Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D026205.439ON1261266645e-91
CAGL0I01078g5.439ON1261266282e-85
NDAI0C015805.439ON1261266263e-85
Smik_15.2995.439ON1261266179e-84
YOR122C (PFY1)5.439ON1261266179e-84
Skud_15.2845.439ON1261266152e-83
Suva_8.1745.439ON1261266108e-83
SAKL0G02640g5.439ON1261266108e-83
KNAG0B042205.439ON1261266091e-82
KAFR0D050405.439ON1261265994e-81
NCAS0H020705.439ON1261265925e-80
Kpol_1062.275.439ON1261265925e-80
TPHA0E017405.439ON1261265856e-79
Ecym_45105.439ON1261265822e-78
KLTH0F15950g5.439ON1261265804e-78
ACL168C5.439ON1261265779e-78
KLLA0E02289g5.439ON1261265743e-77
ZYRO0F10142g5.439ON1261265596e-75
TBLA0A065005.439ON1191265578e-75
Kwal_55.214135.439ON58582761e-32
ZYRO0F02574g8.17ON63058642.7
NCAS0C035703.163ON87645624.6
YMR041C (ARA2)2.604ON33571625.0
Kpol_2001.31.251ON164385625.7
Kpol_1072.118.683ON109460616.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D02620
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   260   5e-91
CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   246   2e-85
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   245   3e-85
Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   242   9e-84
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   242   9e-84
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   241   2e-83
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   239   8e-83
SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   239   8e-83
KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   239   1e-82
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   235   4e-81
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   232   5e-80
Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   232   5e-80
TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   229   6e-79
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   228   2e-78
KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   228   4e-78
ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   226   9e-78
KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   225   3e-77
ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   219   6e-75
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   219   8e-75
Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   110   1e-32
ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} simila...    29   2.7  
NCAS0C03570 Chr3 complement(712859..715489) [2631 bp, 876 aa] {O...    28   4.6  
YMR041C Chr13 complement(350966..351973) [1008 bp, 335 aa] {ON} ...    28   5.0  
Kpol_2001.3 s2001 complement(8876..10429,10432..13809) [4932 bp,...    28   5.7  
Kpol_1072.11 s1072 (20737..24021) [3285 bp, 1094 aa] {ON} (20737...    28   6.7  

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  260 bits (664), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  246 bits (628), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 122/126 (96%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNLL TGKVDKAVIYS+AGD++WA+SGGL+LQANEI EI QGFD+P GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT+LIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  245 bits (626), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNLL TGKVDKAVIYSRAGDS+WA+SGG  LQANEI EI QGFD+P GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT+L+AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  242 bits (617), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 113/126 (89%), Positives = 121/126 (96%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNL+GTGKVDKAVIYSRAGD++WA+SGGL+LQ NEI EI QGFD+P GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT++IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  242 bits (617), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 113/126 (89%), Positives = 121/126 (96%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNL+GTGKVDKAVIYSRAGD++WA+SGGL+LQ NEI EI QGFD+P GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT++IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  241 bits (615), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 121/126 (96%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNL+GTGKVDKAVIYSRAGD+IWA+SGGL+LQ NEI E+ QGFD+P GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAIWATSGGLSLQPNEISEVVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGV+CVRTKQT++I+HYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  239 bits (610), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 121/126 (96%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNL+GTGKVDKAVI+SRAGD+IWA+SGGL+LQ NEI EI QGFD+P GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIFSRAGDAIWATSGGLSLQPNEIGEIVQGFDNPGGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGV+CVRTKQT++IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  239 bits (610), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNLLGTGKVDKA+IYSRAGD+IWA+SGGL LQ  EI EIAQGFD+P GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGVVCVRTKQTILIAHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  239 bits (609), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNLLGTGKVDKAVIYSRAGDS+WA+SGGLTLQ NEI  I  GFD+  GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQTIL+AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  235 bits (599), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNLL T KVD+AVIYSRAGD+ WA+SGG+ LQ NEI EIAQGFD+  GLQSNG
Sbjct: 1   MSWQAYTDNLLATNKVDRAVIYSRAGDAAWATSGGMALQPNEIAEIAQGFDNAAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTI+IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  232 bits (592), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQA TDNLL TGKVD+AV+YSRAGDS+WA+SGGL LQ NEI EIA+GFD+P GLQSNG
Sbjct: 1   MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFMLLRADD+SIYGRHDAEG+VCVRT QTILIAHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV+Y
Sbjct: 121 LISVKY 126

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  232 bits (592), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNLL TGK+DKAV+YSRAGD++WASSGGL L A EI  IAQGFD P  LQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGVVCVRTKQTIL+AHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  229 bits (585), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNLL TGKVDKA +YSRAGD+ WA+SGGL+L A E  EIA+GFD P GLQ+ G
Sbjct: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTI+IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  228 bits (582), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 107/126 (84%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNL+ TGKVDKA+IYSRAGD+IWASSGG++L+ANEI EI+QGFD+  GLQSNG
Sbjct: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG++ VRTKQTILIAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  228 bits (580), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNLLGTGK+DKA IYSRAGDS+WA+SGGL+L  NEI EIAQGF++P GLQS G
Sbjct: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGV+CVRTKQTIL+ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV Y
Sbjct: 121 LISVSY 126

