G+F VKQ+EK
Sbjct: 157 DLLQAYIKEKTGRGTVPNVVINGVSRGGSDDLRALHADGKLLDSLKTWGSGNFQVKQIEK 216

Query: 240 PSNN 243
           PSNN
Sbjct: 217 PSNN 220

>SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar to
           Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 230

 Score =  176 bits (447), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/219 (45%), Positives = 142/219 (64%), Gaps = 16/219 (7%)

Query: 28  QNANSISFGEEELKAATFVNPVASGLTSAGTAVHNNDEIVVDKESGKKGKDQESALVDAE 87
           QNAN+++   +    A  V P +  + S G    +  E+ V K+     +++E + V+AE
Sbjct: 25  QNANTVAVANKNSGRANGVPPSSKLIHSDG----DEQEVAVQKQ-----QEKEDSAVNAE 75

Query: 88  IDKIKQEVNSGSGASKDNSISQKAG---SGSKDGTVSEGEFDPAKEYSMILGISPVIVFS 144
           I +I+QE+          S S + G   S +KD   S  EF+ AKEY+ IL  SP++VFS
Sbjct: 76  IAQIQQEI--AGNQGGGGSNSGRTGNKVSAAKDS--SSVEFNAAKEYASILEESPMVVFS 131

Query: 145 KSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGKS 204
           KS+CP+S++LK+LL +EY  TPSYVV+ELDKH+HG  LQK+I   TGR+TVPN++IN  S
Sbjct: 132 KSYCPFSTKLKDLLAQEYQFTPSYVVLELDKHEHGAELQKYIGDVTGRSTVPNVVINRVS 191

Query: 205 RGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSNN 243
           RGG DD++ALH  G+LL+SL +WG    TV + +KPSNN
Sbjct: 192 RGGSDDLRALHKDGKLLDSLKEWGGKQLTVSKNQKPSNN 230

>KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} similar
           to Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 213

 Score =  174 bits (441), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 119/197 (60%), Gaps = 18/197 (9%)

Query: 47  NPVASGLTSAGTAVHNNDEIVVDKESGKKGKDQESALVDAEIDKIKQEVNSGSGASKDNS 106
           N   SG T++G  +H+            KG  + S  VD  +DK  QE+ +  G   D+ 
Sbjct: 35  NSSLSGQTASGAVIHS------------KGNHKSSGEVDPSVDKEIQEIKNEVGIKGDD- 81

Query: 107 ISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITP 166
                G+ S      E EFDPAKEY  IL   P+IVFSKS CP+S +LK+LL KE+  +P
Sbjct: 82  -----GASSGTDFTQEKEFDPAKEYQYILANRPMIVFSKSRCPFSKKLKDLLAKEFEFSP 136

Query: 167 SYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNK 226
           SY+V+ELDKH+HG  LQK I   TGR+TVPN++ING SRGG DD + L  KGELL SL  
Sbjct: 137 SYMVVELDKHEHGAELQKHIGSLTGRSTVPNVIINGVSRGGCDDFEKLQEKGELLSSLKT 196

Query: 227 WGDGDFTVKQLEKPSNN 243
           W D   TV + EKPSNN
Sbjct: 197 WCDKALTVSKKEKPSNN 213

>Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  173 bits (438), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 139/218 (63%), Gaps = 14/218 (6%)

Query: 28  QNANSISFGEEELKAATFVNPVASGLTSAGTAVHNNDEIVVDKESGKKGKDQESALVDAE 87
           QNAN ++   +E +++   +   + L +  T  +    + V   +  KG    S+ VD E
Sbjct: 27  QNANFLTLETKERESSELFDSEMNNLAAESTRKY----VAVPTSATNKG----SSEVDEE 78

Query: 88  IDKIKQEVN-SGSGASKDNSISQ-KAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVFSK 145
           I++IKQ+V       S D+S+S  K+   S  G +    F+  KEYS++L +SPVI+FSK
Sbjct: 79  INEIKQKVGLQRPILSDDDSLSAIKSDKQSGTGKL----FNVQKEYSLMLDLSPVIIFSK 134

Query: 146 SFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGKSR 205
           S C YS  +KELL  EY   P+Y +IELDKH HG  LQ++I+ KTGR TVPNL++NG SR
Sbjct: 135 SSCSYSKGMKELLENEYQFVPNYYIIELDKHGHGEELQEYIKLKTGRGTVPNLLVNGISR 194

Query: 206 GGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSNN 243
           GG ++I+ LHS+G+LLESL  W DG F+V+Q EKPSNN
Sbjct: 195 GGNEEIRKLHSQGKLLESLQSWSDGKFSVEQHEKPSNN 232

>Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  169 bits (429), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 115/167 (68%), Gaps = 10/167 (5%)

Query: 81  SALVDAEIDKIKQEVNSGSG-ASKDNSIS---QKAGSGSKDGTVSEGEFDPAKEYSMILG 136
           S+ VD EI++IKQ+V      AS D+S+S      GSG+  G      F+  KEYS++L 
Sbjct: 72  SSEVDEEINEIKQKVGLQQPIASADDSLSALKSDKGSGTGKG------FNVQKEYSLMLD 125

Query: 137 ISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVP 196
           +SPVI+FSKS CPYS  +KELL  EY   P+Y +IELDKH HG  LQ++I   TGR  VP
Sbjct: 126 LSPVIIFSKSVCPYSRNMKELLENEYQFLPNYYIIELDKHGHGEELQEYIRLMTGRGAVP 185

Query: 197 NLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSNN 243
           NL+ING SRGG ++I+ LHS+G+LL SL  W +G F+V+Q EKPSNN
Sbjct: 186 NLLINGISRGGNEEIRGLHSQGKLLGSLQAWSNGKFSVEQREKPSNN 232

>Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {ON}
           YBR014C - Hypothetical ORF [contig 183] FULL
          Length = 210

 Score =  167 bits (424), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 95/221 (42%), Positives = 131/221 (59%), Gaps = 20/221 (9%)

Query: 28  QNANSISFGEEELKAATFVNPVASGLTSAGTAVHNNDEIVVDKESGKKGKDQESALVDAE 87
           +N    SF    +    F+   A   +  G A++   E ++    G   K +E+  +D +
Sbjct: 5   RNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIG--DGVVAKAKETTKIDED 62

Query: 88  IDK----IKQEVNSGSGASKDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVF 143
           +D+    I++EV    G+S  +  ++KA             FDPA EY  IL  SP+IVF
Sbjct: 63  VDQAIRNIQEEVGIKEGSSGKSEPTRKA-------------FDPAMEYQQILSNSPMIVF 109

Query: 144 SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGK 203
           SKS CPYS+++KELL +EY  TP Y+V+ELD+H HG  LQ +I K T RATVPN++I+G 
Sbjct: 110 SKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGV 169

Query: 204 SRGGFDDIKALHSKGELLESLNKWGDG-DFTVKQLEKPSNN 243
           SRGG+DD KAL  KG+LLESL  W DG   +V + EKPSNN
Sbjct: 170 SRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210

>YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-golgi
           localized monothiol glutaredoxin that binds an
           iron-sulfur cluster; more similar in activity to dithiol
           than other monothiol glutaredoxins; involved in the
           oxidative stress response; functional overlap with GRX7
          Length = 231

 Score =  168 bits (425), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 88/164 (53%), Positives = 117/164 (71%), Gaps = 4/164 (2%)

Query: 81  SALVDAEIDKIKQEVNSGSG-ASKDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISP 139
           S+ VD EI++IKQ+V      AS D+S+S  A    K   +++  F+  KEYS+IL +SP
Sbjct: 71  SSEVDEEINEIKQKVGLQQPIASVDDSLS--AIKNDKGSRITKA-FNVQKEYSLILDLSP 127

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLM 199
           +I+FSKS C YS  +KELL  EY   P+Y +IELDKH HG  LQ++I+  TGR TVPNL+
Sbjct: 128 IIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNLL 187

Query: 200 INGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSNN 243
           +NG SRGG ++IK LH++G+LLESL  W DG F+V+Q EKPSNN
Sbjct: 188 VNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231

>Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W
           (REAL)
          Length = 233

 Score =  166 bits (421), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 113/161 (70%), Gaps = 4/161 (2%)

Query: 84  VDAEIDKIKQEVNSGSG-ASKDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIV 142
           VD EI++IKQ+V      AS D+S+S      S  GT +   F+  +EYS++L ++PVI+
Sbjct: 76  VDEEINEIKQKVGLQQPIASADDSLS---AIKSDKGTGTGKGFNVQQEYSLMLDLAPVII 132

Query: 143 FSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMING 202
           FSKS C YS  LKELL  EY   P+Y +IELDKH HG  L+++I+  TGR TVPNL+ING
Sbjct: 133 FSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGRGTVPNLLING 192

Query: 203 KSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSNN 243
            SRGG ++IK LHS+G+LL SL +W  G FTV+Q EKPSNN
Sbjct: 193 VSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233

>YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}
           GRX7Cis-golgi localized monothiol glutaredoxin; more
           similar in activity to dithiol than other monothiol
           glutaredoxins; involved in the oxidative stress
           response; does not bind metal ions; functional overlap
           with GRX6
          Length = 203

 Score =  147 bits (370), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 91/145 (62%), Gaps = 5/145 (3%)

Query: 96  NSGSGASKDNSISQKAGSGSK-----DGTVSEGEFDPAKEYSMILGISPVIVFSKSFCPY 150
           NSG+      S+     +  K     D    + EFD A EY+ I+  SP+IVFSK+ CPY
Sbjct: 51  NSGNAPGTHQSVHDTVNTQDKEAEEVDKNSGDAEFDAAAEYNKIMEQSPMIVFSKTGCPY 110

Query: 151 SSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDD 210
           S +LK LLT  YT +PSY V+ELD+H+H   LQ  IEK TGR TVPN++I G SRGG+ +
Sbjct: 111 SKKLKALLTNSYTFSPSYYVVELDRHEHTKELQDQIEKVTGRRTVPNVIIGGTSRGGYTE 170

Query: 211 IKALHSKGELLESLNKWGDGDFTVK 235
           I  LH   ELL+S  KW DG FTVK
Sbjct: 171 IAELHKNDELLDSFKKWSDGAFTVK 195

>KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {ON}
           Anc_3.189 YDL010W
          Length = 194

 Score =  146 bits (368), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 65/115 (56%), Positives = 85/115 (73%)

Query: 123 GEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVAL 182
           G F PA EY  IL  SPV++FSKS+CPYS++LK+LL   +  TP+Y V+ELD+H+HG  L
Sbjct: 80  GVFSPAVEYDSILSRSPVVIFSKSYCPYSAKLKKLLAAGFKFTPAYTVVELDEHEHGPEL 139

