Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D026105.440ON44044017500.0
ZYRO0F10164g5.440ON4234139081e-118
Skud_15.2855.440ON4873689071e-117
YOR123C (LEO1)5.440ON4643719021e-117
Smik_15.3005.440ON4633708971e-116
Suva_8.1755.440ON4533678941e-116
NDAI0C015905.440ON4702208611e-111
NCAS0H020805.440ON4352628491e-109
SAKL0G02662g5.440ON4793038311e-106
KAFR0D050505.440ON4192148191e-105
CAGL0K10230g5.440ON4462158101e-103
Kpol_1062.265.440ON4572207991e-101
KNAG0B042105.440ON4632227911e-100
TPHA0E017305.440ON4692277852e-99
KLLA0E02311g5.440ON4172777784e-99
Ecym_45115.440ON4612247233e-90
Kwal_55.214085.440ON4362127187e-90
TBLA0A064905.440ON4282237179e-90
KLTH0F15928g5.440ON4232607151e-89
ACL167C5.440ON4392227065e-88
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D02610
         (440 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   678   0.0  
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   354   e-118
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   353   e-117
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   352   e-117
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   350   e-116
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   348   e-116
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   336   e-111
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   331   e-109
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   324   e-106
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   320   e-105
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   316   e-103
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   312   e-101
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   309   e-100
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   306   2e-99
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   304   4e-99
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   283   3e-90
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   281   7e-90
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   280   9e-90
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   280   1e-89
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   276   5e-88

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/440 (78%), Positives = 346/440 (78%)

Query: 1   MSEEVEDRVESGQNSTVEPVEEPINGNAGEIEDSGGDDEMDDLFGDEGQAXXXXXXXXXX 60
           MSEEVEDRVESGQNSTVEPVEEPINGNAGEIEDSGGDDEMDDLFGDEGQA          
Sbjct: 1   MSEEVEDRVESGQNSTVEPVEEPINGNAGEIEDSGGDDEMDDLFGDEGQASDRGSDEEEG 60

Query: 61  XXXXXXXXXXXXXXXMQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVR 120
                          MQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVR
Sbjct: 61  GSSNSDEEESSRRGEMQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVR 120

Query: 121 HIVPYKTVGEGADEKSTIYYAKVPEFLTIDPVPFDPPSFESKVKERLNSSSREDQLGDRL 180
           HIVPYKTVGEGADEKSTIYYAKVPEFLTIDPVPFDPPSFESKVKERLNSSSREDQLGDRL
Sbjct: 121 HIVPYKTVGEGADEKSTIYYAKVPEFLTIDPVPFDPPSFESKVKERLNSSSREDQLGDRL 180

Query: 181 IDENTIRWRYSRDENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHD 240
           IDENTIRWRYSRDENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHD
Sbjct: 181 IDENTIRWRYSRDENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHD 240

Query: 241 EQELMQCSQGGEVTKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPXXXX 300
           EQELMQCSQGGEVTKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDP    
Sbjct: 241 EQELMQCSQGGEVTKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEK 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXIESRNSPDISTGLNGYRKTPVTASDEQDSYYGSSKRNXX 360
                                IESRNSPDISTGLNGYRKTPVTASDEQDSYYGSSKRN  
Sbjct: 301 NELEKKQQQVVRERRKRQLKEIESRNSPDISTGLNGYRKTPVTASDEQDSYYGSSKRNEY 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLRQLKRQGTERYTEPEP 420
                                                     RLRQLKRQGTERYTEPEP
Sbjct: 361 EQDDFLVDDDEEEEAGYSEEDDVLDDNNDDQEAEDEEDAKAERLRQLKRQGTERYTEPEP 420

Query: 421 ESDPSTKRRKVAIIDDEDDE 440
           ESDPSTKRRKVAIIDDEDDE
Sbjct: 421 ESDPSTKRRKVAIIDDEDDE 440

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  354 bits (908), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/413 (50%), Positives = 247/413 (59%), Gaps = 29/413 (7%)

Query: 32  EDSGGDDEMDDLFGDEGQAXXXXXXXXXXXXXXXXXXXXXXXXXMQMDDEEAQEHAMYTR 91
           E SG  DEM+DLFG++ +                           +MDDEEA+EHAMYTR
Sbjct: 36  EKSGSQDEMEDLFGED-EGEDEEDEKRKGSEDENDEGEVTLRHRQEMDDEEAEEHAMYTR 94

