Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D026005.441ON52352327820.0
ZYRO0F10186g5.441ON51951816930.0
NDAI0B057105.441ON56349714670.0
Kpol_1062.255.441ON53351214410.0
NCAS0F034205.441ON52550013840.0
TBLA0A027905.441ON54753013750.0
SAKL0G02684g5.441ON53946812751e-171
TPHA0E017205.441ON53748212631e-169
CAGL0A02904g5.441ON50149511831e-157
Skud_4.6405.441ON51150511651e-155
Suva_2.5435.441ON51150511621e-154
KNAG0C048705.441ON45844811421e-152
Smik_4.6375.441ON51150211451e-152
YDR371W (CTS2)5.441ON51150411351e-150
KAFR0E038105.441ON49045211271e-149
KLLA0E02333g5.441ON48045310781e-142
ACL166W5.441ON49051710611e-139
Ecym_45125.441ON52746610461e-136
Kwal_55.214025.441ON51646010361e-135
KLTH0F15906g5.441ON51544510141e-132
ZYRO0C02266g3.61ON162146810.31
NCAS0A143107.378ON76759751.5
CAGL0K09966g7.22ON719123741.9
SAKL0F12100g7.378ON76733732.4
KNAG0C036407.378ON76777723.5
Skud_5.2127.378ON76768724.0
ZYRO0B03036g7.378ON76733714.5
ZYRO0G04554g1.504ON218117695.0
YER091C (MET6)7.378ON76733705.9
Smik_5.2327.378ON76733706.1
ABR212C7.378ON76833706.8
TBLA0D049401.357ON665134696.8
Suva_5.2077.378ON76733697.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D02600
         (523 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...  1076   0.0  
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   656   0.0  
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   569   0.0  
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   559   0.0  
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   537   0.0  
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   534   0.0  
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   495   e-171
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   491   e-169
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   460   e-157
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   453   e-155
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   452   e-154
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   444   e-152
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   445   e-152
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   441   e-150
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   438   e-149
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   419   e-142
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   413   e-139
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   407   e-136
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   403   e-135
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   395   e-132
ZYRO0C02266g Chr3 (176474..181339) [4866 bp, 1621 aa] {ON} simil...    36   0.31 
NCAS0A14310 Chr1 complement(2817732..2820035) [2304 bp, 767 aa] ...    33   1.5  
CAGL0K09966g Chr11 complement(974931..977090) [2160 bp, 719 aa] ...    33   1.9  
SAKL0F12100g Chr6 complement(941686..943989) [2304 bp, 767 aa] {...    33   2.4  
KNAG0C03640 Chr3 (712317..714620) [2304 bp, 767 aa] {ON} Anc_7.3...    32   3.5  
Skud_5.212 Chr5 complement(333916..336219) [2304 bp, 767 aa] {ON...    32   4.0  
ZYRO0B03036g Chr2 complement(245870..248173) [2304 bp, 767 aa] {...    32   4.5  
ZYRO0G04554g Chr7 complement(366792..367448) [657 bp, 218 aa] {O...    31   5.0  
YER091C Chr5 complement(339864..342167) [2304 bp, 767 aa] {ON}  ...    32   5.9  
Smik_5.232 Chr5 complement(348431..350734) [2304 bp, 767 aa] {ON...    32   6.1  
ABR212C Chr2 complement(802388..804694) [2307 bp, 768 aa] {ON} S...    32   6.8  
TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON} Anc_1...    31   6.8  
Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON...    31   7.9  

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score = 1076 bits (2782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/523 (97%), Positives = 511/523 (97%)

Query: 1   MQRRPWLSHTXXXXXXXXXXXXEMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNPGTVE 60
           MQRRPWLSHT            EMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNPGTVE
Sbjct: 1   MQRRPWLSHTVIIIVILASIAVEMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNPGTVE 60

Query: 61  PGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMD 120
           PGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMD
Sbjct: 61  PGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMD 120

Query: 121 LYKPMAIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGG 180
           LYKPMAIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGG
Sbjct: 121 LYKPMAIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGG 180

Query: 181 WSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRL 240
           WSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRL
Sbjct: 181 WSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRL 240

Query: 241 KERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEW 300
           KERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEW
Sbjct: 241 KERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEW 300

Query: 301 SEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMA 360
           SEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMA
Sbjct: 301 SEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMA 360

Query: 361 AYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSGFC 420
           AYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSGFC
Sbjct: 361 AYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSGFC 420

Query: 421 YSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFV 480
           YSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFV
Sbjct: 421 YSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFV 480

Query: 481 SKFDDLMYRQTPVLRYYVNKFGNDAFLSPFILNLLAGQGEAPH 523
           SKFDDLMYRQTPVLRYYVNKFGNDAFLSPFILNLLAGQGEAPH
Sbjct: 481 SKFDDLMYRQTPVLRYYVNKFGNDAFLSPFILNLLAGQGEAPH 523

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/518 (60%), Positives = 392/518 (75%), Gaps = 8/518 (1%)

Query: 2   QRRPWLSHTXXXXXXXXXXXXEMCFYKKIFHRSAQRKVVDYVQSQPQQA--QLVTNPGTV 59
             +PW +H+            EMCFY+KIF  SA+  V+D+V      +  Q   +   +
Sbjct: 4   HNQPWFNHSIILAFIIASIVIEMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVI 63

Query: 60  EPGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGM 119
               Y SGLYYS+WSPY PR HFPHDID S+VSHIYYAFFL+DG TG LK  DEWSD  M
Sbjct: 64  GDEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQM 123

Query: 120 DLYKPMAIKLNKLNPEVKND-LERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCV 178
           DLYKP+A+KLN+L  ++KND +     +LP GC+GELFY+R+  +      R FKV+M V
Sbjct: 124 DLYKPLAVKLNQL--QLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAV 181

Query: 179 GGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAK 238
           GGWSNR+++PKMVR+P+RV+ FI+SC+ETMFKYGFDGIDLDWEFP++DGFEP+MYL+LA+
Sbjct: 182 GGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELAR 241

Query: 239 RLKERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHG 298
           +++ + +ELE+ IF    NHPKFQLSMATPAF +KL++LPI E+D+YID+WNMMTYDYHG
Sbjct: 242 KMRLKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHG 301

Query: 299 EWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLG 358
           EWS  TGYHCNLY+G  K    +  KH  S++  EGLDA+SAI  M+N  GV+S KI LG
Sbjct: 302 EWSPVTGYHCNLYDGPVKV--HSQYKHDSSSDD-EGLDANSAISDMINRFGVDSRKITLG 358

Query: 359 MAAYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSG 418
           MAAYGRGFT+V A S DKRFIDK FHGVGGAS+GEPGMWLYNQLPI+G+ E +DP+YVSG
Sbjct: 359 MAAYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSG 418

Query: 419 FCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIK 478
           FC+   +KTFVGYD+VESV+ KA YV+E  L GGFWWESCGD+H +  RSLLNAFT  IK
Sbjct: 419 FCFDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIK 478

Query: 479 FVSKFDDLMYRQTPVLRYYVNKFGNDAFLSPFILNLLA 516
            ++K ++ +Y +   LRYY+ KFG D FLSPFI+ +++
Sbjct: 479 TIAKNENSVYHKPEALRYYLEKFGQDEFLSPFIIRIIS 516