Query: 183 QKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQL 237
           QK+I +KTGR+TVPNL++NG S GG DDI AL   G+LL+ LN+WG     V Q+
Sbjct: 140 QKYIAEKTGRSTVPNLIVNGVSHGGCDDIVALSENGKLLDRLNEWGGSAVNVIQV 194

>NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON}
           Anc_3.189
          Length = 222

 Score =  146 bits (369), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 90/244 (36%), Positives = 128/244 (52%), Gaps = 30/244 (12%)

Query: 1   MSVSLKKRNXXXXXXXXXXXXXXXXXXQNANSISFGEEELKAATFVNPVASGLTSAGTAV 60
           M+V L KRN                  QNAN+ ++   +   +T  +      T++    
Sbjct: 1   MAVVLNKRNIRVLITTCVLIVIGVFVFQNANASTYTSSKALKSTITD------TNSIVQA 54

Query: 61  HNNDEIVVDKESGKKGKDQESALVDAEIDKIKQEVNS--GSGASKDNSISQKAGSGSKDG 118
           H  DE +              AL + +   +  E+ S   S  + D+SI Q         
Sbjct: 55  HGEDENI-------------PALKNVDNSPVSTEITSEEDSKINADSSIVQAEA------ 95

Query: 119 TVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKH 178
              E  FD AKEY+ IL   P+++FSK+FCPYS  LKELL+  + I P  +VIELDKH+H
Sbjct: 96  ---EVPFDVAKEYTSILQRGPMVIFSKTFCPYSKALKELLSTNFQINPQPIVIELDKHEH 152

Query: 179 GVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLE 238
           G  LQ +I+++TGR TVPNL+ING S+GG DD+K L  +  LL+SLN+W +G + V+  E
Sbjct: 153 GEELQAYIKEQTGRGTVPNLIINGNSKGGSDDMKKLFDENVLLDSLNEWSNGAYEVQATE 212

Query: 239 KPSN 242
             SN
Sbjct: 213 TASN 216

>AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL010W and
           YBR014C
          Length = 216

 Score =  145 bits (367), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 68/118 (57%), Positives = 82/118 (69%)

Query: 125 FDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQK 184
           FD AK Y+ IL +S ++VFSKS CP SS LK+LL   Y   P Y V+ELDKH +G  LQK
Sbjct: 98  FDAAKTYNEILSLSSMVVFSKSTCPLSSGLKQLLNNNYEFLPDYQVVELDKHANGAELQK 157

Query: 185 FIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSN 242
           ++ K T R+TVPNL+ING SRGG D I  LH  GELLESL KW +G   V Q ++PSN
Sbjct: 158 YVTKTTARSTVPNLVINGVSRGGHDSIMELHKTGELLESLRKWANGKHAVTQKQRPSN 215

>Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  144 bits (364), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 66/116 (56%), Positives = 83/116 (71%)

Query: 122 EGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVA 181
           E +FD A EY  IL  SP+IVFSKSFCP+S +LK LL + YT +PSY V+ELDK +H   
Sbjct: 83  EAQFDAAAEYDKILKKSPMIVFSKSFCPFSKKLKTLLAESYTFSPSYYVVELDKREHTSE 142

Query: 182 LQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQL 237
           LQ+ IEK TGR TVPN++I+G SRGG D+I ALH   +LL S  +W  G FTV+ +
Sbjct: 143 LQEHIEKSTGRRTVPNVVIDGISRGGCDEITALHENDKLLNSFKEWSSGKFTVEAI 198

>Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {ON}
           complement(161503..162291) [789 nt, 263 aa]
          Length = 262

 Score =  146 bits (368), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 109/184 (59%), Gaps = 29/184 (15%)

Query: 84  VDAEIDKIKQEV-------------------------NSGSGASKDNSISQKAGSGSKDG 118
           V+AEIDKIK+EV                              ++  N+ +Q+A  G  + 
Sbjct: 82  VNAEIDKIKEEVGLPFNDNNNNNIANKKLTTDNNKNNVVNEKSTVQNNAAQRAVQGGSEP 141

Query: 119 TVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKH 178
                +FDPA+EY++I  +SP+I+++K+FCPY  RL +LL + Y+  P +  ++LDKH H
Sbjct: 142 V----KFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTH 197

Query: 179 GVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLE 238
           G  LQ+F+ K+TG  TVPN +INGKS GG+DDI  LH  G+L+E++ +  D    VK +E
Sbjct: 198 GDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMSDYSVVVKAIE 257

Query: 239 KPSN 242
           KPSN
Sbjct: 258 KPSN 261

>NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON}
           Anc_3.189
          Length = 229

 Score =  140 bits (354), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 86/121 (71%)

Query: 116 KDGTVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDK 175
           KD + +  +FD AKEY+ IL   P+++FSKS CPYSS+LK+LL   +  +P  V++ELDK
Sbjct: 101 KDASTTAPDFDVAKEYAAILAKGPMVIFSKSTCPYSSKLKKLLRTNFQFSPEPVIVELDK 160

Query: 176 HKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVK 235
           H+HG  LQ +I+++TGR TVPNL++ G SRGG DDI+ L  +G LL+ L  WG GD  V 
Sbjct: 161 HEHGDVLQGYIKEETGRGTVPNLIVGGLSRGGSDDIQKLFDEGTLLKELKTWGFGDLEVT 220

Query: 236 Q 236
           Q
Sbjct: 221 Q 221

>Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AER017C
          Length = 248

 Score =  140 bits (354), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 65/115 (56%), Positives = 82/115 (71%)

Query: 125 FDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQK 184
           ++PA  Y  IL ++PVI+FSK+ CPYS +LK LLT+ Y  TP YVVIELD  K    LQ 
Sbjct: 132 YNPADRYQKILDMAPVIIFSKTTCPYSLKLKSLLTQNYQFTPDYVVIELDLEKRTKELQF 191

Query: 185 FIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEK 239
           +I ++TGR TVPNL++NGKS GG D+I ALHSKGELL+S+  W D   TV   +K
Sbjct: 192 YISQQTGRKTVPNLLVNGKSMGGHDEISALHSKGELLKSIEDWSDKKVTVTPKQK 246

>Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  137 bits (344), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 84/116 (72%)

Query: 122 EGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVA 181
           E +FD A EY  IL  S ++VFSKS+CP+S +LK LL + Y  +PSY V+ELD+H H   
Sbjct: 83  EVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDE 142

Query: 182 LQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQL 237
           LQ +IEK TGR TVPN++ING S+GG DD+  LH + +LLESL +W +G FTV+ +
Sbjct: 143 LQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVEAV 198

>Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  135 bits (341), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 79/111 (71%)

Query: 125 FDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQK 184
           FD A EY  IL  SP +VFSK+ CPYS +LK LL + Y ITPSY V+ELD+H+HG  L+ 
Sbjct: 86  FDAAAEYGKILEYSPFVVFSKTGCPYSKKLKSLLAESYAITPSYYVVELDEHEHGKELKD 145

Query: 185 FIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVK 235
           +I  KTGR+TVPN++ING SRGG+ ++ ALH    L++S  +W    FTVK
Sbjct: 146 YIGDKTGRSTVPNVVINGISRGGYTEMAALHENDTLVDSFKEWSSDKFTVK 196

>KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa]
           {ON} similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 211

 Score =  135 bits (339), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 113/186 (60%), Gaps = 14/186 (7%)

Query: 61  HNNDEIV---VDKESGKKGKDQESALVDAEIDKIKQEV----NSGSGASKDNSISQKAG- 112
           HN + +    V KES     D   A V+++I+ I++ +    ++   A   N++   AG 
Sbjct: 25  HNAESVTRSYVGKESSNLAND---AKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGP 81

Query: 113 SGSKDGT-VSEGE-FDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVV 170
           +G KD    +E E ++   EY  IL  SP++VFSKS+CP+S+RLK LL KEY   P Y +
Sbjct: 82  NGVKDSDFAAEVETYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTI 140

Query: 171 IELDKHKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDG 230
           +ELDKH++G  LQK+I  KTGR+TVPN++ING SRGG D+   LH    LL+SL  W   
Sbjct: 141 VELDKHENGAELQKYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGS 200

Query: 231 DFTVKQ 236
             +VK+
Sbjct: 201 TLSVKK 206

>CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some
           similarities with uniprot|P38068 Saccharomyces
           cerevisiae YBR014c
          Length = 226

 Score =  129 bits (323), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 90/136 (66%), Gaps = 1/136 (0%)

Query: 102 SKDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKE 161
           S  NS+S K G    +      E+ PAKE+  ++  +P+++FSKS+CP+S  LK+LL K 
Sbjct: 92  SNSNSLSNKEGQEDAEEAADA-EYSPAKEFQKLVKSAPIVIFSKSYCPFSKNLKKLLDKN 150

Query: 162 YTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELL 221
           Y + P+YV +E+D+H +G  L  +I+K TGR TVPNL+ NG S+GGFDD+ ALH+  EL 
Sbjct: 151 YRLDPAYVAVEVDQHPNGDKLYSYIKKLTGRNTVPNLIANGDSKGGFDDMLALHNSNELE 210

Query: 222 ESLNKWGDGDFTVKQL 237
             L +WG G+  V ++
Sbjct: 211 SKLIEWGVGELQVSKV 226

>TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.189
           YDL010W
          Length = 191

 Score =  121 bits (304), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 80/117 (68%), Gaps = 2/117 (1%)

Query: 118 GTVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHK 177
           G  S G+FDPA+EY  I+ ++PV++FSK+FCPY  RLK+LL   Y  +P   +IELDKH 
Sbjct: 63  GGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHP 122

Query: 178 HGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTV 234
           +G  L  +I+++T   TVPNL++NGKS GGFD IK L     + +++ K  D DF+V
Sbjct: 123 NGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQK--DSDFSV 177

>CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {ON}
           some similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156c PRM4
          Length = 233

 Score = 89.4 bits (220), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 88/174 (50%), Gaps = 22/174 (12%)

Query: 86  AEIDKIKQEVNSGSGASKDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVFSK 145
           A ++ IK+E N+ +  +     S  + S +KDGTV E  +DP K +  I+  SP ++F +
Sbjct: 64  ASVNSIKKESNNLNSVAHT---SMSSSSVAKDGTVIE--YDPEKNFKQIINTSPAVLFIR 118

Query: 146 SFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFI--------------EKKTG 191
           S    S+ L++LLT++Y ITP   +++LDKH H V L++ I                   
Sbjct: 119 SSEYESNILRKLLTRDYEITPELAIVDLDKHDHDVLLERHILSHKIKSTKVEVLKSTSVK 178