Query: 92  KFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAKVPEFLTIDP 151
           KFYGED D +SD+EE+     EE+VELVRHIVPY+   +G D K  +YYAK+PEFLTIDP
Sbjct: 95  KFYGEDVDRVSDEEEAQEF-REEDVELVRHIVPYRAT-QGTD-KPVLYYAKIPEFLTIDP 151

Query: 152 VPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDENQQVYKESNAQIVQWS 210
           VPFDPPSFE+ VKERL N +S+EDQLGDRLIDENT+RWRYSRD NQQV+KESNAQIVQWS
Sbjct: 152 VPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIVQWS 211

Query: 211 DGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPTSTNSKMHQ 270
           DG  SLKLG EYTDIL NDTDNTFFAVSHD+QELMQC +GGEVTK+LMFIPTST+S+MHQ
Sbjct: 212 DGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMHQ 271

Query: 271 KLTKAVIRRDQRQTKGPGVYFVNKDPXXXXXXXXXXXXXXXXXXXXXXXXXIESRNS--- 327
           KLTKAV+RRD +Q  GPG Y V KDP                         +ESR +   
Sbjct: 272 KLTKAVMRRDHKQAAGPGTYIVQKDPELERGELEKKQQQVVRERRRRQVKEMESREASGD 331

Query: 328 PDISTGLNGYRKTPVTASDEQDSYYGSSKRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 387
           PD        R+  ++A  E     G+ +RN                             
Sbjct: 332 PD--------RRAAISAEAEP---MGNIRRNEYEQDDFLVDDDDEEEYASGSGEEGEEEE 380

Query: 388 XXXXXXXXXXXXXXXRLRQLKRQGTERYTEPEPESDPSTKRRKVAIIDDEDDE 440
                          R  +LKR+G   Y E         KRR+VA+IDDE+DE
Sbjct: 381 EEDEGNVSDEGAERLR--RLKREGANNYEE--------RKRRRVAVIDDEEDE 423

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  353 bits (907), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 190/368 (51%), Positives = 235/368 (63%), Gaps = 12/368 (3%)

Query: 76  MQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKT-VGEGADE 134
           + +DD+EA+E AMYTRKFYGEDA++ SDQ+E+A+ F EEN+E+VRHI+P K  V E A  
Sbjct: 128 LGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETA-S 186

Query: 135 KSTIYYAKVPEFLTIDPVPFDPPSFESKVKER-LNSSSREDQLGDRLIDENTIRWRYSRD 193
            + I+YA++P FLTID VPFDPPSFE+KV ER +NS+S+EDQL DRLIDENT+RWRYSRD
Sbjct: 187 HNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRD 246

Query: 194 ENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEV 253
           ++Q V+KESN QIVQWSDG  SLK+G E TDILVNDT NTF  VSHD+QEL+QC +GGE+
Sbjct: 247 KDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEI 306

Query: 254 TKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPXXXXXXXXXXXXXXXXX 313
            K+LMFIPTSTNSK+HQKL+KAVIRR+QRQ KGPG Y VN DP                 
Sbjct: 307 KKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVLRD 366

Query: 314 XXXXXXXXIESRNSPDISTGLNGYRKTPVTASDEQDSYYGSSKRNXXXXXXXXXXXXXXX 373
                    E + SPD +    G+RK     S      YG S+RN               
Sbjct: 367 RRRRQLKEREKQESPDAAFET-GFRKQSSPTS------YGISRRN-EYEEDDFLVDDDEE 418

Query: 374 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLRQLKRQGTERYTEPEPESDPS-TKRRKVA 432
                                        RLR LKR+G   Y E E + D + TKRR+VA
Sbjct: 419 EEAGFDDGDDEEEEEEEEEEEEADQENAARLRNLKREGAAMYKEEEKDDDSNETKRRRVA 478

Query: 433 IIDDEDDE 440
           +I+D++DE
Sbjct: 479 VIEDDEDE 486

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  352 bits (902), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 192/371 (51%), Positives = 236/371 (63%), Gaps = 19/371 (5%)

Query: 76  MQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKT-VGEGADE 134
           + +DD+EA+E AMYTRKFYGEDA+N SDQ+E+ + F EENVELVRHI+P K  V E A  
Sbjct: 106 LGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASH 165

Query: 135 KSTIYYAKVPEFLTIDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRD 193
            + I+YA++P FLTIDP+PFDPPSFE+KV ER  NS+SREDQL DRLIDENT+RWRYSRD
Sbjct: 166 -NEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRD 224