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  226 bits (577), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNLL TGKVDKA IYSRAGD+IWASSGGL L+ +EI+EI+QGFD+  GLQ+NG
Sbjct: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGVV VRTKQTILIAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  225 bits (574), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYTDNLL TGK+DK+VIYSRAGD++WASSGGL LQ  EI EIA+GFD+P GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFML++ADDRSIYGRH+AEG+V VRTKQTILI HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  219 bits (559), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 111/126 (88%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQAYT+NLLGTGK+DKA IYSRAGDS+WASSGGLT    EI +IA GFD P GLQS G
Sbjct: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQTI++AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI  QY
Sbjct: 121 LIGAQY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  219 bits (557), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 107/126 (84%), Positives = 113/126 (89%), Gaps = 7/126 (5%)

Query: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60
           MSWQA       TGKVDKAVIYSRAGDS+WASSGGL L ANEI EIA+GFD+P GLQSNG
Sbjct: 1   MSWQA-------TGKVDKAVIYSRAGDSVWASSGGLQLGANEIAEIARGFDNPSGLQSNG 53

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120
           LH+Q QKFMLLRADDRSIYGRHDAEG+VCVRTKQTI+IAHYPPTVQAGEATKIVEQLADY
Sbjct: 54  LHVQSQKFMLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADY 113

Query: 121 LISVQY 126
           LI VQY
Sbjct: 114 LIGVQY 119

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
           (PFY1) - profilin (actin-binding protein) [contig 130]
           FULL
          Length = 58

 Score =  110 bits (276), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 54/58 (93%)

Query: 69  MLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADYLISVQY 126
           ML+RADDRSIYGRHDAEGVVCVRTKQTIL+ HYP  VQAGEATKIVEQLADYLISV Y
Sbjct: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

>ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} similar
           to uniprot|P43561 Saccharomyces cerevisiae YFL041W
          Length = 630

 Score = 29.3 bits (64), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 38  LQANEIQEIA--QGFDSPVGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTK 93
           LQ     ++A  +G+D P  +   GL    ++F L   D+R +Y  +D +    VR K
Sbjct: 294 LQLQWTHQVAYDKGYDWPKTIDVGGLENAAEEFYLQPLDNRELYDDYDVQITFDVRMK 351

>NCAS0C03570 Chr3 complement(712859..715489) [2631 bp, 876 aa] {ON}
           Anc_3.163 YOL063C
          Length = 876

 Score = 28.5 bits (62), Expect = 4.6,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 11  LGTGKVDKAVIYSRAGD-SIWASSGGLTLQANEIQEIAQGFDSPV 54
           L +G + + ++ S   D S WA  GGLT+Q  +  +I    +SP+
Sbjct: 590 LASGILKELLLESDTEDMSFWAKLGGLTMQEAQDDDITPFINSPI 634

>YMR041C Chr13 complement(350966..351973) [1008 bp, 335 aa] {ON}
           ARA2NAD-dependent arabinose dehydrogenase, involved in
           biosynthesis of dehydro-D-arabinono-1,4-lactone; similar
           to plant L-galactose dehydrogenase
          Length = 335

 Score = 28.5 bits (62), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 33/71 (46%)

Query: 15  KVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNGLHIQGQKFMLLRAD 74
            VD A + +R   S W   G + L  + ++E+    D+   ++SNG  +  +   L+   
Sbjct: 253 NVDLADLATRYAISEWVGKGPVVLGVSSMEELKLALDNYEIVKSNGNRLSSKDGQLVEYI 312

Query: 75  DRSIYGRHDAE 85
            ++I+  H  E
Sbjct: 313 QKNIFKEHFNE 323

>Kpol_2001.3 s2001 complement(8876..10429,10432..13809) [4932 bp, 1643
            aa] {ON} complement(8876..10429,10432..13809) [4932 nt,
            1644 aa]
          Length = 1643

 Score = 28.5 bits (62), Expect = 5.7,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 9/85 (10%)

Query: 6    YTDN--LLGTGKVDKAVIYSRAGDSIW-----ASSGGLTLQANEIQEIAQGFDSPVGL-Q 57
            Y +N   + T K D  VI ++ GD+I      A+S G   +A  I  +  GFDSP+   +
Sbjct: 933  YIENQFFITTSKWDGVVIENKIGDAIIDRIIRANSEGKVWKAFIIIPLMPGFDSPIDQPE 992

Query: 58   SNGLHIQGQ-KFMLLRADDRSIYGR 81
            ++ L I  Q ++  +   + SI+ R
Sbjct: 993  ASSLRIIMQCQYQSISRGETSIFAR 1017

>Kpol_1072.11 s1072 (20737..24021) [3285 bp, 1094 aa] {ON}
          (20737..24021) [3285 nt, 1095 aa]
          Length = 1094

 Score = 28.1 bits (61), Expect = 6.7,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 6/60 (10%)

Query: 10 LLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNGLHIQGQKFM 69
          L  TG+ D  +   +    IWA      + A  I       D P+ + S  LH +  KFM
Sbjct: 12 LENTGRRDALIAIEKKYQKIWAEEHQFEIDAPSID------DEPITMDSEELHAKYPKFM 65

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,363,829
Number of extensions: 414901
Number of successful extensions: 809
Number of sequences better than 10.0: 29
Number of HSP's gapped: 809
Number of HSP's successfully gapped: 29
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)