Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D026305.438ON1021025354e-72
KNAG0C048805.438ON1041044513e-59
ZYRO0F10120g5.438ON105994411e-57
CAGL0A02882g5.438ON1041034332e-56
NCAS0F034105.438ON1061034142e-53
Kwal_55.214145.438ON1191034021e-51
SAKL0G02618g5.438ON1041043993e-51
Kpol_1016.35.438ON971033714e-47
NDAI0B057005.438ON1041043699e-47
KLTH0F15972g5.438ON1031033481e-43
KLLA0E02267g5.438ON1031043463e-43
Ecym_45095.438ON1031063273e-40
Kpol_1016.3asingletonON971033142e-38
ACL169W5.438ON1031043108e-38
TPHA0C00950singletonON991032595e-30
KAFR0D02490singletonON107951972e-20
TBLA0C05870singletonON1001041743e-17
KAFR0D02400singletonON114901651e-15
KAFR0D02500singletonON112901581e-14
Kwal_14.18516.104ON53559670.60
SAKL0B03850g4.164ON66447606.5
KNAG0J00120singletonON67472596.5
KNAG0H00110singletonON68972596.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D02630
         (102 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON...   210   4e-72
KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON...   178   3e-59
ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserv...   174   1e-57
CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly ...   171   2e-56
NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438     164   2e-53
Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {O...   159   1e-51
SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserv...   158   3e-51
Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON} co...   147   4e-47
NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5....   146   9e-47
KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa] ...   138   1e-43
KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserv...   137   3e-43
Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar ...   130   3e-40
Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON} c...   125   2e-38
ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No h...   124   8e-38
TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON}                104   5e-30
KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}      80   2e-20
TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {...    72   3e-17
KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON}                68   1e-15
KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}      65   1e-14
Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {O...    30   0.60 
SAKL0B03850g Chr2 (340435..342429) [1995 bp, 664 aa] {ON} weakly...    28   6.5  
KNAG0J00120 Chr10 complement(4248..6272) [2025 bp, 674 aa] {ON} ...    27   6.5  
KNAG0H00110 Chr8 complement(10805..12874) [2070 bp, 689 aa] {ON}...    27   6.6  

>TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON}
           Anc_5.438
          Length = 102

 Score =  210 bits (535), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%)

Query: 1   MVEWVVIVYDKGDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHLQI 60
           MVEWVVIVYDKGDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHLQI
Sbjct: 1   MVEWVVIVYDKGDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHLQI 60

Query: 61  VADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102
           VADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK
Sbjct: 61  VADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102

>KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON}
           Anc_5.438
          Length = 104

 Score =  178 bits (451), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 84/104 (80%), Positives = 92/104 (88%), Gaps = 2/104 (1%)

Query: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
           MVEW  +VYDK   DRS FRP HLA IP LV+QGKLVCAGAIYNEPTTPGG+RTFAGSHL
Sbjct: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60

Query: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102
           QIVADTKEEALEV+ GD+FAKEG+WDL NII+YQFGCAVR+ KK
Sbjct: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104

>ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON}
          conserved hypothetical protein
          Length = 105

 Score =  174 bits (441), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 79/99 (79%), Positives = 88/99 (88%)

Query: 1  MVEWVVIVYDKGDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHLQI 60
          MVEWVVI +DK DRSA+R  HLAGIPP VE GKLVCAGAIYNEP  PG  RTFAGSHLQ+
Sbjct: 1  MVEWVVIAFDKADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHLQV 60

Query: 61 VADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRK 99
          VADTKEEA+E+VK DIFAKEGVWDLDN+I+YQFGCA+R+
Sbjct: 61 VADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQ 99

>CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly
           similar to KLLA0E02266g Kluyveromyces lactis
          Length = 104

 Score =  171 bits (433), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 83/103 (80%), Positives = 88/103 (85%), Gaps = 2/103 (1%)