Query: 194 ENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEV 253
           ++Q V+KESN QIVQWSDG  SLK+G E TDILVNDT NTF  VSHD+QEL+QC +GGE+
Sbjct: 225 KDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEI 284

Query: 254 TKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPXXXXXXXXXXXXXXXXX 313
            K+LMFIPTSTNSK+HQKL+KAVIRR+QRQ+KGPG Y V+ DP                 
Sbjct: 285 KKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQILRD 344

Query: 314 XXXXXXXXIESRNSPDISTGLNGYRK--TPVTASDEQDSYYGSSKRNXXXXXXXXXXXXX 371
                    E + SPD +    G+RK  +P T        YG+S+RN             
Sbjct: 345 RRRRQLKEKEKQESPDAAFET-GFRKQNSPTT--------YGASRRN---EYEEDDFLVD 392

Query: 372 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLRQLKRQGTERY--TEPEPESDPSTKRR 429
                                          RLR LKR+G   Y   E E +    TKRR
Sbjct: 393 DDEEEEAAFDDEEDDNEEEEEEEDADEENASRLRNLKREGAAMYREEEEEEKDRSETKRR 452

Query: 430 KVAIIDDEDDE 440
           +VA+I+D++DE
Sbjct: 453 RVAVIEDDEDE 463

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  350 bits (897), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 183/370 (49%), Positives = 231/370 (62%), Gaps = 12/370 (3%)

Query: 76  MQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEK 135
           + +DD+EA+E AMYTRKFYGED ++ SDQ+E+ + F EENVELVRHI+P K +       
Sbjct: 100 LGLDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASH 159

Query: 136 STIYYAKVPEFLTIDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDE 194
           + I+YA++P FLTIDPVPFDPPSFE+KV ER  NS+S+EDQL DRLIDENT+RWRYSRD+
Sbjct: 160 NEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDK 219

Query: 195 NQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVT 254
           +Q V+KESN QIVQWSDG  SLK+G E TDILVNDT NTF  VSHD+QEL+QC +GGE+ 
Sbjct: 220 DQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIK 279

Query: 255 KSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPXXXXXXXXXXXXXXXXXX 314
           K+LMFIPTSTNSK+HQKL+KAVIRR+QRQ KGPG Y V+ DP                  
Sbjct: 280 KTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQSQILRDR 339

Query: 315 XXXXXXXIESRNSPDISTGLNGYRKTPVTASDEQDSYYGSSKRNX----XXXXXXXXXXX 370
                   E + SPD +    G+RK     +      YG+S+RN                
Sbjct: 340 RRRQLKEKEKQESPDAAFE-TGFRKQSSPTA------YGTSRRNEYEEDDFLVDDDEEEE 392

Query: 371 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLRQLKRQGTERYTEPEPESDPSTKRRK 430
                                           RLR LK++G   Y + E E +  TKRR+
Sbjct: 393 AEFDDDDDNEEEEEEEEEEEEEEEDADEANAARLRSLKKEGAAMYRQEENEDNNETKRRR 452

Query: 431 VAIIDDEDDE 440
           VA+I+D+++E
Sbjct: 453 VAVIEDDEEE 462

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  348 bits (894), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 180/367 (49%), Positives = 231/367 (62%), Gaps = 14/367 (3%)

Query: 76  MQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEK 135
           + +DD+EA+E AMYTRKFYGEDA++ SDQ+E+ + F EENVELVRHI+P K         
Sbjct: 98  LGLDDDEAEEQAMYTRKFYGEDANDFSDQDEATHTFKEENVELVRHIIPSKANVNETASH 157

Query: 136 STIYYAKVPEFLTIDPVPFDPPSFESKVKERLNSS-SREDQLGDRLIDENTIRWRYSRDE 194
           + I+YA++P FLTIDP+PFDPPSFE+KV ER N+S S+EDQL DRLIDENT+RWRYSRD 
Sbjct: 158 NEIFYARIPNFLTIDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDENTVRWRYSRDN 217

Query: 195 NQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVT 254
           +Q V+KESN QIVQWSDG  SLK+G EYTDILVNDT NTF  VSHD+QELMQC +GGE+ 
Sbjct: 218 DQHVFKESNTQIVQWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQELMQCYEGGEIK 277

Query: 255 KSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPXXXXXXXXXXXXXXXXXX 314
           K+LMFIPTST+SK+HQKL+KAV+R++QRQ +GPG Y +N DP                  
Sbjct: 278 KTLMFIPTSTSSKIHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQSQILRDR 337