Query: 192 RATVPNLMINGKS---RGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSN 242
           +A  P L ING S    G  DDI   H KG+LL  L  +   +    + + PSN
Sbjct: 179 QAKAPYLFINGHSLINNGIADDILKFHEKGQLLTKLKAFAGENIVFNKRDLPSN 232

>KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.679
           YPL156C
          Length = 267

 Score = 89.0 bits (219), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 3/123 (2%)

Query: 123 GEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVAL 182
             FD    ++ IL  SPV++F K+    S+  K LL +EY I+P   V++LDKH +G  L
Sbjct: 144 ASFDVETNFNEILNTSPVVLFIKTSDKQSNYFKNLLLREYEISPEVAVVDLDKHSNGAKL 203

Query: 183 QKFIEKK---TGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEK 239
           Q++I K    T    +P L IN  +    D++K  H  G LLE+  K G+G    K++E 
Sbjct: 204 QEYIRKNKLMTKDQKLPYLFINSVAITNNDNLKKFHKDGTLLENFKKLGNGKIMFKKIEA 263

Query: 240 PSN 242
           PSN
Sbjct: 264 PSN 266

>SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {ON}
           weakly similar to uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 258

 Score = 87.0 bits (214), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 83/162 (51%), Gaps = 23/162 (14%)

Query: 105 NSISQKAGSGSKDGTVSEGE--------FDPAKEYSMILGISPVIVFSKSFCPYSSRLKE 156
           +SIS++  +GS     ++G         FDP+  +  IL  SPV++F+KS    S  LK 
Sbjct: 97  SSISKQGSAGSWATNTADGHKNTDESLAFDPSINFKEILSTSPVVIFTKSSDLGSQYLKN 156

Query: 157 LLTKEYTITPSYVVIELDKHKHGVALQKFIE--KKTGRAT----------VPNLMINGKS 204
           LLTKEY I+P   V+ELDKH  G  LQ +I+  K T   +          VP L ING S
Sbjct: 157 LLTKEYQISPQVAVVELDKHAKGKELQDYIKLNKLTAYKSNLSPSDDIPEVPYLFINGVS 216

Query: 205 ---RGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSNN 243
              +G  DDIK LH  G LL+ L  +       ++   PSN+
Sbjct: 217 IINKGLKDDIKKLHKDGSLLDKLRSFAGEKVMFEKANLPSNS 258

>NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {ON}
           Anc_8.679
          Length = 357

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 80/165 (48%), Gaps = 11/165 (6%)

Query: 89  DKIKQEVNSGSGASKDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVFSKSFC 148
           DK    +N G+  +K       A    +   ++   FDP + ++ I+  SP ++F KS  
Sbjct: 192 DKGNFNLNDGAMNTKKKPSQGNAMRTKESSKLNVKPFDPERSFNQIIHTSPAVLFIKSSS 251

Query: 149 PYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFI--------EKKTGRATVPNLMI 200
             S  L++LL +EY I+P   V++LDKH +GV L+++I        E+      VP L +
Sbjct: 252 TDSLNLRKLLKEEYEISPELAVVDLDKHSNGVELEQYIKQNKLLTEERTNSPINVPYLFL 311

Query: 201 NGKS---RGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSN 242
           NG S    G   DI  LH  G LLE L    DG     + + PSN
Sbjct: 312 NGNSVINNGLSKDISKLHKNGHLLEKLRSLSDGHIMFVKKDHPSN 356

>Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C
           (PRM4) -  [contig 68] FULL
          Length = 275

 Score = 80.9 bits (198), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 98/198 (49%), Gaps = 32/198 (16%)

Query: 77  KDQESALVDAEIDK---------IKQEV-NSGSGASKDNSISQKAGS-----------GS 115
           KD++ +L   E+D          IK E+ +SGSG++   +I+ +  +           G 
Sbjct: 79  KDEDPSLAALEVDTRSVEQIFSDIKHEISDSGSGSATQRAIATRVAATADIVRSEVVHGH 138

Query: 116 KDGTVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDK 175
            +   S  +FD A  +S IL  SPV++F  S    S  L+ LL + Y ++P+  V++L+K
Sbjct: 139 GNYRASGSDFDAAASFSEILNTSPVVIFVDS-AQDSELLRSLLHRHYEVSPAPAVVDLEK 197

Query: 176 HKHGVALQKFIE-KKTGRATVPN------LMINGKSRGGFD---DIKALHSKGELLESLN 225
           H  G  L+ FI   KT + + P+      L +NG+S    D   DI+ LH++ +LLE L 
Sbjct: 198 HSRGAQLESFIRLYKTDQTSNPSPREPPYLFVNGQSVINTDFKSDIQDLHAQNKLLEKLR 257

Query: 226 KWGDGDFTVKQLEKPSNN 243
              +G     +   PSN+
Sbjct: 258 SVAEGQVMFTRNNAPSNS 275

>KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 271

 Score = 80.1 bits (196), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 84/169 (49%), Gaps = 17/169 (10%)

Query: 91  IKQEVNSGSG-----ASKDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVFSK 145
           I+ E++  SG     A++   +  +   G ++      +FDPA  +  IL  SPV++F  
Sbjct: 104 IRLEISDNSGVATRVATRAEIVRSEVVHGPRNYRPPSADFDPAANFQEILSASPVVLFVD 163

Query: 146 SFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFI---EKKTGRATV-----PN 197
           S    S RL+ LL ++Y ++P+  V++L+KH  G  L+ +I     K   AT      P 
Sbjct: 164 S-AQDSERLRALLQRDYEVSPAPAVVDLEKHSRGAQLETYIRYYRTKPASATAVPRQPPY 222

Query: 198 LMINGKSRGGFD---DIKALHSKGELLESLNKWGDGDFTVKQLEKPSNN 243
           L +NG S    D   DI+ LH++ ELL  L    +G+    +   PSN+
Sbjct: 223 LFVNGNSVINSDFQSDIQDLHAQNELLAKLKTVAEGNVMFARNNAPSNS 271

>Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON}
           complement(30780..31532) [753 nt, 251 aa]
          Length = 250

 Score = 79.0 bits (193), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 68/128 (53%), Gaps = 10/128 (7%)

Query: 125 FDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQK 184
           FD  + +  I+  SPV++F KS  P S  LK LL +EY ++P   V++LD+H  G  LQK
Sbjct: 122 FDAERNFKEIINTSPVVIFIKSSDPASHYLKNLLLREYEVSPEMAVVDLDRHVQGQLLQK 181

Query: 185 FIE-------KKTGRATVPNLMINGKS---RGGFDDIKALHSKGELLESLNKWGDGDFTV 234
           +I+       +      VP L ING S    G   DIK   +KG LL+ L  +   +  +
Sbjct: 182 YIKAYQLTSGENGNPPEVPYLFINGVSVINNGIEKDIKQAQTKGILLDKLKSFASDNVMI 241

Query: 235 KQLEKPSN 242
           ++ + PSN
Sbjct: 242 QKKDMPSN 249

>KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 281

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 72/138 (52%), Gaps = 15/138 (10%)

Query: 120 VSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHG 179
           VS   F P+  +  IL  SPVI+F KS    S  LK +LT EYT +P  +V++LDKH+ G
Sbjct: 143 VSNERFSPSLGFQQILNTSPVILFIKSSEKNSVDLKNVLTLEYTFSPEIIVVDLDKHQFG 202

Query: 180 VALQKFIE------------KKTGRATVPNLMINGKS---RGGFDDIKALHSKGELLESL 224
            ++Q++I+            + +    VP L ING S   +   DDI   H+ G LL  L
Sbjct: 203 DSMQEYIQLNRLATYKSNYGESSKSPDVPYLFINGVSLINKSLKDDILNKHADGSLLSKL 262

Query: 225 NKWGDGDFTVKQLEKPSN 242
               D   ++ +++ PSN
Sbjct: 263 RHVADSKVSISKVDIPSN 280

>KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.679
           YPL156C
          Length = 278

 Score = 76.6 bits (187), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 88/172 (51%), Gaps = 12/172 (6%)

Query: 84  VDAEIDKIKQEVNSGSGASKDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVF 143
           VD EI  +++E+++ +  +      +K    + +    +  +DP   ++ ++ +SPV++F
Sbjct: 107 VDQEISAVRKEIDAQTQPTARGDRRKKKKVLATELLADDAPWDPLSTFTEVMNMSPVVLF 166

Query: 144 SKS--FCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKT----GRATVPN 197
            KS      +  ++++L+ EY I+P   V++LDKH++G  LQ +IE +         +P 
Sbjct: 167 IKSSERNSLADHVRKVLSTEYEISPGAAVVDLDKHRYGEELQNYIETQKLPGGSSQQLPY 226

Query: 198 LMINGKSRGGFDDI------KALHSKGELLESLNKWGDGDFTVKQLEKPSNN 243
           L +N     G  +I      K LHS G LL+   +  +     +++E PSNN
Sbjct: 227 LFVNRVPVIGAGEIDSVAEFKRLHSTGALLDRFKQLAERKVLFEKIELPSNN 278

>NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {ON}
           Anc_8.679
          Length = 271

 Score = 73.9 bits (180), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/174 (32%), Positives = 80/174 (45%), Gaps = 15/174 (8%)

Query: 84  VDAEIDKIKQEVNSGSGASKDNS---ISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPV 140
           V  EI  IK+E++      K N     S+K         +S   F+    +  IL  SP 
Sbjct: 97  VWKEISDIKKELSKDEHILKKNDGNDNSKKLKDSQNVHLLSSTSFNAEDNFKQILNTSPA 156

Query: 141 IVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKK---------TG 191
           ++F KS    S  LK LL+ EY I+P   +++L+KH +G  L  +I+K          + 
Sbjct: 157 VLFIKSSEWDSQYLKNLLSIEYEISPQLAIVDLEKHSNGNQLLNYIKKNKLLPPSNKASS 216

Query: 192 RATVPNLMINGKS---RGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSN 242
              +P L ING S    G   DIK LHS G LL  L  + DG    ++   PSN
Sbjct: 217 TPNLPYLFINGVSIINNGLSKDIKQLHSNGHLLNKLKSYSDGHIFFEKKNFPSN 270

>TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON} 
          Length = 106

 Score = 69.3 bits (168), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 52/88 (59%), Gaps = 1/88 (1%)

Query: 134 ILGISPVIVFSKSFCPYSSRLKELLTKEYTITPS-YVVIELDKHKHGVALQKFIEKKTGR 192
           ++   P+ V +KS+CPY    K  L KE  +      V++LD+ + G A+Q  + + T +
Sbjct: 12  LIAAKPIFVAAKSYCPYCQASKSTLFKELNVPADKATVLDLDQMQDGQAIQAILAELTQQ 71

Query: 193 ATVPNLMINGKSRGGFDDIKALHSKGEL 220
            TVPN+ INGK  GG  D++AL + GEL
Sbjct: 72  NTVPNIFINGKHIGGNSDLQALKNNGEL 99

>Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON}
           similar to Ashbya gossypii ACR146W
          Length = 281

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 69/146 (47%), Gaps = 16/146 (10%)

Query: 113 SGSKDGTVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIE 172
           +G + G + + EF PA  +  IL  SPV+VF+K     S  LK LL  EY +TP   +++
Sbjct: 137 TGPRSGGM-KNEFMPAIAFQEILNTSPVVVFAKGMNRDSEYLKNLLHAEYEVTPEIAIVD 195

Query: 173 LDKHKHGVALQKFI------------EKKTGRATVPNLMINGKSRGGFD---DIKALHSK 217
           L KH  G  LQK+I            +       VP L ING S        DIK  H+ 
Sbjct: 196 LMKHDQGDELQKYIMLNKLNTYNTHYDASDDIPDVPYLFINGVSVINVSLEKDIKLQHTS 255

Query: 218 GELLESLNKWGDGDFTVKQLEKPSNN 243
           G L+E L  +       K+L  PSN+
Sbjct: 256 GLLIEKLRSFAGEKVKFKRLSPPSNS 281

>YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}
           PRM4Pheromone-regulated protein proposed to be involved
           in mating; predicted to have 1 transmembrane segment;
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 284

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 75/148 (50%), Gaps = 12/148 (8%)

Query: 107 ISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITP 166
           ++ ++ S +        +FDP  ++  I+  SP ++F KS    S  LK LL +E+ I+P
Sbjct: 136 LNPRSSSLALQKNCDHKKFDPRTDFLDIIRTSPAVLFIKSSQADSIFLKNLLQREFEISP 195

Query: 167 SYVVIELDKHKHGVALQKFIEKK-----TGRAT----VPNLMINGKS---RGGFDDIKAL 214
               ++L+KH HG  L+K+I++      T  A      P L +NG S   RG   DI   
Sbjct: 196 ELATVDLEKHSHGYELEKYIKQNKLNIDTSAALESIQSPYLFLNGISVINRGMVRDIIEP 255

Query: 215 HSKGELLESLNKWGDGDFTVKQLEKPSN 242
           HSKG LL  L     G+  V++ + PSN
Sbjct: 256 HSKGLLLPLLKSEARGNLLVEKKDIPSN 283

>NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679
          Length = 240

 Score = 70.1 bits (170), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 7/109 (6%)

Query: 123 GEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVAL 182
             F+  + ++ I+  SPV++F KS    S  +++LL KEY I+P   V++LDKH HG AL
Sbjct: 113 AAFNVQQHFTQIIHTSPVVLFMKSSQDDSRLMRDLLQKEYEISPEIAVVDLDKHTHGAAL 172

Query: 183 QKFIE------KKTGRATVPNLMINGK-SRGGFDDIKALHSKGELLESL 224
           Q +I       + T    +P L IN +       ++K+LH  G LL++ 
Sbjct: 173 QDYIRLNKLDNRGTAYVKLPYLFINEQFVHVDVKNVKSLHKDGALLKTF 221

>NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON}
           Anc_8.679
          Length = 236

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 67/128 (52%), Gaps = 10/128 (7%)

Query: 125 FDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQK 184
           F+P   +  IL  SP+++F KS    S  ++++LTKEY I+P   V++LDKHKHG  L++
Sbjct: 108 FNPEVNFFQILETSPMVLFIKSSERDSKIIRDILTKEYEISPELAVVDLDKHKHGDELEE 167

Query: 185 FIEKK---------TGRATVPNLMINGKSRG-GFDDIKALHSKGELLESLNKWGDGDFTV 234
           FI            +  A++P L +N  S       IK LHSK  L++      +G    
Sbjct: 168 FIRLNKLNEQAIFSSSLASLPYLFVNEVSMEIDTATIKDLHSKNFLIKKFELMSNGKVLF 227

Query: 235 KQLEKPSN 242
           ++   PSN
Sbjct: 228 ERKNPPSN 235

>Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {ON}
           YPL156C (REAL)
          Length = 287

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 69/133 (51%), Gaps = 12/133 (9%)

Query: 122 EGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVA 181
           + EFDP   +  I+  SP ++F KS    S  LK LL +E+ I+P    ++L+KH HG  
Sbjct: 154 QKEFDPKVSFLDIISTSPAVLFIKSSQMDSIFLKNLLQREFEISPELATVDLEKHSHGYQ 213

Query: 182 LQKFIEKK-------TGRATV--PNLMINGKS---RGGFDDIKALHSKGELLESLNKWGD 229
           L+K+I++        T   ++  P L +NG S    G   DI   HS+G LL  L     
Sbjct: 214 LEKYIKQNKLSINPSTALESIHSPYLFLNGVSVINNGMAKDIIEPHSEGLLLSILKSEAR 273

Query: 230 GDFTVKQLEKPSN 242
           G+  V++ + PSN
Sbjct: 274 GNLLVEKKDIPSN 286

>ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL156C (PRM4)
          Length = 213

 Score = 67.8 bits (164), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 65/134 (48%), Gaps = 13/134 (9%)

Query: 123 GEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVAL 182
           G+F PA+ +  I+  SP ++F K     S  L+ LLT EY +TP   V++L KH++   L
Sbjct: 80  GDFRPAQNFQEIISTSPFVLFVKGTDESSRYLRHLLTNEYEVTPEIAVVDLSKHRYSGDL 139

Query: 183 QKFIEKKT----------GRATVPNLMINGKSRGGFD---DIKALHSKGELLESLNKWGD 229
           Q++I +                VP L + G+S        DI+  H +G+L   L +   
Sbjct: 140 QRYIREHKLHGPLFQLTENTPDVPYLFVKGESVINTSVEKDIREPHERGQLQAELQRHAG 199

Query: 230 GDFTVKQLEKPSNN 243
            D  +K+   PSN+
Sbjct: 200 LDAVIKKRSPPSNS 213

>Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON}
           complement(73659..73988) [330 nt, 110 aa]
          Length = 109

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 134 ILGISPVIVFSKSFCPYSSRLKELLTKEYTIT-PSYVVIELDKHKHGVALQKFIEKKTGR 192
           ++G  PV V +KS+CP+    +E L +EY +     +V+ELD    G  +Q+ + + T +
Sbjct: 13  MIGEKPVFVAAKSYCPHCRATRETLFEEYNLPREKALVLELDLMTDGAEIQEALAEITHQ 72

Query: 193 ATVPNLMINGKSRGGFDDIKALHSKGELLESLN 225
            TVPN+ I G+  GG  D++AL   G+L E L+
Sbjct: 73  DTVPNIFIYGQHVGGNSDLQALKKDGQLKEMLD 105

>AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL035C (GRX1) and
           YDR513W (TTR1)
          Length = 111

 Score = 62.4 bits (150), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 51/83 (61%), Gaps = 2/83 (2%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPSYV-VIELDKH-KHGVALQKFIEKKTGRATVPN 197
           V + SK++CPY    K  L +E  +  S V ++ELD   + G  +Q  +++ +G+ TVPN
Sbjct: 19  VFIASKTYCPYCQAAKRTLLEEKRVPASAVKLLELDTMGEEGAVIQAALQELSGQRTVPN 78

Query: 198 LMINGKSRGGFDDIKALHSKGEL 220
           + ING+  GG  D++AL + GEL
Sbjct: 79  IYINGRHVGGNSDLEALKASGEL 101

>Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {ON}
           YPL156C (REAL)
          Length = 283

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 69/134 (51%), Gaps = 12/134 (8%)

Query: 121 SEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGV 180
           +E +FDP   +  I+  SP ++F KS    S  LK LL +E+  +P   +++L+KH +G 
Sbjct: 149 NEKKFDPKVNFLDIINTSPAVLFIKSSQMDSVFLKRLLQREFETSPELAIVDLEKHSYGY 208

Query: 181 ALQKFIEKK-------TGRATV--PNLMINGKS---RGGFDDIKALHSKGELLESLNKWG 228
            L+K+I++        T    +  P L +NG S    G   DI   HSKG LL  L    
Sbjct: 209 ELEKYIKENKLDVDPSTALEAIHSPYLFLNGVSVINNGIARDIIEPHSKGLLLPVLKSKA 268

Query: 229 DGDFTVKQLEKPSN 242
            G+  V++ + PSN
Sbjct: 269 GGNLLVEKRDIPSN 282

>Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 63.2 bits (152), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 55/92 (59%), Gaps = 1/92 (1%)

Query: 134 ILGISPVIVFSKSFCPYSSRLKELLTKEYTITPS-YVVIELDKHKHGVALQKFIEKKTGR 192
           ++G   V V +K++CPY       L +E  +  S  VV+ELD+  +G  +Q  +E+ +G+
Sbjct: 47  LIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKAVVLELDEMSNGSEIQDALEEISGQ 106

Query: 193 ATVPNLMINGKSRGGFDDIKALHSKGELLESL 224
            TVPN+ INGK  GG  D++AL   G+L E L
Sbjct: 107 KTVPNVYINGKHIGGNSDLEALKKNGKLAELL 138

>TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON}
           Anc_8.679 YPL156C
          Length = 297

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 61/131 (46%), Gaps = 13/131 (9%)

Query: 125 FDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQK 184
           FD A  Y  I+  S V++F KS    S+ +K+LL   Y I P   +++LD+H  G  L  
Sbjct: 166 FDAAANYKEIINTSRVVLFMKSSDSQSNEIKKLLLNSYEILPEIAIVDLDRHVQGALLHD 225

Query: 185 FIEKKT-----------GRATVPNLMINGKS--RGGFDDIKALHSKGELLESLNKWGDGD 231
           +I KK             +  VP L+ING S       +   LH++G LL+ L       
Sbjct: 226 YIAKKKILTNQLGYHKDDQLEVPFLVINGVSFVTSSNKNFHKLHNEGLLLQKLKNLAGDS 285

Query: 232 FTVKQLEKPSN 242
             + + + PSN
Sbjct: 286 VMISKKDSPSN 296

>Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C
           (REAL)
          Length = 286

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 64/132 (48%), Gaps = 16/132 (12%)

Query: 125 FDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQK 184
           FDP   +  I+  SP ++F KS    S  L+ LL KE+ I+P    ++L+KH  G  L+K
Sbjct: 156 FDPKANFLDIIKTSPAVLFIKSSQSDSIFLRNLLQKEFEISPELATVDLEKHSRGYELEK 215

Query: 185 FIEKKTGRATV-----------PNLMINGKS---RGGFDDIKALHSKGELLESLNKWGDG 230
           +I  K  +  +           P L +NG S    G   DI   HSKG LL  L     G
Sbjct: 216 YI--KQNKLNIDPDIALESIHPPYLFLNGVSLINNGIEKDIIEPHSKGSLLSVLKSEARG 273