Query: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
           MVEW VIVYDK   DRS  RP HLAGIPPLVE GKLVCAGAIYNEP   GGERTFAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60

Query: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEK 101
           QIVADTKEEALE+V  D+FAK G+WDL+NIIIYQFGCAVR+ K
Sbjct: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103

>NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438
          Length = 106

 Score =  164 bits (414), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 80/103 (77%), Positives = 86/103 (83%), Gaps = 2/103 (1%)

Query: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
           MVEW VIVYDK   DRSAFRP HLA IP LVEQGKLVCAGAIYNEP + G   TFAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60

Query: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEK 101
           QI+ADTKEEAL +V  DIFAKEG+WD DNIIIY+FGCAVR+ K
Sbjct: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPK 103

>Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {ON}
           [contig 130] FULL
          Length = 119

 Score =  159 bits (402), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 78/103 (75%), Positives = 86/103 (83%), Gaps = 2/103 (1%)

Query: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
           MVEW VIVYDK   DRS FRPAHL GIP LVE+GKLVCAGAIY + +  G    FAGSHL
Sbjct: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75

Query: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEK 101
           QIVADTKEEALE+VKGD+FAKEG+WDL+NIIIY FGCAVR+ K
Sbjct: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118

>SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  158 bits (399), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 86/104 (82%), Gaps = 2/104 (1%)

Query: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
           MVEW V+VYDK   DRS FRPAHLAGIPPLVEQGKLVCAGAI+NE    G    FAGS L
Sbjct: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60

Query: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102
            IVAD+KEEAL VVK D+FAKEG+WDL+NI+I+ FGCAVRKEKK
Sbjct: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104

>Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON}
           complement(6319..6612) [294 nt, 98 aa]
          Length = 97

 Score =  147 bits (371), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 74/103 (71%), Positives = 84/103 (81%), Gaps = 8/103 (7%)

Query: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
           MVEW VI+ DK   DRS  RP HLAGIPPLVEQGKL CAGAIYN+      + +FAGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSELRPQHLAGIPPLVEQGKLKCAGAIYND------DGSFAGSHL 54

Query: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEK 101
           QIVADTKE+ALEVVKGD+FA  G+WDLD+IIIY+FGCAVR+ K
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIIIYKFGCAVRQPK 97

>NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5.438
          Length = 104

 Score =  146 bits (369), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 81/104 (77%), Gaps = 2/104 (1%)

Query: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
           MVEW VI+ DK   DRSAF   H AGIP LVEQGK+VC GAIYNEPT  GG  T AGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60

Query: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102
           Q+VADTKEE +E+VK DIFAKEG+WD+DN IIY+F  A+R  KK
Sbjct: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104

>KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa]
           {ON} conserved hypothetical protein
          Length = 103

 Score =  138 bits (348), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 70/103 (67%), Positives = 80/103 (77%), Gaps = 2/103 (1%)

Query: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
           MVEW VIV+DK   DRSA RPAHL G+    E+G LVCAGAIY+E    G    FAGSHL
Sbjct: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60

Query: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEK 101
           QI A+TKE+AL+VVK DIFAKEG+WDL+NIIIY FGCAVR+ K
Sbjct: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103

>KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserved
           hypothetical protein
          Length = 103

 Score =  137 bits (346), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (77%), Gaps = 3/104 (2%)

Query: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
           MVEWVVIVYDK   DRSA RP HLAGIPPLVE GK+V AGAIY +    G    FAGSHL
Sbjct: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKD-VVDGKPANFAGSHL 59

Query: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102
            IVAD+K+E +E++K D+FAK  +WD+DN +IY FGCAVRKEK+
Sbjct: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103

>Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii ACL169W
          Length = 103

 Score =  130 bits (327), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 7/106 (6%)

Query: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPT--TPGGERTFAGS 56
           MVEW V VYDK   DRS +R  HL  IP LV++GK+V AGAIY +     PGG   FAGS
Sbjct: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGG---FAGS 57