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/497 (54%), Positives = 366/497 (73%), Gaps = 35/497 (7%)

Query: 47  PQQAQLVTNPGTVEPGQ-YLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGAT 105
           PQ+  +V  P   +    ++SG+YYS+WSPY PR HFPHDIDL++++H+YY+FFLV+GAT
Sbjct: 75  PQENDIVNYPKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGAT 134

Query: 106 GALKLGDEWSDVGMDLYKPMAIKLNKL--NPEVKND---------LERQRRILPNGCLGE 154
           G +   DEWSD+ MDLYKP+++KLN L  N +V +D         +E+ ++ LP GC+GE
Sbjct: 135 GDVTCSDEWSDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGE 194

Query: 155 LFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFD 214
           LFY++          ++FK+IM +GGWSNRE FP MVR+  ++++FI+S +E MFKYGFD
Sbjct: 195 LFYLKK--------FQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFD 246

Query: 215 GIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGP----------NMNHPKFQLS 264
           GIDLDWEFPEDDGFEP  YL++ +RL++RM++LE  IF            + +HPKF+LS
Sbjct: 247 GIDLDWEFPEDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELS 306

Query: 265 MATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFDETHQK 324
           +ATPAF EKL+ILPI EM+KYID WNMMTYDY+G+WSE+TGYHCNLY G          K
Sbjct: 307 VATPAFIEKLNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYK 366

Query: 325 HIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGFTNVVAQSTDKRFIDKPFH 384
           H + T S +GL+A+ AI +ML    V+S K+ LG+AAYGRGFT V     D+ FI+K F 
Sbjct: 367 HEH-TSSNKGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFD 425

Query: 385 GVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFVGYDSVESVRFKAQYV 444
           GVGGAS GEPGMWLYNQLPI+ + E+FDP+YVS FCY   +KTFVGYD+V++++ KA+YV
Sbjct: 426 GVGGASAGEPGMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYV 485

Query: 445 REKNLAGGFWWESCGDDHANQSRSLLNAFTN--EIKFVSKFDD--LMYRQTPVLRYYVNK 500
           ++++LAGGFWWESCGDDH +  RSLLNAFTN  E+K + K++D  L+Y Q   ++YY+N 
Sbjct: 486 QDRHLAGGFWWESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNY 545

Query: 501 FGNDAFLSPFILNLLAG 517
           FGND FLSPF + +++ 
Sbjct: 546 FGNDGFLSPFFIQIMSA 562

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/512 (54%), Positives = 353/512 (68%), Gaps = 27/512 (5%)

Query: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNPGTVEPGQYLSGLYYSNWSPYSPRMHF 82
           E   Y+K     ++ + ++   ++ Q     + P   + G Y  G+YYSNWSPY+PR+H 
Sbjct: 24  ESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPNNPDSG-YDVGVYYSNWSPYTPRLHL 82

Query: 83  PHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNKL------NPEV 136
           PHD+D SR++H+YYAFF+VD  TGAL   D WSD  MD YKP+A+KL KL      NP+ 
Sbjct: 83  PHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKLKKLQLDHFFNPKF 142

Query: 137 KNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKR 196
           KN L       P GC+GELFY+R++ LF + N R FK+IM VGGWSNRE FP+M+R+ K+
Sbjct: 143 KNGL-------PMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAFPRMIRDSKK 195

Query: 197 VDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIF--GP 254
           +D F++SCIE MF YGFDGI+LDWEFP+DD  EP+MYL+L K+LK + NELE  IF    
Sbjct: 196 LDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQKIFNNSG 255

Query: 255 NMNH---PKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLY 311
           N NH   PKF LS+A PAF EKLDIL + EMD Y+D+WNMMTYDYHGEWSEKTGYH NLY
Sbjct: 256 NGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTGYHSNLY 315

Query: 312 N--------GSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYG 363
           +              DE ++      +    L+   AI +++    +N  KI LGMAAYG
Sbjct: 316 SPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVIKKYHINPKKINLGMAAYG 375

Query: 364 RGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSS 423
           RGFT V A S D RFI+KP+ GVGGAS+GEPGMWLYNQLPI+ + E FDPDYVS FCY  
Sbjct: 376 RGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSLEEFDPDYVSAFCYDK 435

Query: 424 TSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFVSKF 483
            SKTFVGYD+ +S++ KAQYV+E NL GGFWWESCGDDH N  +SLLNAFT+EI  V++ 
Sbjct: 436 KSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAFTDEIGSVTEK 495

Query: 484 DDLMYRQTPVLRYYVNKFGNDAFLSPFILNLL 515
           ++ M+    VL+YY+   G+  FLS FI+ LL
Sbjct: 496 NETMFTNIEVLKYYLKTKGDTGFLSTFIMKLL 527

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/500 (51%), Positives = 350/500 (70%), Gaps = 15/500 (3%)

Query: 23  EMCFYKKIFHRSAQRKVVD------YVQSQPQQAQLVTNPGTVEPGQYLSGLYYSNWSPY 76
           +MC +K  F + A + ++        + ++ +   L+    +     YLSGLYYS+WSPY
Sbjct: 27  QMCLHKLYFKQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSNGEKGYLSGLYYSSWSPY 86

Query: 77  SPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNKLN--P 134
            PR HFPHDIDL+RVSHIYYAFFLVD  TG L   DEWSD+ MDLYKP+++KL+ LN   
Sbjct: 87  KPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNLNLAD 146

Query: 135 EVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNP 194
             K    R +R LP GC+GELFY++++ + P  +    K+I+ +GGWSNR+ FP +VR+ 
Sbjct: 147 NEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGS--STKMILSIGGWSNRDRFPGLVRDT 204

Query: 195 KRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGP 254
           ++ + FIDS +ETMF+YGFDGIDLDWEFP+DDG EP  YL++  +L+ +M++LE  IFG 
Sbjct: 205 RKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIFGE 264

Query: 255 NMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGS 314
             +HPKFQLS+ATPAF  KL ILPI +MD+Y+D WNMMTYDY+G WSE TGYHCNL+NG 
Sbjct: 265 TKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLFNGD 324

Query: 315 TKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGFTNVVAQST 374
              F   + KH ++  +  GL+A+ AI+ M+    V S K+ LGMAAYGR F +V ++  
Sbjct: 325 GSEFRAGY-KHEHTAHN-NGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQG 382

Query: 375 DKRFIDKPFHGVG-GASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFVGYDS 433
               I++ F GVG G    EPGMWLYNQLP++GT E++DP+Y + FCY   S+TF+GYD+
Sbjct: 383 VDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSETFIGYDN 442

Query: 434 VESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFVSKFD--DLMYRQT 491
           V+SV+ KAQYV+ + L GGFWWESCGDDH N+ RSLL  F+NE+  + KF   DL++R+ 
Sbjct: 443 VDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFSDQDLIFRRK 502

Query: 492 PVLRYYVNKFGNDAFLSPFI 511
             + YY+N++G D FLS  +
Sbjct: 503 ECIAYYLNRYGTDGFLSGIL 522

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/530 (49%), Positives = 352/530 (66%), Gaps = 49/530 (9%)