Query: 315 XXXXXXXIESRNSPDISTGLNGYRKTPVTASDEQDSYYGSSKRNXXXXXXXXXXXXXXXX 374
                   E + SPD+       +++  TA       YG+++RN                
Sbjct: 338 RKRQLKEKEKQESPDVGFETAFRKQSSPTA-------YGATRRN-----EYEEDDFLVDD 385

Query: 375 XXXXXXXXXXXXXXXXXXXXXXXXXXXXRLRQLKRQGTERYTEPEPESDPS-TKRRKVAI 433
                                       RLR LKR+G   Y E   + D + +KRR+VA+
Sbjct: 386 DEEEEAEFDDDDDNEEEEEEEADEDNAARLRNLKREGAAMYKEEGGDDDSNESKRRRVAV 445

Query: 434 IDDEDDE 440
           I+D++DE
Sbjct: 446 IEDDEDE 452

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  336 bits (861), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/220 (73%), Positives = 184/220 (83%), Gaps = 8/220 (3%)

Query: 78  MDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKST 137
           MDDEEA    MYTRKFYG D D  SD EE A+ F E NVE++RH+VPYKT  + AD  +T
Sbjct: 115 MDDEEA----MYTRKFYG-DTDKYSDNEEDAHDFKEANVEIIRHMVPYKTSSDQAD--TT 167

Query: 138 IYYAKVPEFLTIDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDENQ 196
           IYYAKVP FLTIDP+PFDP SFE+KVK+RL + SSREDQLGDRLIDENTIRWRYSRD+NQ
Sbjct: 168 IYYAKVPPFLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQNQ 227

Query: 197 QVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKS 256
           +V+KESNAQIVQWSDG  SLKLG EYTDILVNDTDNTF  VSHD+QELMQC  GGE+TK+
Sbjct: 228 RVFKESNAQIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKT 287

Query: 257 LMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDP 296
           +MFIPTSTNSK+HQ+L+KAV RR+QRQ  GPG   + KDP
Sbjct: 288 MMFIPTSTNSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDP 327

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (73%), Gaps = 5/42 (11%)

Query: 403 RLRQLKRQGTERYTEPEPESD---PSTKRRKVAII-DDEDDE 440
           RL+++K+ G + Y + E ESD    S+KRRKVA++ DDE+DE
Sbjct: 430 RLKEIKKGGAQEYADRE-ESDMEEGSSKRRKVAVLSDDEEDE 470

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  331 bits (849), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 197/262 (75%), Gaps = 12/262 (4%)

Query: 38  DEMDDLFGDEGQAXXXXXXXXXXXXXXXXXXXXXXXXXMQMDDEEAQEHAMYTRKFYGED 97
           D MDDLFGDE +                            +D+EE    AMYTRKFYG+D
Sbjct: 43  DGMDDLFGDEEE----EDENKSVDEQSEDDDIGSRPRRTDIDEEE----AMYTRKFYGDD 94

Query: 98  ADNM--SDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAKVPEFLTIDPVPFD 155
             N   SDQ+ + +HF EENVEL+RH+VPYKT  E  DE +T+YYAKVP FLTI+PVPFD
Sbjct: 95  DYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDE-TTVYYAKVPPFLTINPVPFD 153

Query: 156 PPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDENQQVYKESNAQIVQWSDGGL 214
           P +FES V++RL N SS+EDQLGDRLIDENT+RWRYSRD NQ+V+KESNAQIVQWSDG  
Sbjct: 154 PIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFKESNAQIVQWSDGSF 213

Query: 215 SLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPTSTNSKMHQKLTK 274
           SLKLG EYTDILVN+T+NTF AVSHD+QELMQC  GGE+TK+LMFIPTSTNSK+HQ+L+K
Sbjct: 214 SLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFIPTSTNSKIHQQLSK 273

Query: 275 AVIRRDQRQTKGPGVYFVNKDP 296
           AV RR+QR+  GPG   +N+DP
Sbjct: 274 AVTRRNQREHLGPGTMIINRDP 295

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  324 bits (831), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 163/303 (53%), Positives = 207/303 (68%), Gaps = 14/303 (4%)

Query: 6   EDRVESGQNSTVEP------VEEPINGNAG-----EIEDSGGDDEMDDLFGDEGQAXXXX 54
           ED  E+  N+ ++       +E PI   +G     + ++SG D+EMDDLFGD+       
Sbjct: 41  EDNSETKDNTAIQESDASAGLENPIREASGKDNEDDNDNSGEDEEMDDLFGDDSDNAGEG 100