Query: 57  HLQIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102
           HL +VADT+EE +E++KGDI+AKEGVWD+DNI+I+ FGCAVRKEK+
Sbjct: 58  HLILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103

>Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON}
           complement(7088..7381) [294 nt, 98 aa]
          Length = 97

 Score =  125 bits (314), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (72%), Gaps = 8/103 (7%)

Query: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
           M EW +I+ DK   +RS     H AGI PLVEQG L C GAIYN+      + + AGSHL
Sbjct: 1   MSEWCIIINDKKGSNRSELLSQHFAGISPLVEQGILTCGGAIYND------DGSVAGSHL 54

Query: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEK 101
           QIVADTKE+ALEVVKGD+FA  G+WDLD+I+IY+F CAVR+ K
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIVIYKFACAVRQPK 97

>ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No
           homolog in Saccharomyces cerevisiae
          Length = 103

 Score =  124 bits (310), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 76/104 (73%), Gaps = 3/104 (2%)

Query: 1   MVEWVVIVYDKG--DRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
           MVEW  I+YDK   DRS  R  HLA IP LVEQGKLV AGAIY E    G    FAGS L
Sbjct: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKE-VVDGRPSQFAGSQL 59

Query: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102
            +VAD++EEAL +++ D FAK GVWD++N+++Y FGCAVRKEK+
Sbjct: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103

>TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON} 
          Length = 99

 Score =  104 bits (259), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 69/103 (66%), Gaps = 10/103 (9%)

Query: 1  MVEWVVIVYDKGDRSAFR----PAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGS 56
          M E+VV++ D       R    P H   IPPLV+ G +VC GA++NE  +P       GS
Sbjct: 1  MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAMFNEEGSP------VGS 54

Query: 57 HLQIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRK 99
          H+QIVAD++E+ LE++K D+FA+E VWDL++ IIY+F CAVRK
Sbjct: 55 HIQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRK 97

>KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}
          
          Length = 107

 Score = 80.5 bits (197), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%), Gaps = 8/95 (8%)

Query: 1  MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
          M EW+V V DK   DR+ +   HLA +P L E+  LV AGA+       G      GS  
Sbjct: 1  MPEWIVNVQDKPEADRAPYNDRHLAALPGLFEKKVLVSAGALI------GDNGKEVGSSF 54

Query: 59 QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQF 93
          Q+VA++KE+A+ V+K DIFAKEGV++LD+ + Y+F
Sbjct: 55 QVVAESKEDAINVIKNDIFAKEGVYNLDSFVCYRF 89

>TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {ON}
           
          Length = 100

 Score = 71.6 bits (174), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 8/104 (7%)

Query: 1   MVEWVVIVYD--KGDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
           M EW V + D    DR+     H+  +P L+  G L C GA+ ++           GSH 
Sbjct: 1   MTEWYVTIKDIPNSDRTPVLKEHMDRLPILINAGVLSCGGALLDD------NGNMIGSHF 54

Query: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102
           ++  +TKEEA++++  D F K GVWD+++I I +F C  R+E K
Sbjct: 55  ELKVETKEEAMKLINEDPFVKGGVWDMNSIQIRKFYCVHREEYK 98

>KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON} 
          Length = 114

 Score = 68.2 bits (165), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 58/90 (64%), Gaps = 8/90 (8%)

Query: 1  MVEWVVIVYDKGD--RSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
          M EW+V V D  D  R+ + P H+  +P LV+ G +V AGA+    TTP G+    G   
Sbjct: 1  MPEWLVKVKDNKDVDRAPYYPEHMRDLPSLVDGGIIVVAGAL----TTPEGKEI--GGMF 54

Query: 59 QIVADTKEEALEVVKGDIFAKEGVWDLDNI 88
           + A TKEEA+E+VK D+FA++G++++D++
Sbjct: 55 IVTAKTKEEAIEIVKRDVFARKGIFNMDSV 84

>KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}
          
          Length = 112

 Score = 65.5 bits (158), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 8/90 (8%)