Query: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQAQLV-----------TNPGTVEPGQYLSGLYYS 71
           EMCFY K+F++  +++V++ +Q   +   L            TN     P  Y SG+YYS
Sbjct: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84

Query: 72  NWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNK 131
           NWSPYSPR HFPHDID SR+SH+YY+FFLV+G  G ++LGD+WSD+ MDLYKP++IKL K
Sbjct: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144

Query: 132 LNPEVKNDLERQ-----RRILPNGCLGELFYMRNANLFPN---RNIRDFKVIMCVGGWSN 183
           L  +V    E Q     +  LP GC+GE FY+RN+ L P     N ++FK+IM +GGWSN
Sbjct: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204

Query: 184 REEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKER 243
           R+ FPKM ++P+++  F+ S IE MF+YGFDGIDLDWEFP+++  EP +YL++ ++L++ 
Sbjct: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264

Query: 244 MNELEDAIFG----PNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGE 299
           MNELE+ I+     P      FQLS+A+PAF EKL +LPI EM+K +D WNMMTYDY+GE
Sbjct: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324

Query: 300 WSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGM 359
           WSEKTGYH NLY+GS    DE            E L+A SAI++M+   GV  +K+ LG+
Sbjct: 325 WSEKTGYHSNLYDGSKVKHDE------------EVLNADSAIKYMIETQGVEPNKLVLGL 372

Query: 360 AAYGRGFTNVVAQ--------------STDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQ 405
           A YGRG+TNV                 + D+ FID  + GVGG S+GEPGMW+YNQLPI+
Sbjct: 373 AGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEPGMWMYNQLPIK 432

Query: 406 GTHELFDPDYVSGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQ 465
           G+ E FDP +VS +CY   + T V YD+VES+  K QYV++K LAGGF WESCGD H N 
Sbjct: 433 GSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNP 492

Query: 466 SRSLLNAFTNEIKFVSKFDDLMYRQTPVLRYYVNKFGNDAFLSPFILNLL 515
            RSL+ AFTNE+  + K +  +++      +Y+ +FGN+ +LS  I  LL
Sbjct: 493 KRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKLL 542

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  495 bits (1275), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 232/468 (49%), Positives = 325/468 (69%), Gaps = 26/468 (5%)

Query: 48  QQAQLVTNPGTVEPGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGA 107
           Q  Q    P + +   Y+SG+YY+NWSPY+PR HFPHD++  R+++++Y+FF+VD  +G 
Sbjct: 73  QNLQEEVGPASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGT 132

Query: 108 LKLGDEWSDVGMDLYKPMAIKLNKLNPEVKNDL----------ERQRRILPNGCLGELFY 157
           +K  DEWSD  MDLYK       K  P+ K  L            ++ +LP GC+GELFY
Sbjct: 133 VKSSDEWSDFQMDLYK-------KFYPQFKAALLSSSSSSTFQSHKKEMLPMGCIGELFY 185

Query: 158 MRNANLFPNRN----IRDFKVIMCVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGF 213
           ++ +++ P+ +     R+FKV M VGGWSNR+ FP +VR+  + D FI +C+ETMF+YGF
Sbjct: 186 LKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGF 245

Query: 214 DGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHPKFQLSMATPAFSEK 273
           DG+D+DWEFP++DG EP+MYL + +RL+E +++LE  IF    +   F L++A PAF EK
Sbjct: 246 DGLDIDWEFPQNDGLEPKMYLTMIRRLREALDDLERDIFQDEHHSEHFFLTVAVPAFKEK 305

Query: 274 LDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVE 333
           L +LP+ +MD Y+D WN+M YDYHGEWSE TGYH NLY+  +   +  H++H    E+  
Sbjct: 306 LQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDS---NHVHRRHFRDEEN-- 360

Query: 334 GLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGE 393
            L+A SA++++L   G+NS K+ LGMAAYGRGFT V   +    +I KP++GVGGAS+GE
Sbjct: 361 QLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGE 420

Query: 394 PGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGF 453
           PGMWLYNQLP+ GT E FDP  VS + +   SKTFVGYD+V+S+R KAQYV+  NLAGGF
Sbjct: 421 PGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGF 480

Query: 454 WWESCGDDHANQSRSLLNAFTNEIKFVSKFDDLMYRQTPVLRYYVNKF 501
           WWESCGD+H ++ +SLLNAFTN++  ++K    +Y    V+RYY+  +
Sbjct: 481 WWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNY 528

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  491 bits (1263), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 243/482 (50%), Positives = 327/482 (67%), Gaps = 13/482 (2%)

Query: 46  QPQQAQLVTNPGTVEPGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGAT 105
           +P+ ++   N GT E   Y  G+YYSNWSPYSPR+ FPHDID SRVSH+YY+F LVDG  
Sbjct: 63  KPENSE--QNNGT-ENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDE 119

Query: 106 GALKLGDEWSDVGMDLYKPMAIKLNKLNPEVKN-DLERQRRILPNGCLGELFYMRNANL- 163
           G +K  D WSD  +D+YKP+ + L +++ +  +  +  ++ +LP GC+GE FY+RN  + 
Sbjct: 120 GTIKSSDTWSDFQIDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIP 179

Query: 164 FPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFP 223
                  DFKV M VGGWSNRE FPKMVR+P++VDKFI+SCI+TMF YGFDGIDLDWEFP
Sbjct: 180 IHGPKSTDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFP 239

Query: 224 EDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNH----PKFQLSMATPAFSEKLDILPI 279
           EDDGFEP MYL + KRLK +M ELE  I+   ++H    P F+LS+A PAF EKL ILP+
Sbjct: 240 EDDGFEPMMYLDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPV 299

Query: 280 TEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHS 339
            +MDK++D WNMMTYDY GEWS+ TGYH NL++    S     +    S E++ G    +
Sbjct: 300 QQMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCG---DN 356

Query: 340 AIEHMLNVAGVNSHKICLGMAAYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLY 399
           A+++M +   ++S KI LGMAAYGRGF+ V    T+ +   K F+GV G+S  EPG+WLY
Sbjct: 357 AVKYMKDNLKISSRKIILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLY 416

Query: 400 NQLPIQGTHELFDPDYVSGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCG 459
           N+LPI+G+ E FD + VS +CY   SK FV YD+ +S+  K++YVR+ NL GGF WE+CG
Sbjct: 417 NKLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACG 476

Query: 460 DDHANQSRSLLNAFTNEIKFVSKFDDLMYRQTPVLRYYVNKFGNDAFLSPFILNLLAGQG 519
           +   N   SL+N+FT ++  + K    M+    VL YY+ K+G   FLS +IL++L    
Sbjct: 477 EKLNNPKLSLINSFTFDMNNIDK-QKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNRMN 535

Query: 520 EA 521
           E 
Sbjct: 536 ET 537

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  460 bits (1183), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 238/495 (48%), Positives = 316/495 (63%), Gaps = 21/495 (4%)

Query: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNPGTVEPGQYLSGLYYSNWSPYSPRMHF 82
           +M  + KIF +  +R   D    +  ++ +++N        Y++GLYYSNWSPY PR+HF
Sbjct: 23  QMSLHYKIFQKLKRRSQSD--DYRMPESDVLSNT------SYIAGLYYSNWSPYEPRLHF 74