Query: 55  XXXXXXXXXXXXXXXXXXXXXMQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEE 114
                                     EE +E AMY RKFYG+D DN SD E+S   F E 
Sbjct: 101 ELEGEEKEGKSPNHLSKSEANHGSYLEEDEEQAMYNRKFYGDDVDNDSDAEDSQREFKEA 160

Query: 115 NVELVRHIVPYKTVGEGADEKSTIYYAKVPEFLTIDPVPFDPPSFESKVKERLNS-SSRE 173
           +VE+ +HIVPYKT     D++  +YYAKVP+FLTIDPVPFDPPSF+  V+ RL   SS+E
Sbjct: 161 DVEIAKHIVPYKTTSNSQDKE--VYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKE 218

Query: 174 DQLGDRLIDENTIRWRYSRDENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNT 233
           DQL DRLIDENTIRWRYSRD  QQV+KESNAQI+QWSDG  SL+LG E++D+L+NDTDNT
Sbjct: 219 DQLDDRLIDENTIRWRYSRDSKQQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNT 278

Query: 234 FFAVSHDEQELMQCSQGGEVTKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVN 293
           F  VSH++QELMQC +GGE+TK++MFIPTST+SK+HQ+L+KAV+RR+QR+  GP  Y V 
Sbjct: 279 FLTVSHEQQELMQCVEGGEITKTMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVR 338

Query: 294 KDP 296
           KDP
Sbjct: 339 KDP 341

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (70%), Gaps = 3/41 (7%)

Query: 403 RLRQLKRQGTERYTEPEPESDPST---KRRKVAIIDDEDDE 440
           RLRQLKR+G  +Y + + ES       KRRK+A++DDE+++
Sbjct: 438 RLRQLKREGAAQYEQKDEESGSEESSHKRRKIAVLDDEEED 478

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  320 bits (819), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 154/214 (71%), Positives = 174/214 (81%), Gaps = 3/214 (1%)

Query: 84  QEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAKV 143
           +E AMY RKFYGE+  +MSD EE A  F E +VELVRH+VPYKT  E  D+K TIYY KV
Sbjct: 67  EEEAMYNRKFYGEEGSDMSDHEEEA-LFKEADVELVRHVVPYKTFPENEDDK-TIYYTKV 124

Query: 144 PEFLTIDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDENQQVYKES 202
           P FL+IDP+PFDPPSFE+KVKER  N SS EDQLGDRLIDENTIRWRYSRD  Q+V+KES
Sbjct: 125 PAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKES 184

Query: 203 NAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPT 262
           NAQIVQWSDG  SLKLG EYTDILVN TDNTF  VSHD+QELMQC  GG++ K+L+FIPT
Sbjct: 185 NAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPT 244

Query: 263 STNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDP 296
           STNSK+HQ+L+KA+ RRDQR   GPG   VN DP
Sbjct: 245 STNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDP 278

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  316 bits (810), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 175/215 (81%), Gaps = 3/215 (1%)

Query: 83  AQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAK 142
           A+E  MYTRKFYGEDA N SD +E  + F E NV+L+RHI+PYKT     +E   I+YAK
Sbjct: 106 AKEQEMYTRKFYGEDAVNYSDDDE-PHTFKESNVDLIRHIIPYKTRTTN-NEHDEIFYAK 163

Query: 143 VPEFLTIDPVPFDPPSFESKVKERLN-SSSREDQLGDRLIDENTIRWRYSRDENQQVYKE 201
           VP FLTIDPVPFDP +FE+ V ERL+ S+S+EDQLGDRLIDENTIRWRYSRD  Q V+KE
Sbjct: 164 VPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKE 223

Query: 202 SNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIP 261
           SNAQIVQWSDG  SLKLG EYTDI+VNDTDNTF  VSHD+QELMQC  GGE+TK++MFIP
Sbjct: 224 SNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIP 283

Query: 262 TSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDP 296
           TSTNSK+HQKL+KAV RR+ RQ  GPG Y + +DP
Sbjct: 284 TSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDP 318

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  312 bits (799), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 145/220 (65%), Positives = 177/220 (80%), Gaps = 1/220 (0%)

Query: 78  MDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKST 137
           +D++E +E AMYTRKFYGED  + SDQEE  + F EE+V L RH+VP K   E  D  +T
Sbjct: 85  VDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTT 144

Query: 138 IYYAKVPEFLTIDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDENQ 196
           IYYAKVP FLTIDP+PFDPP+FE+ V+ERL N  S+E+QL DRLID+NTIRWRYSRD+NQ
Sbjct: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204