Query: 231 DFTVKQLEKPSN 242
           +  V++ + PSN
Sbjct: 274 NLLVEKKDIPSN 285

>CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly
           similar to uniprot|P17695 Saccharomyces cerevisiae
           YDR513w TTR1
          Length = 142

 Score = 60.8 bits (146), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 65/121 (53%), Gaps = 4/121 (3%)

Query: 107 ISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTI-T 165
           ISQK  S   +  VS+   +  K    ++G   + V SKS+CPY    K+ L +E  +  
Sbjct: 22  ISQKFYSSLGNKMVSQDTVNSVKN---MIGQKKIFVASKSYCPYCRAAKQTLFEELKVPM 78

Query: 166 PSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLN 225
              VV+ELD+ + G  +Q+ + +  G+ TVPN+ I+G+  GG  D++ L   G+L   L 
Sbjct: 79  DKAVVLELDEIEEGSDIQQALAEINGQNTVPNIYIDGQHIGGNSDLQKLKQTGKLQPLLQ 138

Query: 226 K 226
           K
Sbjct: 139 K 139

>Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}
           YCL035C (REAL)
          Length = 316

 Score = 62.8 bits (151), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 56/103 (54%), Gaps = 4/103 (3%)

Query: 119 TVSEGEFDPAKEYSMILGISPVIVFSKSFCPYS-SRLKELLTKEYTITPSYVVIELDKHK 177
            VS+   D  KE   ++    + V SK++CPY  + L  L  K        +V++L++ K
Sbjct: 207 MVSQETIDHVKE---LIAEKEIFVASKTYCPYCHAALNTLFQKMNVPKSKVLVLQLNEMK 263

Query: 178 HGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGEL 220
            GV +Q  + +  G+ TVPN+ INGK  GG DD++ L   GEL
Sbjct: 264 DGVDIQAALYQLNGQRTVPNIYINGKHIGGNDDLQELRETGEL 306

>Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W
           (REAL)
          Length = 145

 Score = 60.1 bits (144), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 55/92 (59%), Gaps = 1/92 (1%)

Query: 134 ILGISPVIVFSKSFCPYSSRLKELLTKEYTITPS-YVVIELDKHKHGVALQKFIEKKTGR 192
           ++G   V V +K++CPY       L +E  +  S  +V+ELD+  +G  +Q  +E+ +G+
Sbjct: 47  LIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQ 106

Query: 193 ATVPNLMINGKSRGGFDDIKALHSKGELLESL 224
            TVPN+ INGK  GG  D+++L   G+L E L
Sbjct: 107 RTVPNVYINGKHIGGNSDLESLKKSGKLAEIL 138

>YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}
           GRX2Cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase involved
           in maintaining redox state of target proteins, also
           exhibits glutathione peroxidase activity, expression
           induced in response to stress
          Length = 143

 Score = 60.1 bits (144), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 1/92 (1%)

Query: 134 ILGISPVIVFSKSFCPYSSRLKELLTKEYTITPS-YVVIELDKHKHGVALQKFIEKKTGR 192
           ++G   V V +K++CPY       L +E  +  S  +V+ELD+  +G  +Q  +E+ +G+
Sbjct: 47  LIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQ 106

Query: 193 ATVPNLMINGKSRGGFDDIKALHSKGELLESL 224
            TVPN+ INGK  GG  D++ L   G+L E L
Sbjct: 107 KTVPNVYINGKHIGGNSDLETLKKNGKLAEIL 138

>TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38
           YCL035C
          Length = 106

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 139 PVIVFSKSFCPYSSRLKELLTKEYTITP-SYVVIELDKHKHGVALQKFIEKKTGRATVPN 197
           PV + +KS+C  S+  K  L  EY+I      V+ELDK   G A+   + K + ++T+PN
Sbjct: 17  PVFIATKSYCNESNAAKGTLFDEYSILDDEATVLELDKMSDGEAVLFALSKISQQSTLPN 76

Query: 198 LMINGKSRGGFDDIKALHSKGEL 220
           + I GK  GG+ D+K ++  GEL
Sbjct: 77  IFIKGKHIGGYQDLKEMNESGEL 99

>Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 58.9 bits (141), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 1/86 (1%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPS-YVVIELDKHKHGVALQKFIEKKTGRATVPNL 198
           V V +K++CPY       L +E  +  S  +V+ELD+  +G  +Q  +E+ +G+ TVPN+
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNV 112

Query: 199 MINGKSRGGFDDIKALHSKGELLESL 224
            INGK  GG  D++ L   G+L E L
Sbjct: 113 YINGKHIGGNSDLETLKKNGKLAEIL 138

>TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {ON}
           Anc_1.38 YCL035C
          Length = 118

 Score = 57.8 bits (138), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 139 PVIVFSKSFCPYSSRLKELLTKEYTITPSYVV-IELDKHKHGVALQKFIEKKTGRATVPN 197
           P+ V  KS CPYS +  E L  +  +    V+ I +D+ ++G  +++ I   TG+ TVPN
Sbjct: 28  PIFVARKSDCPYSKKTLETLFDDLHVPKDKVLLITVDEIENGAEVKQAIIDYTGQKTVPN 87

Query: 198 LMINGKSRGGFDDIKALHSKGELLESL 224
             ING+  GG DD++ L   GEL E L
Sbjct: 88  TYINGRHIGGNDDLQKLKQTGELQELL 114

>Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON}
           (219541..219966) [426 nt, 142 aa]
          Length = 141

 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 60/106 (56%), Gaps = 4/106 (3%)

Query: 120 VSEGEFDPAKEYSMILGISPVIVFSKSFCPYS-SRLKELLTKEYTITPSYVVIELDKHKH 178
           VS+      KE   ++G   V V +KS+CPY  + L+ L T  +      +V++L++ + 
Sbjct: 34  VSQATVSRVKE---LIGQKKVFVAAKSYCPYCQASLQTLFTDYHVPKDKSLVLQLNQMED 90

Query: 179 GVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESL 224
           G  +Q  + + TG+ TVPN+ I+GK  GG  D++ L S G+L E L
Sbjct: 91  GDDIQAALAEITGQRTVPNIYIDGKHIGGNSDLQQLKSSGKLDELL 136

>KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON}
           Anc_1.38 YCL035C
          Length = 157

 Score = 58.5 bits (140), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 134 ILGISPVIVFSKSFCPYSSRLKELLTKEYTITPS-YVVIELDKHKHGVALQKFIEKKTGR 192
           ++G  P+ V SK++CPY     + L KE  I  S  VV++LD+   G  +Q+ +    G+
Sbjct: 61  LIGEKPIFVASKTYCPYCRATLKTLFKELEIPESEAVVLQLDEMPDGPEIQEALFDINGQ 120

Query: 193 ATVPNLMINGKSRGGFDDIKALHSKGEL 220
            TVPN+ I G+  GG DD++ L   G+L
Sbjct: 121 KTVPNIYIKGQHIGGNDDLQTLKKAGKL 148

>KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 57.4 bits (137), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 140 VIVFSKSFCPYS-SRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNL 198
           V V SKS+CPYS + L  L T+    T   +V+++++   G  +Q  + + TG+ TVPN+
Sbjct: 19  VFVASKSYCPYSKAALNTLFTELNVPTSKALVLQVNQLPEGSDIQDALLELTGQRTVPNI 78

Query: 199 MINGKSRGGFDDIKALHSKGEL 220
            I GK  GG DD++ L   G+L
Sbjct: 79  YIKGKHIGGNDDLQILKQSGKL 100

>TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON}
           Anc_8.679 YPL156C
          Length = 251

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 123 GEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVAL 182
           G ++P   +  IL  SP+++F +S    S  +K+L   EY I+P + +++LD HK+G  L
Sbjct: 123 GSYNPELNFKQILNTSPMVLFIRSSQKSSKFIKKLFLNEYEISPEFAIVDLDLHKNGNIL 182

Query: 183 QKFIE-----KKTGRATVPNLMINGKSRGGFD---DIKALH 215
           Q +I+      K     VP L ING S    +   DI +LH
Sbjct: 183 QNYIQTKKIINKDDTLDVPYLFINGVSVINSNLNKDIISLH 223

>Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON}
           similar to Ashbya gossypii AFR710W
          Length = 158

 Score = 58.5 bits (140), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 2/85 (2%)

Query: 138 SPVIVFSKSFCPYSSRLKELLTKEYTI-TPSYVVIELDKH-KHGVALQKFIEKKTGRATV 195
           S + V SK++CPY  R K+ L ++  I  P   V+ELD   + GV +Q  + + +G+ TV
Sbjct: 65  SKIFVASKTYCPYCRRAKKTLFEDKKIPLPEAKVLELDIMGQEGVDIQAALLELSGQRTV 124

Query: 196 PNLMINGKSRGGFDDIKALHSKGEL 220
           PN+ I GK  GG  +++AL S GEL
Sbjct: 125 PNIYIGGKHIGGNSELQALESSGEL 149

>KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {ON}
           weakly similar to uniprot|P25567 Saccharomyces
           cerevisiae YCL037C SRO9 Associates with translating
           ribosomes and weakly similar to uniprot|Q12034
           Saccharomyces cerevisiae YDR515W SLF1 RNA binding
           protein that associates with polysomes
          Length = 107

 Score = 56.6 bits (135), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 138 SPVIVFSKSFCPYS-SRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVP 196
           S + V SK++CPY  + LK L  ++        V++L++ + G  +Q  + + TG+ TVP
Sbjct: 17  SKIFVASKTYCPYCQATLKTLFEEKKVDKKLATVLQLNQLEDGSDIQDALAEITGQKTVP 76

Query: 197 NLMINGKSRGGFDDIKALHSKGEL 220
           N+ INGK  GG  D++ L++ G+L
Sbjct: 77  NIFINGKHIGGNSDLQELNNSGDL 100

>Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {ON}
           YCL035C (GRX1) - Glutaredoxin [contig 121] FULL
          Length = 138

 Score = 57.4 bits (137), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPSYV-VIELDKHKHGVALQKFIEKKTGRATVPNL 198
           + V SK++CPY     +LL ++  +T   V V++LD  K G  +Q+ + + +G+ TVPN+
Sbjct: 48  IFVASKTYCPYCQATLKLLFEDKKLTKDQVYVVQLDTIKEGSEIQEALAEISGQKTVPNV 107

Query: 199 MINGKSRGGFDDIKALHSKGEL 220
            I+G+  GG  D++AL S G+L
Sbjct: 108 YISGEHIGGNSDLQALESSGKL 129

>NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1.38
           YCL035C
          Length = 109