Query: 83  PHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNKLNPEVKNDLER 142
           PHDID  +VSHIYYAF L+D  TG L   DEWSD  ++L K     + K      ++L+ 
Sbjct: 75  PHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLNLAKQCREYMFK--RFTGDELKA 132

Query: 143 QRRI-LPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDKFI 201
              I  P GC+GEL Y+R   ++     R+ K+IM VGGWSNRE FP MVR+  +   FI
Sbjct: 133 VTNIRAPPGCIGELNYLRY--IYSKIKKRNVKLIMSVGGWSNRESFPIMVRDELKFKNFI 190

Query: 202 DSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHPKF 261
           +SCIETM  YGFDGIDLDWEFPEDD +EP  YL++A+ LK ++ +LE  I G + N   F
Sbjct: 191 NSCIETMVYYGFDGIDLDWEFPEDDSYEPDAYLRMARELKLQLQKLEANILGDHSN-KTF 249

Query: 262 QLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFDET 321
           QLSMATPAF +KL ILPI ++DKYID+WN+MTYDY+GEWSE+TG H NLYN   K     
Sbjct: 250 QLSMATPAFKDKLSILPIHKLDKYIDLWNLMTYDYYGEWSERTGLHANLYNEKGKLL--- 306

Query: 322 HQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGFTNVVAQSTDKRF-ID 380
              H++  +   GL   +AI +M+N   ++  K+ LGMAAYGRGFTNV  +ST+      
Sbjct: 307 ---HLHRHDEDAGLSGDAAINYMVNRCKIDPRKVILGMAAYGRGFTNVDMKSTNPHNPYG 363

Query: 381 KPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFVGYDSVESVRFK 440
             F GVGGAS+GEPGMWLYNQLPI G++E +D  +V  +CY   + T VGYD+  SV  K
Sbjct: 364 LKFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYRHVGAYCYDDRTHTLVGYDNPTSVIEK 423

Query: 441 AQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFVSKFDDLMYRQTPVLRYYVNK 500
           A Y+   +L G FWWESCGD H N  RSLLN +   I+ V    + +Y  T +  YY+  
Sbjct: 424 ANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRVIRNVKNNKETIYSTTKLHDYYLEN 483

Query: 501 FGNDAFLSPFILNLL 515
           +  + FL+ FI +++
Sbjct: 484 YDTNGFLTGFIKDII 498

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  453 bits (1165), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 232/505 (45%), Positives = 325/505 (64%), Gaps = 41/505 (8%)

Query: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQA-QLVTNPGTVEPGQ-YLSGLYYSNWSPYSPRM 80
           EMC Y KIF       + D  ++   Q   +V N    + G+ Y+SG+YYSNWSPY+PR 
Sbjct: 30  EMCLYNKIFKSQRSDDIRDNFRNGGDQVPSMVQNQKPHDGGKGYVSGVYYSNWSPYTPRF 89

Query: 81  HFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNKLNPEVKNDL 140
           HFPHDI+L +VSH+YYAFF ++  TG ++  D WSD+ M+LYKP+AIK ++L   V+N+L
Sbjct: 90  HFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQL---VENNL 146

Query: 141 -ERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDK 199
            +  + ILP GC+GELFY++NA      + + FKVIM +GGWS+ E F  +V + K +  
Sbjct: 147 NDSVQNILPLGCVGELFYLKNAC-----SEKKFKVIMSIGGWSDSENFKTIVGDDKLLQN 201

Query: 200 FIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHP 259
           F+DS +ETMFK GFDGID+DWEFPE++  EPQ YL+L K L+ ++N LE  IFG ++   
Sbjct: 202 FVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGESI-ED 260

Query: 260 KFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFD 319
            FQ+S+A PAF +KL  LPI+E+D+YID WNMMTYDY+G WSE TGYH NL       F 
Sbjct: 261 HFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNL-------FS 313

Query: 320 ETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGF----TNVVAQSTD 375
           ET             L  + A+ +M++   V+S K+ LGMAAYGR F    +     + +
Sbjct: 314 ETE------------LSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQN 361

Query: 376 KRFIDKPFHGVG------GASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFV 429
              I++ F GVG        +DG+ G+W Y  LP +GT E +DP YVS +C+   +  F+
Sbjct: 362 TVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFI 421

Query: 430 GYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFVSKFDDLMYR 489
            YD+ +S + KA+YV    L GGFWWESCG+ H N+SRSL+NAF   I+F       M++
Sbjct: 422 SYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQ 481

Query: 490 QTPVLRYYVNKFGNDAFLSPFILNL 514
              V+++Y+NK+G+D FLSP++ +L
Sbjct: 482 DMRVIKFYLNKYGDDGFLSPYLKHL 506

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  452 bits (1162), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 235/505 (46%), Positives = 317/505 (62%), Gaps = 40/505 (7%)

Query: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQA-QLVTN--PGTVEPGQYLSGLYYSNWSPYSPR 79
           EMC Y K+F       + D  Q+   Q   +V N  P   + G Y+SG+YYSNWSPY PR
Sbjct: 30  EMCLYNKLFKNQRSEDIRDNFQNGRHQVPNMVQNQKPSGDDDG-YVSGVYYSNWSPYKPR 88

Query: 80  MHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNKLNPEVKND 139
            HFPHDI+L +VSH+YYAFF +D  TG +   D WSD+ MDLYKP+AIK ++L  +  +D
Sbjct: 89  FHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDD 148

Query: 140 LERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDK 199
              Q  ILP GC+GELFY++NA      + R FK IM +GGWS+ E F  +V+N K +  
Sbjct: 149 NNMQS-ILPLGCIGELFYLKNAC-----SGRKFKSIMSIGGWSDSENFKTIVKNEKLLQN 202

Query: 200 FIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHP 259
           F+DS +ETMFK GFDGID+DWEFPE++  EPQ YL+L + L+ ++N LE  IFG +    
Sbjct: 203 FVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGSTKD- 261

Query: 260 KFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFD 319
            F+LS+A PAF +KL  LPI E+D+YID WNMMTYDY+G WSE TGYH NL       F 
Sbjct: 262 HFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNL-------FS 314

Query: 320 ETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGF----TNVVAQSTD 375
           ET             L  + AI +M+   GVN  K+ LGMAAYGR F          + +
Sbjct: 315 ETE------------LSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFTKN 362

Query: 376 KRFIDKPFHGVG------GASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFV 429
              I++ F GVG        +DG+ G+W Y  LP +GT E +DP YVS +C+   +  F+
Sbjct: 363 TVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFI 422

Query: 430 GYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFVSKFDDLMYR 489
           GYD+ ES++ KA YV    L GGFWWESCG+D+A++SRSL+NAF   + F       M++
Sbjct: 423 GYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQ 482

Query: 490 QTPVLRYYVNKFGNDAFLSPFILNL 514
              V++YY++K+G+  FL+P++ +L
Sbjct: 483 DKRVMKYYLSKYGDGGFLAPYLKHL 507

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  444 bits (1142), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 222/448 (49%), Positives = 292/448 (65%), Gaps = 45/448 (10%)

