Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D025905.442ON33033016600.0
Smik_4.6385.442ON34634613670.0
YDR372C (VPS74)5.442ON34534513640.0
Skud_4.6415.442ON34634613610.0
Suva_2.5445.442ON34634613580.0
ZYRO0F10208g5.442ON33233213470.0
KAFR0D050605.442ON32633013080.0
SAKL0G02706g5.442ON33233212980.0
Kwal_55.213995.442ON32933012941e-180
KLTH0F15884g5.442ON32933212861e-179
KNAG0B042005.442ON34434412791e-178
CAGL0A02926g5.442ON32833012501e-173
Kpol_1016.25.442ON32833012361e-171
NCAS0F034305.442ON33233312231e-169
TBLA0A064805.442ON33433512131e-168
Ecym_45135.442ON33333212081e-167
NDAI0B057205.442ON36536511991e-165
KLLA0E02355g5.442ON32432811851e-164
TPHA0J026105.442ON32933011561e-159
ACL165C5.442ON33133211531e-159
Kpol_1062.245.442ON2762649051e-122
TBLA0A027805.442ON3873117901e-103
NCAS0H020905.442ON3452695267e-64
KAFR0C051107.39ON89174722.0
TBLA0B031408.824ON123355677.1
NDAI0A003201.33ON49796677.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D02590
         (330 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   644   0.0  
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   531   0.0  
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   530   0.0  
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   528   0.0  
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   527   0.0  
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   523   0.0  
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   508   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   504   0.0  
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   503   e-180
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   499   e-179
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   497   e-178
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   486   e-173
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   480   e-171
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   475   e-169
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   471   e-168
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   469   e-167
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   466   e-165
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   461   e-164
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   449   e-159
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   448   e-159
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   353   e-122
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   308   e-103
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   207   7e-64
KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7...    32   2.0  
TBLA0B03140 Chr2 (732288..735989) [3702 bp, 1233 aa] {ON} Anc_8....    30   7.1  
NDAI0A00320 Chr1 (45071..46564) [1494 bp, 497 aa] {ON} Anc_1.33        30   7.9  

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/330 (96%), Positives = 318/330 (96%)

Query: 1   MSNLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKITENVKNPKXXXXXXXXX 60
           MSNLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKITENVKNPK         
Sbjct: 1   MSNLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKITENVKNPKLTLMEEVLL 60

Query: 61  XXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASK 120
              RDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASK
Sbjct: 61  LGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASK 120

Query: 121 TGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 180
           TGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR
Sbjct: 121 TGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 180

Query: 181 TEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIAL 240
           TEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIAL
Sbjct: 181 TEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIAL 240

Query: 241 ICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVK 300
           ICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVK
Sbjct: 241 ICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVK 300

Query: 301 EELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           EELSQNKDCPLQLEVVAGVFEVFSRMDMLL
Sbjct: 301 EELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/346 (74%), Positives = 292/346 (84%), Gaps = 16/346 (4%)

Query: 1   MSNLQRRRVNRVDSGDESSLQASEFN----------------ETTTSKRVAYDPEEAKIT 44
           MS LQRRRVNR DSGD SS+Q S  N                +  T+K++AYDPEE+K+ 
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60

Query: 45  ENVKNPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARK 104
           +N+  P             RD+EGYLSFWND+ISYALRGCIIIELALRGKIRI+DDSARK
Sbjct: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120

Query: 105 RFDVSERLIEVVDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQ 164
           RFD+SERLIEV+D SKTGEVLLDETLQLMK DEPLTI+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 165 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNE 224
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEA+KRRVLSVLVSRNMELSYNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 225 YFPDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLD 284
           YFP+TTSFK+IRT+ALICGSY ANVLENVLT+L+YEKRD+A+SRA+EI+ Q++Q+PFDL+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300

Query: 285 KATESGLSINLNKEVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           K TE G+S+NLNKEVKEE+  N    LQLEV+AGVFEVFSRMDMLL
Sbjct: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/345 (74%), Positives = 293/345 (84%), Gaps = 15/345 (4%)

Query: 1   MSNLQRRRVNRVDSGDESSLQASEFN---------------ETTTSKRVAYDPEEAKITE 45
           MS LQRRRVNR DSGD SS+ +S  N               +  T+K++AYDPEE+K+ +
Sbjct: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60

Query: 46  NVKNPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKR 105
           N+  P             RD+EGYLSFWND+ISYALRGCIIIELALRGKIRI+DDSARKR
Sbjct: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120

Query: 106 FDVSERLIEVVDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQV 165
           FD+SERLIEV+D+SKTGEVLLDETLQLMK DEPL+I+NWIDLLSGETWNLLKINYQLKQV
Sbjct: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180

Query: 166 RERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEY 225
           RERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEA+KRRVLSVLVSRNMELSYNEY
Sbjct: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240

Query: 226 FPDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDK 285
           FP+TTSFK+IRT+ALICGSY ANVLENVLT+L+YEKRD+A+SRA+EI+ Q++QYPFDL+K
Sbjct: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300

Query: 286 ATESGLSINLNKEVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
            TE G+S+NLNKEVKEE+  N    LQLEV+AGVFEVFSRMDMLL
Sbjct: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/346 (73%), Positives = 293/346 (84%), Gaps = 16/346 (4%)