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPS-YVVIELDKHKHGVALQKFIEKKTGRATVPNL 198
           + V SK++CPY     + L KE  +  S  +V++L++   G  +Q+ + +  G+ TVPN+
Sbjct: 19  IFVASKTYCPYCHATIKTLFKELNVPKSKALVLQLNEMDDGAEIQQALFEINGQKTVPNI 78

Query: 199 MINGKSRGGFDDIKALHSKGEL 220
            INGK  GG D ++ L   GEL
Sbjct: 79  YINGKHVGGNDKLQDLKESGEL 100

>NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {ON}
           Anc_1.38 YCL035C
          Length = 136

 Score = 54.7 bits (130), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPS-YVVIELDKHKHGVALQKFIEKKTGRATVPNL 198
           VI+F+KS+CPY    K  + +E  +  S  +V++LD   +G  +Q+ +    G+ TVP++
Sbjct: 48  VIIFAKSYCPYCKAAKHTIFEEINVPKSKALVLDLDLMDNGQEIQQALLAINGQKTVPHV 107

Query: 199 MINGKSRGGFDDIKALHSKGEL 220
            ING+  GG  +++ ++  GEL
Sbjct: 108 YINGEFIGGNSEVQKIYKSGEL 129

>KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 and similar to uniprot|P17695 Saccharomyces
           cerevisiae YDR513w TTR1
          Length = 138

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 54/88 (61%), Gaps = 1/88 (1%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPSYVVI-ELDKHKHGVALQKFIEKKTGRATVPNL 198
           + V +K++CPY +   +LL ++  +    V++ +LD  K G  +Q+ + + +G+ TVPN+
Sbjct: 48  IFVAAKTYCPYCNATLKLLFQDKKLRKDQVLLLQLDTMKEGSEIQEALTEISGQRTVPNI 107

Query: 199 MINGKSRGGFDDIKALHSKGELLESLNK 226
            I G+  GG  D++AL + G+L E L K
Sbjct: 108 YILGEHIGGNSDLQALEASGKLDELLEK 135

>Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 140 VIVFSKSFCPYS-SRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNL 198
           + V SK++CPY  + L  L  K        +V++L++ K G  +Q  + +  G+ TVPN+
Sbjct: 19  IFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNEMKDGAEIQAALCEINGQRTVPNI 78

Query: 199 MINGKSRGGFDDIK 212
            INGK  GG DD++
Sbjct: 79  YINGKHIGGNDDLQ 92

>YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}
           GRX1Hydroperoxide and superoxide-radical responsive
           heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair; protects
           cells from oxidative damage
          Length = 110

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 140 VIVFSKSFCPYS-SRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNL 198
           + V SK++CPY  + L  L  K        +V++L+  K G  +Q  + +  G+ TVPN+
Sbjct: 19  IFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNI 78

Query: 199 MINGKSRGGFDDIK 212
            INGK  GG DD++
Sbjct: 79  YINGKHIGGNDDLQ 92

>NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPS-YVVIELDKHKHGVALQKFIEKKTGRATVPNL 198
           + + SK++CPY     + L +E  +  S  +V++L++   G  +Q+ + +  G+ TVPN+
Sbjct: 19  IFIASKTYCPYCFSTIKTLFEELKVPKSKALVLQLNEMDDGADIQEALFEINGQKTVPNI 78

Query: 199 MINGKSRGGFDDIKALHSKGEL 220
            INGK  GG   ++ L   GEL
Sbjct: 79  YINGKHIGGNSQLQDLKESGEL 100

>Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPSYV-VIELDKHKHGVALQKFIEKKTGRATVPNL 198
           + V SK++CPY       L ++  +  S V V++L++ + G  +Q  + +  G+ TVPN+
Sbjct: 19  IFVASKTYCPYCHAALNTLFQQLKVPKSKVLVLQLNEMEDGADIQAALYEINGQRTVPNV 78

Query: 199 MINGKSRGGFDDIK 212
            INGK  GG DD++
Sbjct: 79  YINGKHIGGNDDLQ 92

>NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON}
           Anc_1.38 YCL035C
          Length = 138

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 50/86 (58%), Gaps = 1/86 (1%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPS-YVVIELDKHKHGVALQKFIEKKTGRATVPNL 198
           +IVF+KS+CPYS   +  L  +  +  S  +V+ELD  + G  +Q+ +    G+ TVP++
Sbjct: 48  IIVFAKSYCPYSIATRRTLFNDCKVPQSKALVLELDLMQDGQEIQQALLAINGQKTVPHV 107

Query: 199 MINGKSRGGFDDIKALHSKGELLESL 224
            I G+  GG  +++ +   GEL + L
Sbjct: 108 YIAGEFIGGNHELQQIFQSGELQKKL 133

>ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} similar
           to uniprot|P17695 Saccharomyces cerevisiae YDR513W TTR1
           Glutaredoxin (thioltransferase) (glutathione
           reductase)and similar to uniprot|P25373 Saccharomyces
           cerevisiae YCL035c
          Length = 139

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 134 ILGISPVIVFSKSFCPYS-SRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGR 192
           ++G   + V SK++CPY  + LK L T         +V++L+    G  +Q  + +  G+
Sbjct: 47  LIGQKKLFVASKTYCPYCQATLKTLFTDLQFPEAQAIVLQLNTIDDGQDIQDALYEINGQ 106

Query: 193 ATVPNLMINGKSRGGFDDIKALHSKGEL 220
            TVPN+ I+GK  GG  D++ L++ G+L
Sbjct: 107 RTVPNIYIDGKHIGGNSDLQELNASGKL 134

>SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 Hydroperoxide and superoxide-radical
           responsive heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair protects
           cells from oxidative damage and similar to
           uniprot|P17695 Saccharomyces cerevisiae YDR513w
           cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase
          Length = 165

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 1/84 (1%)

Query: 138 SPVIVFSKSFCPYS-SRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVP 196
           S + V SK++CPY  + L+ L   +        V++L++   G  +Q  +++ +G+ TVP
Sbjct: 73  SKIFVASKTYCPYCQATLRTLFDDKKVPNDKIKVLQLNQLDDGAEIQDALQEISGQRTVP 132

Query: 197 NLMINGKSRGGFDDIKALHSKGEL 220
           N+ I GK  GG  D++ L + GEL
Sbjct: 133 NIYILGKHIGGNSDLQELAAAGEL 156

>TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1.38
           YCL035C
          Length = 143

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPS-YVVIELDKHKHGVALQKFIEKKTGRATVPNL 198
           + V SK++CPY     + L  +  +  S  +V++L+    G  +Q+ + +  G+ +VPN+
Sbjct: 53  IFVASKTYCPYCQATLKTLFDDLNVPKSKSLVLQLNTMDDGAEIQEALFEINGQKSVPNI 112

Query: 199 MINGKSRGGFDDIKALHSKGELLESL 224
            I+GK  GG  D++ L + G+L E L
Sbjct: 113 YIDGKHIGGNSDLQELKNAGKLDEVL 138

>TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1.38
           YCL035C
          Length = 138

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPS-YVVIELDKHKHGVALQKFIEKKTGRATVPNL 198
           V V +KS+CPY       L  E  +     +V++LD    G+ LQ  +++  G+ TVP +
Sbjct: 48  VFVAAKSYCPYCKNTLITLFDELKVPKEKALVLQLDGMSDGLELQDTLQQINGQRTVPQI 107

Query: 199 MINGKSRGGFDDIKALHSKGE 219
            I+GK  GG  +++ L   GE
Sbjct: 108 YIDGKHVGGNSELQKLKKSGE 128

>TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {ON}
           Anc_1.38 YCL035C
          Length = 108

 Score = 42.4 bits (98), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLM 199
           V++FSK+FCPY     +   +         V++LDK   G  +Q  + +  G+ TVP++ 
Sbjct: 19  VVIFSKTFCPYCKATLKTFDEARLPVGLVRVLQLDKLDDGSEIQDALYELNGQKTVPSIY 78

Query: 200 INGKSRGGFDDIKALHSKGEL 220
           I  +  GG  +++ L  +G L
Sbjct: 79  ILKRHIGGNSELQKLKHEGVL 99

>KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON}
           Anc_1.38 YCL035C
          Length = 142

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 140 VIVFSKSFCPYSSRLKELLTKEYTITPSYV-VIELDKHKHGVALQKFIEKKTGRATVPNL 198
           V V  K++CPY       L  +  +  S + V++L++ KHG  +Q+ + +  G+ TVP++
Sbjct: 48  VFVAVKTWCPYCKATIVTLLDQMKVPASKIKVLKLNELKHGREIQEALFQMNGQKTVPHI 107

Query: 199 MINGKSRGGFDDIKALHSKGEL 220
            IN    GG  D++ L   G+L
Sbjct: 108 YINQIFIGGNSDLEELRVSGKL 129

>NCAS0B04890 Chr2 complement(897400..898224) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 64/120 (53%), Gaps = 17/120 (14%)

Query: 102 SKDNSISQ-KAGSGSKDGTVS---EGEFDPAKEYSMILGISPVIVF-----SKSFCPYSS 152
           S+D+ +SQ  A S   D  ++   E +FD  K+ S ++  +PV+VF     S+  C YS 
Sbjct: 138 SEDSVVSQYTAESEYTDEEINGQNEEKFD--KKLSKLVQAAPVMVFLKGSPSEPKCGYSR 195

Query: 153 RLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIK 212
           ++ ++L +E  I   +  I  D +     ++K +++ +   T P L ING+ +GG D +K
Sbjct: 196 QMVKIL-RENKIRFGFFDILRDDN-----VRKNMKRFSDWPTFPQLYINGEFQGGLDIVK 249

>NCAS0B08080 Chr2 complement(1532527..1544853) [12327 bp, 4108 aa]
            {ON} Anc_1.216 YKR054C
          Length = 4108

 Score = 34.3 bits (77), Expect = 0.31,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 5/95 (5%)

Query: 107  ISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITP 166
            + Q  G+  +  +  EG+F    EYS+  G + VI+    F  Y   +  L+T EYT   
Sbjct: 3426 LEQSLGNKLRLMSFLEGDFVKKLEYSIKFG-TVVIIQDGEF--YDPIINNLVTCEYTRAG 3482

Query: 167  SYVVIELDKHKHGVA--LQKFIEKKTGRATVPNLM 199
              V ++L KH+  V+   + FI  K   A + N +
Sbjct: 3483 GRVTVQLGKHELDVSPDFRLFIHSKDQNANISNFL 3517

>TPHA0B03340 Chr2 (770614..771363) [750 bp, 249 aa] {ON} Anc_8.240
           YDR098C
          Length = 249

 Score = 33.1 bits (74), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 80/160 (50%), Gaps = 23/160 (14%)