Query: 197 QVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKS 256
           +V+KESNA IVQWSDG  SLKLG EYTDIL+NDTDNTF  VSHD+QELMQC  GGE++KS
Sbjct: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264

Query: 257 LMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDP 296
           L+F+P ST SK+HQ+L+KA++RR+  +T GP    VN DP
Sbjct: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDP 304

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 1/38 (2%)

Query: 403 RLRQLKRQGTERYTEPEPESDPSTKRRKVAII-DDEDD 439
           RLR+LKRQGT  Y + E     S KRRKVA+I DDEDD
Sbjct: 420 RLRELKRQGTAAYNDDEKSGSESPKRRKVAVIEDDEDD 457

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  309 bits (791), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 150/222 (67%), Positives = 174/222 (78%), Gaps = 6/222 (2%)

Query: 76  MQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEK 135
           + MD+EE     MY RKFYGED D MSD E++ + F E NVELV+HIVPYK V + A   
Sbjct: 94  LDMDEEEE----MYNRKFYGEDVD-MSDTEQAEHEFKEANVELVKHIVPYKLVPDDAIGT 148

Query: 136 STIYYAKVPEFLTIDPVPFDPPSFESKVKERLNSS-SREDQLGDRLIDENTIRWRYSRDE 194
           + IY AKVP FL IDP PFDP SFE KV +RL+ S S+ED+LGDRLIDENT+RWRYSRD 
Sbjct: 149 NDIYVAKVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDT 208

Query: 195 NQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVT 254
           NQ V+KESN QIVQWSDG  SLKLG EYTDIL+NDTDNTF  VSHD+QELMQC +GG V 
Sbjct: 209 NQSVFKESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVN 268

Query: 255 KSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDP 296
           K+LMFIPTST+SK+HQKL+KAV RR+  Q+ GPG Y V+ DP
Sbjct: 269 KTLMFIPTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDP 310

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  306 bits (785), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 179/227 (78%), Gaps = 8/227 (3%)

Query: 78  MDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGAD---- 133
           MD++E +EHAMYTRKFYG++  N  D++E+ + F E +VELVRHIVPYK + +  D    
Sbjct: 104 MDEDEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKD 163

Query: 134 ---EKSTIYYAKVPEFLTIDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWR 189
               K++ YYA++P FLTIDPVPFDPP FES+VKERL N+++ +D++GDRLIDENTIRWR
Sbjct: 164 DATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWR 223

Query: 190 YSRDENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQ 249
           YSRD NQ V+KESNAQI+QWSDG  SLKLG +YTD+LVND  NTF  VSHD+QELMQC  
Sbjct: 224 YSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVD 283

Query: 250 GGEVTKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDP 296
           GGE++KS MF+P STNS++HQ+L+KA+ RRDQ  T+ P    +N DP
Sbjct: 284 GGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDP 330

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (64%), Gaps = 4/37 (10%)

Query: 404 LRQLKRQGTERYTEPEPESDPSTKRRKVAIIDDEDDE 440
           L +LK   T+   E E +S    KRRKVA+IDDEDDE
Sbjct: 437 LERLKNSKTQNDFEVEEDS----KRRKVAVIDDEDDE 469

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  304 bits (778), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 157/277 (56%), Positives = 201/277 (72%), Gaps = 6/277 (2%)

Query: 21  EEPINGNAGEIEDSGGDDEMDDLFGDEGQAXXXXXXXXXXXXXXXXXXXXXXXXXMQMDD 80
           EEP   N  +IE+   D  +DDLFGDE +                          + +DD
Sbjct: 7   EEPERVNNEQIEEKVSD-ALDDLFGDESEEENQQQSLDEQQNDSDDSSAGTSHHRV-IDD 64

Query: 81  EEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYY 140
           EE +E AMY RKF GED +  S++E    +  E +VE+V+H+VPYKT   GAD+K TIYY
Sbjct: 65  EEDEEQAMYNRKFLGEDYEGQSEEEYEKKY-KEVDVEIVKHVVPYKTAN-GADDK-TIYY 121

Query: 141 AKVPEFLTIDPVPFDPPSFESKVKERLNS-SSREDQLGDRLIDENTIRWRYSRDENQQVY 199
           AKVP+FLTIDPVPFDPPSF+ KV++R++  SS+EDQLGDRLI+ENTIRWRYSRD++++V+
Sbjct: 122 AKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVF 181