Query: 63  QYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLY 122
           +Y+SG+YYS+WSPY PRMHFP +ID S+++HIYY+FFLVD  + ALKLGD WSD+ M + 
Sbjct: 50  KYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPMG 109

Query: 123 KPMAIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWS 182
           K   +K                     GC+G L  +R+           FK IM VGGWS
Sbjct: 110 KNTVLK---------------------GCIGALNSLRDEK-------PGFKNIMAVGGWS 141

Query: 183 NREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKE 242
           N++ FP  +R    V+K   SC+ETMF+YGFDGIDLDWE+P+DDG EP++YL+L +++++
Sbjct: 142 NKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQ 201

Query: 243 RMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSE 302
            MNELE AI+G      +F LS+ATPAF +KL+  PI EMD+YID WNMMTYDY+GEWS 
Sbjct: 202 HMNELEIAIWGDKKR--RFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSS 259

Query: 303 KTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAY 362
            TG+H NLY+G+ K F E              L A  AI +M N  G+NS K+ LGMA Y
Sbjct: 260 GTGFHSNLYDGTNK-FSE------------HSLCADGAIRYMTNKIGINSRKVVLGMALY 306

Query: 363 GRGFTNVVAQSTDKR--FIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSGFC 420
           GRGFTNV      K    I++ F GVGG S+GEPGMWLYNQLPI+GT E+FD  Y S +C
Sbjct: 307 GRGFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYC 366

Query: 421 YSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFV 480
           +   +KT VGYD+V+S R KAQYVR  NLAGGFWWESCG+   N  +SL++ F  +I+ +
Sbjct: 367 FDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERL 426

Query: 481 SKFDDLMYRQTPVLRYYVNKFGNDAFLS 508
            + +  +Y+   +  +Y+  F    FL+
Sbjct: 427 DRNETNLYQDPKLREHYLQIFAKSGFLA 454

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  445 bits (1145), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 226/502 (45%), Positives = 319/502 (63%), Gaps = 41/502 (8%)

Query: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQAQLV--TNPGTVEPGQYLSGLYYSNWSPYSPRM 80
           EMC YKKIF      K+ D   +   +   +  T    V+   ++SG+YYSNWSPY PR 
Sbjct: 30  EMCLYKKIFKNQRSNKIRDSFNNGGHKVPNMDQTQGPNVDGEGFVSGVYYSNWSPYKPRF 89

Query: 81  HFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNKL-NPEVKND 139
           HFPHDI+L++VSH+YYAFF ++  TG ++  D WSD+ M+LYKP+AIK ++L +    ND
Sbjct: 90  HFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGNSSND 149

Query: 140 LERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDK 199
           +++   ILP GC+GELFY++++      + + FKVIM +GGWS+ E F  +++N   +  
Sbjct: 150 IQK---ILPLGCIGELFYLKHS-----CSGKKFKVIMSIGGWSDSENFKVIIKNENLLQA 201

Query: 200 FIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHP 259
           F+DS +ETMFK GFDGIDLDWEFPE++  EPQ YL+L + L+ ++N LE  IFG  +   
Sbjct: 202 FVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFGEGV-ED 260

Query: 260 KFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFD 319
            FQLS+A PAF +KL  LPI E+D+YID WNMMTYDY+G WSE TGYH NL       F 
Sbjct: 261 HFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNL-------FS 313

Query: 320 ETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGF----TNVVAQSTD 375
           ET             L  + AI +M++  G+NS K+ LGMAAYGR F    +     + +
Sbjct: 314 ETE------------LSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFTQN 361

Query: 376 KRFIDKPFHGVG------GASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFV 429
              I++ F GVG        +DG+ G+W Y  LP +GT E +DP YVS +C+   +  F+
Sbjct: 362 TILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIFI 421

Query: 430 GYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFVSKFDDLMYR 489
            YD+ +SV+ KA+YV    L GGFWWESCG+ +AN+SRSL++AF   ++        M+ 
Sbjct: 422 SYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMFE 481

Query: 490 QTPVLRYYVNKFGNDAFLSPFI 511
              V+ +Y+NK+GN+ FL+P++
Sbjct: 482 NERVVNFYLNKYGNNGFLTPYL 503

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  441 bits (1135), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 229/504 (45%), Positives = 315/504 (62%), Gaps = 39/504 (7%)

Query: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQA-QLVTNPGT-VEPGQYLSGLYYSNWSPYSPRM 80
           EMC Y KIF       + D   +   +    V N GT +    ++SG+YYSNWSPY PR 
Sbjct: 30  EMCLYNKIFKNQRSDDIRDNFNNGGHRVPSNVQNHGTHIRDEAFISGVYYSNWSPYKPRF 89

Query: 81  HFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNKLNPEVKNDL 140
           HFPHDI+L +VSHIYYAFF ++  TG ++  D WSD+ M+LYK +AIK ++L  E  N+ 
Sbjct: 90  HFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYKSLAIKNSELIKESSNN- 148

Query: 141 ERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDKF 200
              + ILP GC+GELFY++N       + + FKVIM +GGWS+ E F  ++++ K +  F
Sbjct: 149 -SVQNILPLGCIGELFYLKNTC-----SDKKFKVIMSIGGWSDSENFKIIIKDDKLLQNF 202

Query: 201 IDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHPK 260
           +DS +ETMF+ GFDGIDLDWEFP ++  EP+ YL+L + L+ ++N LE  IFG       
Sbjct: 203 VDSSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVRMLRLKLNSLESQIFGKRT-EDH 261

Query: 261 FQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFDE 320
           FQLS+A PAF +KL  LPITE+D+Y+D WNMMTYDY+G WSE TGYH NL       F E
Sbjct: 262 FQLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGSWSETTGYHSNL-------FSE 314

Query: 321 THQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGF----TNVVAQSTDK 376
           T             L+ + A+ +M++  GVNS K+ LGMAAYGR F          + + 
Sbjct: 315 TE------------LNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSFHIKDNKFEPFNQNT 362

Query: 377 RFIDKPFHGVG------GASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFVG 430
             I+K F GVG        +DG+ G+W Y  LP  GT E +DP YVS +C+   +  F+ 
Sbjct: 363 VLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYCFDEKNSIFIS 422

Query: 431 YDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFVSKFDDLMYRQ 490
           YD+ +SV+ KA+YV   NL GGFWWESCG+ +AN+SRSL+NAF   + F       +++ 
Sbjct: 423 YDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNEGLHFNVSSKPSIFQD 482

Query: 491 TPVLRYYVNKFGNDAFLSPFILNL 514
             V +YY+NK+G+  FLSP++ +L
Sbjct: 483 VRVKKYYLNKYGDGGFLSPYLKHL 506

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  438 bits (1127), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 224/452 (49%), Positives = 297/452 (65%), Gaps = 38/452 (8%)

Query: 67  GLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMA 126
           GLYYSNWS Y PR+HFPH+I+   +SH+YYAFFLVDG  G L  GD+W+D      +P+ 
Sbjct: 61  GLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWAD----FQRPI- 115

Query: 127 IKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREE 186
           +K NKL                 G +GELF ++  N          K IMC+GGWSNRE 
Sbjct: 116 LKNNKL---------------VKGNVGELFDLKMKN--------RVKCIMCIGGWSNREA 152