Query: 1  MVEWVVIVYD--KGDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58
          M EW+V + D    DR+ + P H+  +  L ++  LV AGA+    TTP G+ T  G  L
Sbjct: 1  MPEWLVKIEDIEGADRTPYYPEHMQNLKNLFDEKILVGAGAL----TTPEGKET--GGIL 54

Query: 59 QIVADTKEEALEVVKGDIFAKEGVWDLDNI 88
           I A TKEEA+EVVK D+FA++G++ +D I
Sbjct: 55 IIAAKTKEEAIEVVKRDVFARKGIFKMDTI 84

>Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {ON}
           YBR212W (NGR1) - negative growth regulatory protein
           [contig 235] FULL
          Length = 535

 Score = 30.4 bits (67), Expect = 0.60,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 6/59 (10%)

Query: 2   VEWVVIVYDKGDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERT-FAGSHLQ 59
           + W     D G  SA     +  +P  +    L  A  ++N+P  PG   + FA SHLQ
Sbjct: 463 LSWGRTSADTGRHSA-----MQDMPSCLPAANLNRAATVWNQPAAPGSTNSMFASSHLQ 516

>SAKL0B03850g Chr2 (340435..342429) [1995 bp, 664 aa] {ON} weakly
           similar to uniprot|P32499 Saccharomyces cerevisiae
           YLR335W NUP2 Protein involved in nucleocytoplasmic
           transport binds to either the nucleoplasmic or
           cytoplasmic faces of the nuclear pore complex depending
           on Ran-GTP levels also has a role in chromatin
           organization
          Length = 664

 Score = 27.7 bits (60), Expect = 6.5,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 23/47 (48%)

Query: 40  IYNEPTTPGGERTFAGSHLQIVADTKEEALEVVKGDIFAKEGVWDLD 86
           I ++PTT G   +FA    + VAD+  E+   +KG  F   G    D
Sbjct: 235 ISSKPTTEGSAFSFASKKKREVADSDSESEVEIKGPQFKFSGTVSSD 281

>KNAG0J00120 Chr10 complement(4248..6272) [2025 bp, 674 aa] {ON}
          possible pseudogene; NNN added to avoid internal stop
          codon
          Length = 674

 Score = 27.3 bits (59), Expect = 6.5,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 25 IPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHLQIVADTKEEALEVVKGDIFAKEGVWD 84
          +P ++ Q   V  G I  + TT  G+R F+G+    V   K   L +  G    K+ +  
Sbjct: 16 LPTVLAQA--VSNGMIVTDNTTLSGDRVFSGT----VTIEKGATLTLTDGRFMFKKDLNV 69

Query: 85 LDNIIIYQFGCA 96
            N+++Y   C 
Sbjct: 70 YGNLVVYSNNCG 81

>KNAG0H00110 Chr8 complement(10805..12874) [2070 bp, 689 aa] {ON} 
          possible pseudogene; NNN added to avoid internal stop
          codon
          Length = 689

 Score = 27.3 bits (59), Expect = 6.6,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 25 IPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHLQIVADTKEEALEVVKGDIFAKEGVWD 84
          +P ++ Q   V  G I  + TT  G+R F+G+    V   K   L +  G    K+ +  
Sbjct: 16 LPTVLAQA--VSNGMIVTDNTTLSGDRVFSGT----VTIEKGATLTLTDGRFMFKKDLNV 69

Query: 85 LDNIIIYQFGCA 96
            N+++Y   C 
Sbjct: 70 YGNLVVYSNNCG 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.139    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,824,767
Number of extensions: 385402
Number of successful extensions: 678
Number of sequences better than 10.0: 24
Number of HSP's gapped: 657
Number of HSP's successfully gapped: 24
Length of query: 102
Length of database: 53,481,399
Length adjustment: 73
Effective length of query: 29
Effective length of database: 45,110,781
Effective search space: 1308212649
Effective search space used: 1308212649
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)