Query: 200 KESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMF 259
           KESNAQIV+WSDG  SLK+G EYTDILVN+T+NT+  VSH+EQEL+QC +GGE+TKS+MF
Sbjct: 182 KESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMF 241

Query: 260 IPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDP 296
           +PTSTNSK+H+ L+KAV RRD+R   GP  Y    DP
Sbjct: 242 VPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDP 278

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 5/38 (13%)

Query: 403 RLRQLKRQGTERYTEPEPESDPSTKRRKVAIIDDEDDE 440
           RLR++K+ G + Y E     D   K+RK+A++DDEDDE
Sbjct: 385 RLREVKQTGAQEYQE-----DAQAKKRKIAVLDDEDDE 417

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  283 bits (723), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 171/224 (76%), Gaps = 5/224 (2%)

Query: 76  MQMDDEEAQEHAMYTRKFYGEDADNMSDQE--ESANHFTEENVELVRHIVPYKTVGEGAD 133
           + + DEE  E  MY RKFYG+D    S +   E      E NV++++H+VPY T    ++
Sbjct: 78  LGLSDEE-DEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTN-ASE 135

Query: 134 EKSTIYYAKVPEFLTIDPVPFDPPSFESKVKERLNS-SSREDQLGDRLIDENTIRWRYSR 192
           + S++YYAKVP+FLTIDP+PFDPP F+S++++RL   SS+EDQLGDRLIDENTIRWRYSR
Sbjct: 136 KDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSR 195

Query: 193 DENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGE 252
             NQQV+KESNAQI+QWSDG  SLKLG E++DIL+ND +NT+  VSH+++ELMQC +GGE
Sbjct: 196 GANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGE 255

Query: 253 VTKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDP 296
           + KS++FIPTSTNSK HQ+L+ A+ RR+ R+  GP  Y V  DP
Sbjct: 256 IKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDP 299

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 16/53 (30%)

Query: 403 RLRQLKRQGTERY--------------TEPEPESDPST--KRRKVAIIDDEDD 439
           RL+QLK +G  RY              T+ +PE++  +  KRRKVA++D +D+
Sbjct: 409 RLKQLKIEGAARYQHGSTTTTSPSDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  281 bits (718), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 171/212 (80%), Gaps = 4/212 (1%)

Query: 86  HAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAKVPE 145
            AMY RKFYG++A++ +D E S   F E +V++V+H+VPY TV    D+  TI+YAKVP+
Sbjct: 81  QAMYNRKFYGDNAEDSND-EGSQREFREADVDVVKHVVPYSTVPSEGDK--TIFYAKVPQ 137

Query: 146 FLTIDPVPFDPPSFESKVKERLNS-SSREDQLGDRLIDENTIRWRYSRDENQQVYKESNA 204
           FLTIDP+PFDPP+F++K+++R    SS EDQ+ DRLI+ENT+RWRYSRD  QQV+KESNA
Sbjct: 138 FLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNA 197

Query: 205 QIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPTST 264
           QIVQWSDG  SL+LG E+TD+L+NDT++T+  VSHD+QEL+Q  +GGEVTK+++FIPTST
Sbjct: 198 QIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTST 257

Query: 265 NSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDP 296
           NSK HQ+L+KAV R++QR+  GP  Y +  DP
Sbjct: 258 NSKSHQRLSKAVARKEQREHHGPNTYILRVDP 289

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (62%), Gaps = 11/48 (22%)

Query: 403 RLRQLKRQGTERY----------TEPEPESDPSTKRRKVAIIDDEDDE 440
           RLRQLKR G  +Y           + EP+ D + KRRKVA++DDEDDE
Sbjct: 390 RLRQLKRSGASQYRSEGSEDDHVADEEPQ-DSTLKRRKVAVLDDEDDE 436

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  280 bits (717), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 136/223 (60%), Positives = 169/223 (75%), Gaps = 7/223 (3%)

Query: 79  DDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKT--VGEGADEKS 136
           DDE  Q+ AMY +KFYGED  N SD +++   + E ++ELVRHIVPYKT    +  D+  
Sbjct: 51  DDE--QDKAMYEKKFYGEDGFNRSDDDDNEYEYKESDIELVRHIVPYKTRPSNKELDKHR 108

Query: 137 TIYYAKVPEFLTIDPVPFDPPSFESKVKERLNSSSRED-QLGDRLIDENTIRWRYSRD-- 193
            +YYAKVP FL +DPVPFD  +FES VKER+ +S  ED Q+ DRL DENTIRWRYSRD  
Sbjct: 109 ELYYAKVPPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRDSN 168