Query: 64  DEIVVDKESGKKGKDQESALVDAEIDKIKQEVNSGSGASKDNSISQKAGSG-----SKDG 118
           +E ++++ SG   K+  +AL     D+ K+++  G+  SK+ + S + G+        +G
Sbjct: 86  NETILNEISGADPKEFIAAL-----DQCKKQLEDGNLNSKEEATSNQNGNDDADEGEDEG 140

Query: 119 TVSEGEFDPAKEYSMILGISPVIVFSKSF-----CPYSSRLKELLTKEYTITPSYV-VIE 172
              E E +  +  + +   +PV++F K       C +S +L  +L +EY +   +  +++
Sbjct: 141 ENEETEEELNERLTKLTRAAPVMLFMKGNPTEPKCGFSRQLVGIL-REYQLRFGFFDILK 199

Query: 173 LDKHKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIK 212
            D  + G  L+KF    +   T P L ING+ +GG D IK
Sbjct: 200 DDSVRQG--LKKF----SDWPTFPQLYINGEFQGGLDIIK 233

>Suva_10.467 Chr10 (813773..814102) [330 bp, 109 aa] {ON} YLR364W
           (REAL)
          Length = 109

 Score = 31.6 bits (70), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 17/97 (17%)

Query: 139 PVIVFSKSFCP---YSSRLKELLTKEYTITPSYVVIEL------DKHKHGVALQKFIEKK 189
           P    S S+CP   Y++ + E    ++ +     V ++      ++ K  VA QK +   
Sbjct: 16  PYFQLSASWCPDCVYANSVWE----KFNVKDKVFVFDIGSLPRTEQEKWRVAFQKVV--- 68

Query: 190 TGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNK 226
            G   +P +++NGK  G    +    +KG L E L K
Sbjct: 69  -GSRNLPTVVVNGKFWGTESQLHRFENKGTLKEELTK 104

>KNAG0J01730 Chr10 (316411..317001) [591 bp, 196 aa] {ON} Anc_8.679
           YPL156C
          Length = 196

 Score = 32.3 bits (72), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/117 (19%), Positives = 52/117 (44%), Gaps = 9/117 (7%)

Query: 134 ILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGR- 192
           +  ++P+++   S  P +  L++   +EY ++P   V+ L+ +     L+ F++    + 
Sbjct: 80  LFAVTPIVLLVDSTDPRAVDLEKTFMQEYEVSPPLTVVNLNSYPESRELRLFLQLYYTQD 139

Query: 193 ---ATVPNLMINGKSRGGFDDIKALHSKGELLESLNK----WGDGDFTVKQLEKPSN 242
               ++  L IN     GF   ++  S  +    L K    + +G   + ++  PSN
Sbjct: 140 IMDRSLAYLFINNHPSVGFVMFESYLSLAQ-FRKLRKAKGVYSEGRVVINKIALPSN 195

>KAFR0B02600 Chr2 complement(522861..523640) [780 bp, 259 aa] {ON}
           Anc_8.240 YDR098C
          Length = 259

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 53/97 (54%), Gaps = 15/97 (15%)

Query: 124 EFDPA--KEYSMILGISPVIVF-----SKSFCPYSSRLKELLTKEYTITPSYV-VIELDK 175
           E +PA  ++ S ++  +P ++F     S+ +C YS ++ +LL +++ +   Y  V++ D 
Sbjct: 155 ELNPALTQKLSNLVQAAPAMLFLKGTPSEPYCGYSRQIVKLL-RDHNVRFGYFNVLKND- 212

Query: 176 HKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIK 212
                 ++K ++  +   T P L +NG+ +GG D IK
Sbjct: 213 -----VVRKAMKNYSDWPTFPQLYLNGEFQGGLDIIK 244

>NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519
          Length = 155

 Score = 32.0 bits (71), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 16/101 (15%)

Query: 135 LGISPVIVFSKSF-----CPYSSRLKELLTKEYTITPS----YVVIELDKHKHGVALQKF 185
           +G +PV++F K       C +S    +LL ++  + P+    Y V+E         L+  
Sbjct: 40  IGSAPVVLFMKGTPEFPKCGFSKATIQLLGQQ-GVDPAKFAAYNVLE------DPELRDA 92

Query: 186 IEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNK 226
           I++ T   T+P L +N +  GG D I ++   GEL E L +
Sbjct: 93  IKEFTEWPTIPQLFVNKEFVGGCDVITSMSRSGELAEVLEE 133

>SAKL0H04136g Chr8 complement(386608..386940) [333 bp, 110 aa] {ON}
           similar to uniprot|Q05926 Saccharomyces cerevisiae
           YLR364W Hypothetical ORF
          Length = 110

 Score = 31.2 bits (69), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 41/95 (43%), Gaps = 2/95 (2%)

Query: 134 ILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYV--VIELDKHKHGVALQKFIEKKTG 191
           IL     +  +  +CP       +  K   +   Y+  + +L   + G A +    K +G
Sbjct: 11  ILRAHKFVQLTAGWCPDCVYANSIWKKYGVLDKVYLFDIAKLPTREEGNAYRDAFHKISG 70

Query: 192 RATVPNLMINGKSRGGFDDIKALHSKGELLESLNK 226
              +P + +NG   G   D++ L  +G+L++ L K
Sbjct: 71  IRWLPTIFVNGTKWGTEADLRRLDKEGKLVDELKK 105

>Suva_5.308 Chr5 complement(506262..506996) [735 bp, 244 aa] {ON}
           YER174C (REAL)
          Length = 244

 Score = 32.3 bits (72), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 63/128 (49%), Gaps = 16/128 (12%)

Query: 95  VNSGSGASKDN-----SISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVF-----S 144
           +++GS +  +N     S S    SGS D    E E +     + ++  +PV++F     S
Sbjct: 108 LSNGSASISNNANGPKSTSDVENSGSSDNEEEETEEEINARLAKLVQAAPVMLFMKGSPS 167

Query: 145 KSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGKS 204
           +  C +S +L  +L +E+ I   +  I  D +     +++ ++K +   T P L ING+ 
Sbjct: 168 EPKCGFSRQLVGIL-REHQIRFGFFDILRDDN-----VRQSLKKFSDWPTFPQLYINGEF 221

Query: 205 RGGFDDIK 212
           +GG D IK
Sbjct: 222 QGGLDIIK 229

>Ecym_1187 Chr1 (384530..384949) [420 bp, 139 aa] {ON} similar to
           Ashbya gossypii ADR053W
          Length = 139

 Score = 31.6 bits (70), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 16/101 (15%)

Query: 135 LGISPVIVFSKSF-----CPYSSRLKELLTKEYTITPS----YVVIELDKHKHGVALQKF 185
           +G +PV++F K       C +S    ++L ++  + PS    Y V+E  + + G      
Sbjct: 37  IGSAPVVLFMKGTPEFPQCGFSRASIQILGQQ-GVDPSKFAAYNVLEHPELREG------ 89

Query: 186 IEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNK 226
           I++ +   T+P L IN +  GG D +  +   GEL E L K
Sbjct: 90  IKEYSEWPTIPQLYINKEFIGGCDILTNMAQSGELAELLEK 130

>Skud_5.313 Chr5 complement(523537..524271) [735 bp, 244 aa] {ON}
           YER174C (REAL)
          Length = 244

 Score = 32.3 bits (72), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 55/112 (49%), Gaps = 11/112 (9%)

Query: 106 SISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVF-----SKSFCPYSSRLKELLTK 160
           S S    SGS D    E E +     + ++  +PV++F     S+  C +S +L  +L +
Sbjct: 124 STSDMENSGSSDDEEEETEEEINARLAKLVQAAPVMLFMKGSPSEPKCGFSRQLVGIL-R 182

Query: 161 EYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIK 212
           E+ I   +  I  D +     +++ ++K +   T P L ING+ +GG D IK
Sbjct: 183 EHQIRFGFFDILRDDN-----VRQSLKKFSDWPTFPQLYINGEFQGGLDIIK 229

>TBLA0H03500 Chr8 complement(857008..857457) [450 bp, 149 aa] {ON}
           Anc_8.519 YPL059W
          Length = 149

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 19/111 (17%)

Query: 135 LGISPVIVFSKSF-----CPYSSRLKELLTKEYTITPS----YVVIELDKHKHGVALQKF 185
           +G +PV++F K       C +S     LL ++  + P+    + V+E  + ++G      
Sbjct: 43  IGTAPVVLFMKGTPEFPQCGFSRATISLLGQQ-GVDPAKFAAFNVLEDPELRNG------ 95

Query: 186 IEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQ 236
           I++ T   T+P L +N +  GG D I  +   GEL + L    D D  V +
Sbjct: 96  IKEYTEWPTIPQLFVNKEFVGGCDIITNMSQSGELAKLLE---DADVLVPE 143

>KAFR0A02360 Chr1 (488402..489112) [711 bp, 236 aa] {ON} Anc_8.240
           YDR098C
          Length = 236

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 11/90 (12%)

Query: 128 AKEYSMILGISPVIVF-----SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVAL 182
           A   S ++  +PV++F     S+  C +S ++  +L +E+ +   +  I  D      A+
Sbjct: 137 ADRLSKLVKAAPVMLFMKGNPSEPKCGFSRQIVGIL-REHQVRFGFFDILKDD-----AI 190

Query: 183 QKFIEKKTGRATVPNLMINGKSRGGFDDIK 212
           ++ ++K +   T P L ING+ +GG D IK
Sbjct: 191 RQSMKKFSDWPTFPQLYINGEFQGGLDIIK 220

>YER174C Chr5 complement(538434..539168) [735 bp, 244 aa] {ON}
           GRX4Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase; monothiol
           glutaredoxin subfamily member along with Grx3p and
           Grx5p; protects cells from oxidative damage; mutant has
           increased aneuploidy tolerance; transcription is
           regulated by Yap5
          Length = 244

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 11/80 (13%)

Query: 138 SPVIVF-----SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGR 192
           +PV++F     S+  C +S +L  +L +E+ I   +  I  D++    +L+KF    +  
Sbjct: 156 APVMLFMKGSPSEPKCGFSRQLVGIL-REHQIRFGFFDILRDENVRQ-SLKKF----SDW 209

Query: 193 ATVPNLMINGKSRGGFDDIK 212
            T P L ING+ +GG D IK
Sbjct: 210 PTFPQLYINGEFQGGLDIIK 229

>Skud_4.356 Chr4 complement(621126..621881,621915..621947) [789 bp,
           262 aa] {ON} YDR098C (REAL)
          Length = 262

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 45/84 (53%), Gaps = 11/84 (13%)