Query: 187 FPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNE 246
           +     +P +++ F +  ++ MF+YGFDGIDLDWE+PEDDG EPQ+YL++ +R+K  MN+
Sbjct: 153 WHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNK 212

Query: 247 LEDAIF-GPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTG 305
           LE  IF   +     F+LS+ATPAF +KL+I P+ EMD  ID WNMMTYDY+GEWSE+TG
Sbjct: 213 LESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTG 272

Query: 306 YHCNLYNGSTKSFD-ETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGR 364
           YH NLY+GS  S   E+  +H  S   VEGL+   A+++M+N  G+   KI LGMAAYGR
Sbjct: 273 YHSNLYDGSKGSTTIESVLRHGMS--EVEGLNGDYAVKYMIN-QGIKKDKIILGMAAYGR 329

Query: 365 GFTNVVAQS----TDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSGFC 420
           GFTNV   +       R+I + F GVGGAS+GEPGMW Y+QLPI GT E FDP YVSG+C
Sbjct: 330 GFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYC 389

Query: 421 YSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEI-KF 479
           +  T+ TFVGYD+++SVR K QY++ K++ GGFWWESCGD H N  RSL+NA+  E+ + 
Sbjct: 390 FEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGRD 449

Query: 480 VSKFDDLMYRQTPVLRYYVNKFGNDAFLSPFI 511
             K  + +Y+    + +Y   F    FLS ++
Sbjct: 450 NIKKPESIYKNLHCVSHYKQSFHGKGFLSKYL 481

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  419 bits (1078), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 207/453 (45%), Positives = 298/453 (65%), Gaps = 41/453 (9%)

Query: 61  PGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMD 120
           P  +    YYSNWSPY+ R H P DI  S+++H+YYAFF+VD  +GA+K  D WSD  + 
Sbjct: 63  PDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL- 121

Query: 121 LYKPMAIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGG 180
              P+++ +                    GC+ EL  ++        +  +FK I+C+GG
Sbjct: 122 ---PLSVGVK-------------------GCIKELQKIKL------ESKHEFKTILCLGG 153

Query: 181 WSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRL 240
           WSNRE + K+ ++ K+V KFI++ ++ MF+YGFDGIDLDWEFPE+D  EP +YL++ + +
Sbjct: 154 WSNREAYKKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGI 213

Query: 241 KERMNELEDAIFGP---NMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYH 297
           +E M++LE  IFG      +HP FQLS+ATPAF+EKL+ILPI+EM KY+DIWNMM YD+H
Sbjct: 214 REGMDQLERQIFGSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFH 273

Query: 298 GEWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICL 357
           GEWS+ TGYH NLY         +H++ + +  S   L + +A++ M +   ++S +I L
Sbjct: 274 GEWSDVTGYHSNLYLQG-----HSHRRSLSNRISNSSLSSDTAVKLMTDRHNISSRRIAL 328

Query: 358 GMAAYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVS 417
           GMAAYGRGFTNV  ++ D  ++ K +HGVGG S+GEPG+WLYNQLPI G+ E FD + VS
Sbjct: 329 GMAAYGRGFTNV--ETNDDNYLGKKYHGVGGGSEGEPGIWLYNQLPIDGSKEQFDSNAVS 386

Query: 418 GFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEI 477
            +C+   S+TFVGYD+V+S+  K +Y+++KNL GGFWWESCGD   +  +SL+NAF+ EI
Sbjct: 387 AYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEI 445

Query: 478 KFVSKFDDLMYRQTPVLRYYVNKFGNDAFLSPF 510
                F  L ++   V ++++ K+  D   S F
Sbjct: 446 GLSEGFVSL-FKSDKVKQFHLQKYPKDYISSLF 477

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  413 bits (1061), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 232/517 (44%), Positives = 315/517 (60%), Gaps = 40/517 (7%)

Query: 1   MQRRPWLSHTXXXXXXXXXXXXEMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNPGTVE 60
           M+R P   +T            EM F  K+      R++    + +P +    T P    
Sbjct: 1   MRRFPTPVYTIWILILVAAIVLEMTFLPKLIKEKLSRRI----RPKPLEVHEETRPVPDA 56

Query: 61  P---GQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDV 117
           P   G+Y  G+YYS+WSPY PR+H+P +ID  RV+H+YYAFF+VD  TG +   D+WSD 
Sbjct: 57  PYPDGEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDT 116

Query: 118 GMDLYKPMAIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMC 177
            M    PM             +L    R L NG +GEL Y++       R   DFK++M 
Sbjct: 117 KM----PM-------------NLTGMPRGL-NGAIGELNYLKT------RPGTDFKLMMA 152

Query: 178 VGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLA 237
           VGGWSNRE F K+VR+ ++ + FIDS I+ MF+YGFDGIDLDWEFP+DDG+EPQMYL++ 
Sbjct: 153 VGGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMC 212

Query: 238 KRLKERMNELEDAIFGP-NMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDY 296
            RL+ +M+ELED I+GP     P+F LSMA PAF + L I P+ EM+KY+ +WNMMTYDY
Sbjct: 213 SRLRHKMDELEDNIWGPGGTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDY 272

Query: 297 HGEWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLD---AHSAIEHMLNVAGVNSH 353
           HG WSE+TGYH NLYN +   +     K  Y    ++  D   AH AI  M     V+  
Sbjct: 273 HGAWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPR 332

Query: 354 KICLGMAAYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDP 413
           KI LGMAAYGRGFTNV  +   ++ I + + GVGG S+GEPGMWLYNQLP+    E FD 
Sbjct: 333 KIALGMAAYGRGFTNV--RGDGEQLIGQKYSGVGGGSEGEPGMWLYNQLPLAHGPEKFDN 390

Query: 414 DYVSGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAF 473
            +VS + Y   +KT V YD+V+S++ K +YV++K LAG F WESCGD+  ++ R+L+ AF
Sbjct: 391 VWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAF 450

Query: 474 TNEIKFVSKFDDLMYRQTPVLRYYVNKFGNDAFLSPF 510
           T  +K   K     Y+ + +++YY+ +   + FL P 
Sbjct: 451 TENMKGARK--ATAYKDSKLIQYYL-RTRPEGFLVPM 484

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  407 bits (1046), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 216/466 (46%), Positives = 308/466 (66%), Gaps = 46/466 (9%)

Query: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNP--GTVEPGQYLSGLYYSNWSPYSPRM 80
           EM F  K+     ++   D  ++       +T P    ++ G+Y  G+YY++WSPY PR+
Sbjct: 23  EMTFIPKLMIEKFKKPRSDIERTA---LSTITRPVDRNLQHGKYAVGVYYTSWSPYEPRL 79

Query: 81  HFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNKLNPEVKNDL 140
           HFPHDID  RV+++ YAFF+VD  TG ++  D WSD+ M  + P                
Sbjct: 80  HFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAPG--------------- 124

Query: 141 ERQRRILPNGC---LGELFYM---RNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNP 194
                 +P G    +GEL Y+   RN N         F++ M VGGWSNRE FPK+VR+ 
Sbjct: 125 ------IPQGVTGMIGELNYLKLQRNTN---------FRLFMAVGGWSNREAFPKIVRSE 169