Query: 194 ENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEV 253
           +N +V+K+SNAQI+QWSDG  SLKLG +YTDIL N+TDN F  VSHD+QELMQC  GGE+
Sbjct: 169 DNDKVFKQSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGGEI 228

Query: 254 TKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDP 296
           TK+LMFIP+ST SK+HQ+LT AV  RD++ T GPG+  +N DP
Sbjct: 229 TKTLMFIPSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDP 271

 Score = 37.0 bits (84), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 27/49 (55%), Gaps = 14/49 (28%)

Query: 403 RLRQLKRQGTERYTEPEPESDPS-----------TKRRKVAIIDDEDDE 440
           RLR  KRQG   Y E + E D             TKRRK+A+IDDEDDE
Sbjct: 383 RLRNAKRQG---YQEDDDERDARNEEEQSSSSEVTKRRKIAVIDDEDDE 428

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  280 bits (715), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 136/260 (52%), Positives = 184/260 (70%), Gaps = 16/260 (6%)

Query: 38  DEMDDLFGDEGQAXXXXXXXXXXXXXXXXXXXXXXXXXMQMDDEEAQEHAMYTRKFYGED 97
           +EMDDLFGD+                               ++EE  E AMY RKFYG+ 
Sbjct: 31  EEMDDLFGDDSDQETGSGPGEQEPHSPNS-----------ANEEEDDEQAMYNRKFYGDK 79

Query: 98  ADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAKVPEFLTIDPVPFDPP 157
            ++ +D  E +  F E ++++++HIVPY T     D+  TIYY KVP+FLTIDP+PFDPP
Sbjct: 80  GEDSND--EGSQEFREADIDIMKHIVPYSTEPSQGDK--TIYYTKVPQFLTIDPIPFDPP 135

Query: 158 SFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDENQQVYKESNAQIVQWSDGGLSL 216
           +F+SK++ER    +S EDQ+ DRLI+ENT+RWRYSRD+NQ+V+KESNA IVQWSDG  SL
Sbjct: 136 AFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESNAHIVQWSDGTYSL 195

Query: 217 KLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPTSTNSKMHQKLTKAV 276
           +LG EYTD+L+NDT++T+ AVSHD+QEL+Q  +GGEVTK+++FIPTSTNSK HQ+L+KAV
Sbjct: 196 RLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAV 255

Query: 277 IRRDQRQTKGPGVYFVNKDP 296
            R++Q++  GP  Y +  DP
Sbjct: 256 ARKEQQEHHGPNTYILRVDP 275

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 29/47 (61%), Gaps = 9/47 (19%)

Query: 403 RLRQLKRQGTERY---------TEPEPESDPSTKRRKVAIIDDEDDE 440
           RLRQLKR+G  +Y          E +   D + KRRKVA++DDEDDE
Sbjct: 377 RLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDDEDDE 423

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  276 bits (706), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 172/222 (77%), Gaps = 10/222 (4%)

Query: 81  EEAQEHAMYTRKFYGED---ADNMSDQEESANHFTEENVELVRHIVP--YKTVGEGADEK 135
           E+ +E  MY RKFYG+D   A ++SD++E A    E ++ELV+H+VP  Y    EG   K
Sbjct: 77  EDNEEQEMYNRKFYGDDLQQASDLSDEDE-AREIKEADLELVKHVVPLLYNKPLEG---K 132

Query: 136 STIYYAKVPEFLTIDPVPFDPPSFESKVKERLNS-SSREDQLGDRLIDENTIRWRYSRDE 194
             +YY KVP+FLTIDPVPFDPPSF+ ++++R+   SS+EDQLGD LIDENTIRWRYSR  
Sbjct: 133 RLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGS 192

Query: 195 NQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVT 254
           +Q+V+KESNAQ+++WSDG LSLKLG EYTDIL N+ +NT+  VSH++QE+MQC +GG ++
Sbjct: 193 DQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTIS 252

Query: 255 KSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDP 296
            S++FIPTSTNSK+H++LTKA+ RR+ R+  GP  Y V KDP
Sbjct: 253 NSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDP 294

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.128    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,418,241
Number of extensions: 1678390
Number of successful extensions: 5875
Number of sequences better than 10.0: 33
Number of HSP's gapped: 5967
Number of HSP's successfully gapped: 53
Length of query: 440
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 327
Effective length of database: 40,524,141
Effective search space: 13251394107
Effective search space used: 13251394107
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 67 (30.4 bits)