Query: 134 ILGISPVIVF-----SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEK 188
           ++  +PV++F     S+  C +S +L  +L +E+ +   +  I  D      ++++ ++K
Sbjct: 169 LVNAAPVMLFMKGSPSEPKCGFSRQLVGIL-REHQVRFGFFDILRDD-----SVRQHLKK 222

Query: 189 KTGRATVPNLMINGKSRGGFDDIK 212
            +   T P L ING+ +GG D IK
Sbjct: 223 FSEWPTFPQLYINGEFQGGLDIIK 246

>NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519
          Length = 139

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 180 VALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGEL 220
           V L+  I++ T   T+P L +NG+  GG D I ++   G+L
Sbjct: 82  VELRDGIKEYTDWPTIPQLFVNGEFIGGCDVIVSMSKNGDL 122

>YLR364W Chr12 (854062..854391) [330 bp, 109 aa] {ON}
           GRX8Glutaredoxin that employs a dithiol mechanism of
           catalysis; monomeric; activity is low and null mutation
           does not affect sensitivity to oxidative stress;
           GFP-fusion protein localizes to the cytoplasm;
           expression strongly induced by arsenic
          Length = 109

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 38/94 (40%), Gaps = 11/94 (11%)

Query: 139 PVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIEL------DKHKHGVALQKFIEKKTGR 192
           P    S S+CP       +  K   +     V ++      ++ K  +A QK +    G 
Sbjct: 16  PYFQLSASWCPDCVYANSIWNK-LNVQDKVFVFDIGSLPRNEQEKWRIAFQKVV----GS 70

Query: 193 ATVPNLMINGKSRGGFDDIKALHSKGELLESLNK 226
             +P +++NGK  G    +    +KG L E L K
Sbjct: 71  RNLPTIVVNGKFWGTESQLHRFEAKGTLEEELTK 104

>KLLA0C17842g Chr3 complement(1588951..1589745) [795 bp, 264 aa]
           {ON} similar to uniprot|Q03835 Saccharomyces cerevisiae
           YDR098C GRX3 Hydroperoxide and superoxide-radical
           responsive glutathione-dependent oxidoreductase
           monothiol glutaredoxin subfamily member along with Grx4p
           and Grx5p protects cells from oxidative damage
          Length = 264

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 11/80 (13%)

Query: 138 SPVIVFSKSF-----CPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGR 192
           +PV++F K       C +S ++  +L +E+ I   +  I  D++     +++ ++K +  
Sbjct: 175 APVMLFMKGTPSEPKCGFSRQMVGIL-REHQIRFGFFDILKDEN-----VRQGLKKFSDW 228

Query: 193 ATVPNLMINGKSRGGFDDIK 212
            T P L ING+ +GG D IK
Sbjct: 229 PTFPQLYINGEFQGGLDIIK 248

>Smik_5.346 Chr5 complement(538041..538775) [735 bp, 244 aa] {ON}
           YER174C (REAL)
          Length = 244

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 11/80 (13%)

Query: 138 SPVIVF-----SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGR 192
           +PV++F     S+  C +S +L  +L +E+ I   +  I  D +     +++ ++K +  
Sbjct: 156 APVMLFMKGSPSEPKCGFSRQLVGIL-REHQIRFGFFDILRDDN-----VRQSLKKFSDW 209

Query: 193 ATVPNLMINGKSRGGFDDIK 212
            T P L ING+ +GG D IK
Sbjct: 210 PTFPQLYINGEFQGGLDIIK 229

>Suva_2.257 Chr2 complement(443608..444366) [759 bp, 252 aa] {ON}
           YDR098C (REAL)
          Length = 252

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 45/84 (53%), Gaps = 11/84 (13%)

Query: 134 ILGISPVIVF-----SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEK 188
           ++  +PV++F     S+  C +S +L  +L +E+ +   +  I  D      A+++ ++K
Sbjct: 159 LVNAAPVMLFMKGSPSEPKCGFSRQLVGIL-REHEVRFGFFDILRDD-----AVRQNLKK 212

Query: 189 KTGRATVPNLMINGKSRGGFDDIK 212
            +   T P L ING+ +GG D IK
Sbjct: 213 FSEWPTFPQLYINGEFQGGLDIIK 236

>Kpol_1046.13 s1046 complement(27947..28687) [741 bp, 246 aa] {ON}
           complement(27947..28687) [741 nt, 247 aa]
          Length = 246

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 11/80 (13%)

Query: 138 SPVIVF-----SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGR 192
           +PV++F     S+  C +S ++  +L +       + +++ D  + G  L+KF    +  
Sbjct: 157 APVMLFMKGSPSEPKCGFSRQIVGILREHQVRFGFFDILKDDSVRQG--LKKF----SDW 210

Query: 193 ATVPNLMINGKSRGGFDDIK 212
            T P L ING+ +GG D IK
Sbjct: 211 PTFPQLYINGEFQGGLDIIK 230

>Smik_4.339 Chr4 complement(610713..611480,611484..611513) [798 bp,
           265 aa] {ON} YDR098C (REAL)
          Length = 265

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 46/84 (54%), Gaps = 11/84 (13%)

Query: 134 ILGISPVIVF-----SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEK 188
           ++  +PV++F     S+  C +S +L  +L +E+ +   +  I  D+     ++++ ++K
Sbjct: 172 LVNAAPVMLFMKGSPSEPKCGFSRQLVGIL-REHQVRFGFFDILRDE-----SVRQNLKK 225

Query: 189 KTGRATVPNLMINGKSRGGFDDIK 212
            +   T P L ING+ +GG D IK
Sbjct: 226 FSEWPTFPQLYINGEFQGGLDIIK 249

>YDR098C Chr4 complement(644178..645035) [858 bp, 285 aa] {ON}
           GRX3Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase; monothiol
           glutaredoxin subfamily member along with Grx4p and
           Grx5p; protects cells from oxidative damage; evidence
           exists indicating that the translation start site is not
           Met1 as currently annotated, but rather Met36
          Length = 285

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 46/84 (54%), Gaps = 11/84 (13%)

Query: 134 ILGISPVIVF-----SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEK 188
           ++  +PV++F     S+  C +S +L  +L +E+ +   +  I  D+     ++++ ++K
Sbjct: 192 LVNAAPVMLFMKGSPSEPKCGFSRQLVGIL-REHQVRFGFFDILRDE-----SVRQNLKK 245

Query: 189 KTGRATVPNLMINGKSRGGFDDIK 212
            +   T P L ING+ +GG D IK
Sbjct: 246 FSEWPTFPQLYINGEFQGGLDIIK 269

>TBLA0A08230 Chr1 complement(2028254..2028580) [327 bp, 108 aa] {ON}
           Anc_4.211 YLR364W
          Length = 108

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 181 ALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESL 224
           AL+K I    G   +P++MI+GK  G   ++  L  KGEL E  
Sbjct: 63  ALKKII----GTGNLPSIMIDGKLWGTEKELHELEDKGELQEEF 102

>ZYRO0C13860g Chr3 complement(1092005..1092823) [819 bp, 272 aa]
           {ON} conserved hypothetical protein
          Length = 272

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 157 LLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHS 216
           +L   +T   + VV++LD +KHG+ +  F E+    +   ++  NG+ +G    I AL  
Sbjct: 108 VLMASHTPLSNIVVLKLDNYKHGIYIPNFYEESLCFSGDLHIDDNGELKG--LGIVALAG 165

Query: 217 KGELLESLNKWGDGDFTVKQ 236
           +G + + + K G+ +   ++
Sbjct: 166 QGPIYQMILKPGEKNLVARE 185

>NCAS0C02240 Chr3 (417174..417659) [486 bp, 161 aa] {ON} Anc_8.519
          Length = 161

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 182 LQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNK 226
           L++ I++ T   T+P L +  +  GG D I ++   GEL E L++
Sbjct: 92  LREAIKEFTEWPTIPQLFVENEFVGGCDVITSMARSGELAELLDE 136

>NDAI0J01510 Chr10 (348743..349480) [738 bp, 245 aa] {ON} Anc_8.240
          Length = 245

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 45/84 (53%), Gaps = 11/84 (13%)

Query: 134 ILGISPVIVF-----SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEK 188
           ++  +PV++F     S+  C +S ++  +L +E+ +   +  I  D      ++++ ++K
Sbjct: 152 LVNAAPVMLFMKGNPSEPKCGFSRQIVGIL-REHQVRFGFFDILRD-----TSVRESLKK 205

Query: 189 KTGRATVPNLMINGKSRGGFDDIK 212
            +   T P L ING+ +GG D IK
Sbjct: 206 FSDWPTFPQLYINGEFQGGLDIIK 229

>TBLA0F03860 Chr6 complement(955792..956541) [750 bp, 249 aa] {ON}
           Anc_8.240 YDR098C
          Length = 249

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 11/80 (13%)

Query: 138 SPVIVF-----SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGR 192
           +PV++F     S+  C +S ++  +L +       + +++ D  + G      ++K +  
Sbjct: 158 APVMLFMKGNPSEPKCGFSRQMVGILREHQVRFGFFDILKDDSIRQG------LKKYSDW 211

Query: 193 ATVPNLMINGKSRGGFDDIK 212
            T P L +NG+ +GG D IK
Sbjct: 212 PTFPQLYLNGEFQGGLDIIK 231

>CAGL0G08151g Chr7 complement(775053..775835) [783 bp, 260 aa] {ON}
           highly similar to uniprot|Q03835 Saccharomyces
           cerevisiae YDR098c GRX3 glutaredoxin protection against
           oxidative and osmotic stress
          Length = 260

 Score = 29.3 bits (64), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 134 ILGISPVIVF-----SKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEK 188
           ++  +PV++F     S+  C +S ++  +L +E+ I   +  I  D       ++  ++K
Sbjct: 165 LVNAAPVMLFMKGNPSEPKCGFSRQIVGIL-REHQIRFGFFDILRDD-----TVRTNLKK 218

Query: 189 KTGRATVPNLMINGKSRGGFDDIK 212
            +   T P L ING+ +GG D IK
Sbjct: 219 FSDWPTFPQLYINGEFQGGLDIIK 242

>KNAG0A02090 Chr1 (175247..175696) [450 bp, 149 aa] {ON} Anc_8.519
           YPL059W
          Length = 149

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 182 LQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNK 226
           L+  I++ +   T+P L +N +  GG D I ++   GEL + L +
Sbjct: 88  LRTAIKEFSDWPTIPQLYVNNEFVGGCDVITSMAKSGELADVLEE 132

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.127    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,851,322
Number of extensions: 1094874
Number of successful extensions: 5277
Number of sequences better than 10.0: 161
Number of HSP's gapped: 5289
Number of HSP's successfully gapped: 162
Length of query: 243
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 136
Effective length of database: 41,212,137
Effective search space: 5604850632
Effective search space used: 5604850632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 64 (29.3 bits)