Query: 195 KRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGP 254
           +++  F++S I+ MF+YGFDGIDLDWEFP+DDG+EP MYL++  RL+ +M++LED I+G 
Sbjct: 170 EKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGA 229

Query: 255 N-MNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNG 313
           N  ++PKF+LS+ATPAFS+ L ILPI EM+K++ IWNMMTYD+HG WS++TGYH NLY+G
Sbjct: 230 NNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDG 289

Query: 314 STKSFDETHQKHI--YSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGFTNVVA 371
           + K+ DE  ++       +  EGL+A  AI+ M+    V++ K+ LGM AYGRGFTNV  
Sbjct: 290 N-KNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQT 348

Query: 372 QSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFVGY 431
           +  D   ++K + GVGG S+GEPG+WLYNQLP+  T E FD  +VS +C+    KTFVGY
Sbjct: 349 KDDDD-LLNKKYSGVGGGSEGEPGIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGY 407

Query: 432 DSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEI 477
           D+++S+  K+ YV++K+L+GGF+WESCGD H +  R+L+ AF+ E+
Sbjct: 408 DNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQEL 453

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  403 bits (1036), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 206/460 (44%), Positives = 286/460 (62%), Gaps = 30/460 (6%)

Query: 66  SGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPM 125
           SG+YYSNWSPY  R HFPHDID  R++ ++Y+F +V+G TG  +L DEWSDV MDLYK M
Sbjct: 73  SGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQM 132

Query: 126 AIKLNKLNPEVKNDLERQ-----RRILPNGCLGELFYMRNANLFPN----RNIRDFKVIM 176
                K+      DL+RQ     R  LP GC+GELFY++  +         ++++FK IM
Sbjct: 133 FSAFEKV------DLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIM 186

Query: 177 CVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQL 236
            VGGWSNRE F  +V++P ++  FI+SC++ MFKYGFDGID+DWEFP++D  EP+ YL +
Sbjct: 187 SVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDM 246

Query: 237 AKRLKERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDY 296
            + L++++++LE  IFG   +   F L+ A  A    L+ LP+ E+D+Y+D WN+M YD+
Sbjct: 247 MRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDF 306

Query: 297 HGEWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKIC 356
            G WS  T Y  NLY+ S+             +E+ EG  A +A+  +LN   + + KI 
Sbjct: 307 SGAWSRHTAYQSNLYSRSSLG---------KRSENSEGGSADTAVRLLLNKHKLPAKKIV 357

Query: 357 LGMAAYGRGFTNV-VAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDY 415
           LGM AYGRGF  V V   ++   I + F  V G S+GE G+ LYNQLP++G  E FD D 
Sbjct: 358 LGMPAYGRGFKGVSVPHHSEHNVIGQSFQQVSGLSEGESGISLYNQLPLKGGQEWFDQDA 417

Query: 416 VSGFCYSSTSKT----FVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLN 471
           VS +     S       V YD+V+S++ KAQYV + NL GGFWWESCG+++ + SRSL  
Sbjct: 418 VSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTR 477

Query: 472 AFTNEIKFVSKFDDLMYRQTPVLRYYVNKFGNDAFLSPFI 511
           AFT EIK+++K    +Y    V  YY  K+  D FL+  I
Sbjct: 478 AFTQEIKYLNKTVPTIYALPQVGEYYHKKY-PDGFLASII 516

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  395 bits (1014), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 195/445 (43%), Positives = 283/445 (63%), Gaps = 24/445 (5%)

Query: 64  YLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYK 123
           +++G+YYSNWSPY+ R HFPHDID  +++H+YYAF +V+  TG  +L DEWSDV MDLYK
Sbjct: 71  FVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYK 130

Query: 124 PMAIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRN-----IRDFKVIMCV 178
            M     KL+   +     + + LP GC+GELF+++ +N F  RN     + +FK IM V
Sbjct: 131 QMISSFKKLDLRAQFPTGSKDK-LPLGCIGELFFLKYSN-FLTRNGGSAGVNNFKTIMSV 188

Query: 179 GGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAK 238
           GGWSNRE F  +V +P +++ F+DSC+  MF+YGFDGID+DWEFP++D  EP++YLQ+ K
Sbjct: 189 GGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLK 248

Query: 239 RLKERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHG 298
            L+ER++ LE  IFG   +   F L+ A  A  E L  LP+ E D+Y+D WN+M YD+ G
Sbjct: 249 ALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSG 308

Query: 299 EWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLG 358
            WS +T Y  NLY  +  +   T+ +            A  A+  + + + + S KI LG
Sbjct: 309 AWSAQTAYQSNLYTPAKTNKRSTNGRG----------SADKAVRFLTDKSKLASKKIVLG 358

Query: 359 MAAYGRGFTNV-VAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVS 417
           M AYGRGF  V V+  + +  I KPF  V G+S+GE G+ LY QLP++G  E FD + VS
Sbjct: 359 MPAYGRGFKGVEVSHKSIENVIGKPFQDVSGSSEGEEGISLYKQLPLKGGMEFFDHNAVS 418

Query: 418 GFC----YSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAF 473
            +C    ++      + YD+V+S+  KA YV + +L GGFWWESCG+D+  + +SL+ AF
Sbjct: 419 AYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDY--KGKSLVGAF 476

Query: 474 TNEIKFVSKFDDLMYRQTPVLRYYV 498
           T EIK ++K +  +Y    V+++Y+
Sbjct: 477 TKEIKCLNKTEPTIYSLPEVVQHYL 501

>ZYRO0C02266g Chr3 (176474..181339) [4866 bp, 1621 aa] {ON} similar to
            uniprot|P48563 Saccharomyces cerevisiae YNL297C MON2
            Peripheral membrane protein with a role in endocytosis
            and vacuole integrity interacts with Arl1p and localizes
            to the endosome member of the Sec7p family of proteins
          Length = 1621

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 6/46 (13%)

Query: 269  AFSEKLDILPITEMDKYIDIWN--MMTY----DYHGEWSEKTGYHC 308
            AF+ KL++ P   +DK I+IW+   + Y    D  G +S K+GY C
Sbjct: 1131 AFATKLEVFPSEVLDKCIEIWSGYRIVYGDITDSSGSYSRKSGYDC 1176

>NCAS0A14310 Chr1 complement(2817732..2820035) [2304 bp, 767 aa]
           {ON} Anc_7.378 YER091C
          Length = 767

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 218 LDWEFPEDDGFEPQMYLQLAKRLKERMNELEDA-IFGPNMNHPKFQLSMATPAFSEKLD 275
           L W FP DD  +    LQLA  L++ +N+LE A I    ++ P  +  +   A +E+ D
Sbjct: 572 LRWSFPRDDVNQKTQALQLALALRDEVNDLEAAGIRVIQVDEPAIREGLPLRAGAERSD 630

>CAGL0K09966g Chr11 complement(974931..977090) [2160 bp, 719 aa]
           {ON} highly similar to uniprot|P06103 Saccharomyces
           cerevisiae YOR361c PRT1
          Length = 719

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 58/123 (47%), Gaps = 14/123 (11%)

Query: 363 GRGFTNVVAQS-TDKRFIDKPFHGVGGASDGEPGMWLYN-----QLPIQGTHELFDPDYV 416
            +GF  V   S  D + I K FHG     D +  ++LY+     +L  QG  E  +P+ +
Sbjct: 80  SKGFLFVECGSDVDAKKIIKAFHG--KRLDLKHRLFLYSMRDVEKLSEQGAGEFVEPE-L 136

Query: 417 SGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNE 476
            GF  +ST K+++  +       + Q+V +K+   G +W S  +   +   S  N  TN 
Sbjct: 137 PGFVPTSTLKSWLADED-----GRDQFVIQKDNLTGIFWNSMHESEDDVVESRTNWSTNY 191

Query: 477 IKF 479
           ++F
Sbjct: 192 VRF 194

>SAKL0F12100g Chr6 complement(941686..943989) [2304 bp, 767 aa] {ON}
           highly similar to uniprot|P05694 Saccharomyces
           cerevisiae YER091C MET6 Cobalamin-independent methionine
           synthase involved in amino acid biosynthesis also called
           N5-methyltetrahydrofolate homocysteine methyltransferase
           or 5-methyltetrahydropteroyltriglutamate homocysteine
           methyltransferase
          Length = 767

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 218 LDWEFPEDDGFEPQMYLQLAKRLKERMNELEDA 250
           L W FP DD  +    LQLA  L++ +N+LE A
Sbjct: 571 LRWSFPRDDVNQETQALQLALALRDEVNDLEAA 603

>KNAG0C03640 Chr3 (712317..714620) [2304 bp, 767 aa] {ON} Anc_7.378
           YER091C
          Length = 767

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 9/77 (11%)

Query: 218 LDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDIL 277
           L W FP DD  +     QLA  L++ +N+LE A  G  +      + +  PA  E L + 
Sbjct: 572 LRWSFPRDDVDQKTQAFQLALALRDEVNDLEAA--GIRV------IQVDEPALREGLPLR 623

Query: 278 PITEMDKYIDIWNMMTY 294
              E D Y  +W+   +
Sbjct: 624 SGAERDSY-KVWSAEAF 639

>Skud_5.212 Chr5 complement(333916..336219) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 8/68 (11%)

Query: 218 LDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDIL 277
           L W FP DD  +    +QLA  L++ +N+LE A  G N+      + +  PA  E L + 
Sbjct: 572 LRWSFPRDDVDQKTQAMQLALALRDEVNDLEAA--GINV------IQVDEPALREGLPLR 623

Query: 278 PITEMDKY 285
              E   Y
Sbjct: 624 EGAERSAY 631

>ZYRO0B03036g Chr2 complement(245870..248173) [2304 bp, 767 aa] {ON}
           highly similar to uniprot|P05694 Saccharomyces
           cerevisiae YER091C MET6 Cobalamin-independent methionine
           synthase involved in amino acid biosynthesis also called
           N5-methyltetrahydrofolate homocysteine methyltransferase
           or 5-methyltetrahydropteroyltriglutamate homocysteine
           methyltransferase
          Length = 767

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 218 LDWEFPEDDGFEPQMYLQLAKRLKERMNELEDA 250
           L W FP DD  +    LQLA  L++ +N+LE A
Sbjct: 572 LRWSFPRDDVDQQTQALQLALALRDEVNDLEAA 604

>ZYRO0G04554g Chr7 complement(366792..367448) [657 bp, 218 aa] {ON}
           similar to uniprot|P00572 Saccharomyces cerevisiae
           YJR057W CDC8 Thymidylate and uridylate kinase functions
           in de novo biosynthesis of pyrimidine
           deoxyribonucleotides converts dTMP to dTDP and dUMP to
           dUTP essential for mitotic and meiotic DNA replication
           homologous to S. pombe Tmp1p
          Length = 218

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 50/117 (42%), Gaps = 7/117 (5%)

Query: 126 AIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNRE 185
           +I L+KL P  +  ++   R  P G L   +    +   P+++I    ++     W   +
Sbjct: 22  SILLDKLKPNAEL-VKFPDRTTPIGQLINRYLTDESFQLPDQSIH---LLFSANRWELSQ 77

Query: 186 EFPKMVRNPKRV--DKFIDSCIETMFKYGFDGIDLDWEFPEDDGF-EPQMYLQLAKR 239
                + + K V  D+++ S I      G DG+D DW    D G  +P +   L+ R
Sbjct: 78  SLQNTLLSGKHVIMDRYVYSGIAYSLAKGIDGMDFDWCIQPDKGLIKPDLLFFLSNR 134

>YER091C Chr5 complement(339864..342167) [2304 bp, 767 aa] {ON}
           MET6Cobalamin-independent methionine synthase, involved
           in methionine biosynthesis and regeneration; requires a
           minimum of two glutamates on the methyltetrahydrofolate
           substrate, similar to bacterial metE homologs
          Length = 767

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 218 LDWEFPEDDGFEPQMYLQLAKRLKERMNELEDA 250
           L W FP DD  +    +QLA  L++ +N+LE A
Sbjct: 572 LRWSFPRDDVDQKTQAMQLALALRDEVNDLEAA 604

>Smik_5.232 Chr5 complement(348431..350734) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 218 LDWEFPEDDGFEPQMYLQLAKRLKERMNELEDA 250
           L W FP DD  +    +QLA  L++ +N+LE A
Sbjct: 572 LRWSFPRDDVDQKTQAMQLALALRDEVNDLEAA 604

>ABR212C Chr2 complement(802388..804694) [2307 bp, 768 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER091C
           (MET6)
          Length = 768

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 218 LDWEFPEDDGFEPQMYLQLAKRLKERMNELEDA 250
           L W FP DD  +    LQLA  L++ +N+LE A
Sbjct: 571 LRWSFPRDDIDQRTQALQLAFALRDEVNDLESA 603

>TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON}
           Anc_1.357 YHR015W
          Length = 665

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 60/134 (44%), Gaps = 6/134 (4%)

Query: 201 IDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHPK 260
           +DS I    +    G D++ +   +     ++ LQ+ K   +R   ++D  FG  + HP 
Sbjct: 274 LDSKIIIKEELNCAGKDIEIQQQYEKQQNEKLQLQIQKYPNQR---IQDETFGVKLPHPN 330

Query: 261 FQLSMATPAFSEKLDILP-ITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFD 319
                  P +SE+ ++L   + +     I++   Y Y   WS  T  +    N + + F+
Sbjct: 331 SVFVKNLPLYSEEEELLDYFSSIGPIKSIFSSKVYRYKSLWSIITYKNNEDANFALEKFN 390

Query: 320 ETH--QKHIYSTES 331
           ET+   K IY T++
Sbjct: 391 ETNYKDKIIYVTKA 404

>Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 218 LDWEFPEDDGFEPQMYLQLAKRLKERMNELEDA 250
           L W FP DD  +    +QLA  L++ +N+LE A
Sbjct: 572 LRWSFPRDDVDQRTQAMQLALALRDEVNDLEAA 604

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,370,052
Number of extensions: 2723476
Number of successful extensions: 6478
Number of sequences better than 10.0: 35
Number of HSP's gapped: 6559
Number of HSP's successfully gapped: 35
Length of query: 523
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 409
Effective length of database: 40,409,475
Effective search space: 16527475275
Effective search space used: 16527475275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)