Query: 1   MSNLQRRRVNRVDSGDESSLQASEFNETT----------------TSKRVAYDPEEAKIT 44
           MS LQRRRVNR DSGD SS+Q+   N+ +                 +K++AYDPEE+K+ 
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSMSNNDNSKGDKIANIGIDDDDSGANKKIAYDPEESKLR 60

Query: 45  ENVKNPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARK 104
           +N+K P             RD+EGYLSFWND+ISYALRGCI+IELALRGKIRI+DDSARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 105 RFDVSERLIEVVDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQ 164
           RFD+SERL+EVVD SKTGEVLLDETLQLMK DEPLTI+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 165 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNE 224
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEA+KRRVLSVLVSRNMELSYNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 225 YFPDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLD 284
           YFP+TTSFK+IRT+ALICGSY ANVLENVLT+L+YEKRD+A++RA+EI+ Q++QYPFDL+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDLE 300

Query: 285 KATESGLSINLNKEVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           K TE G+S+NLNKEVKEE+  N    LQLEV+AGVFEVFSRMDMLL
Sbjct: 301 KETELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/346 (73%), Positives = 292/346 (84%), Gaps = 16/346 (4%)

Query: 1   MSNLQRRRVNRVDSGDESSLQASEFNETTTS----------------KRVAYDPEEAKIT 44
           MS LQRRRVNR DSGD SS+Q++  N  ++                 K++AYDPEE+K+ 
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60

Query: 45  ENVKNPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARK 104
           +N+K P             RD+EGYLSFWND+ISYALRGCI+IELALRGKIRI+DDSARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 105 RFDVSERLIEVVDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQ 164
           RFD+SERL+EV+D SKTGEVLLDETLQLMK DEPLTI+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 165 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNE 224
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEA+KRRVLSVLVSRNMELSYNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 225 YFPDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLD 284
           YFP+TTSFK+IRT+ALICGSY ANVLENVLT+L+YEKRD+A+SRA+EI+  ++QYPFDL+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300

Query: 285 KATESGLSINLNKEVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           K T+ G+S+NLNKEVKEE+  N    LQLEV+AGVFEVFSRMDMLL
Sbjct: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/332 (77%), Positives = 287/332 (86%), Gaps = 2/332 (0%)

Query: 1   MSNLQRRRVNRVDSGDESS--LQASEFNETTTSKRVAYDPEEAKITENVKNPKXXXXXXX 58
           MS LQRRRVNRVDS   ++   +  E  E ++SK+VAYDPEE K+T+NV+ PK       
Sbjct: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKLTLMEEV 60

Query: 59  XXXXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDA 118
                RDKEGYLSFWNDNISYALRGCI+IELALRGKIR++DDSARKRFDVSERLIEV D+
Sbjct: 61  LLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDS 120

Query: 119 SKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 178
           SKTGEVLLDE LQLMK DEPL+I NWIDLLSGETWN LKINYQLKQVRERLAKGLVDKGV
Sbjct: 121 SKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGV 180

Query: 179 LRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTI 238
           LRTEMKNFFLFDMATHPVTDTSCKEA+KRR+LSVLV RN+EL+YN+YF +  SFKLIRTI
Sbjct: 181 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTI 240

Query: 239 ALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKE 298
           ALICG+YRANVLENVLTSL YEKRD A+ RADEIL+Q+++YPFDLD  TESG+SINLNKE
Sbjct: 241 ALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKE 300

Query: 299 VKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           V +EL Q+ +  LQLEV+AGVFEVFSRMDMLL
Sbjct: 301 VGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/330 (75%), Positives = 278/330 (84%), Gaps = 4/330 (1%)

Query: 1   MSNLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKITENVKNPKXXXXXXXXX 60
           MS LQRRR NR DS  + S   SE    +  ++VAYDPEEAK+ +NV  PK         
Sbjct: 1   MSTLQRRRKNRSDSNADDSENVSE----SQDRKVAYDPEEAKLRDNVSIPKLTLMEEVLL 56

Query: 61  XXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASK 120
              RD+EGYLSFWNDNISYALRGCI+IELALR KIRI+DDSARKRFDVSERL+EV+D SK
Sbjct: 57  MGLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKRFDVSERLVEVIDGSK 116

Query: 121 TGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 180
           TGEVLLDE LQLMK DEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR
Sbjct: 117 TGEVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 176

Query: 181 TEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIAL 240
           TEMKNFFLFDMATHPVTDTSCKEA+KRR+LS LVSRNMEL+YN YF +TTSFK IR +AL
Sbjct: 177 TEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYFAETTSFKYIRIVAL 236

Query: 241 ICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVK 300
           +C SY ANVLENVL+SLDYEKRDRA+SRA+EIL Q+ QYPFDL K TE G+S+NLNKEV+
Sbjct: 237 VCCSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSKNTELGISVNLNKEVE 296

Query: 301 EELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
            E+++N    LQLEV+AGV EVFSRMDMLL
Sbjct: 297 NEVNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  504 bits (1298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/332 (74%), Positives = 281/332 (84%), Gaps = 2/332 (0%)

Query: 1   MSNLQRRRVNRVDSG-DESSLQASEFN-ETTTSKRVAYDPEEAKITENVKNPKXXXXXXX 58
           MS LQRRRVNR +S   E  + +S+ N E    ++VAYDPEEAK+ EN   PK       
Sbjct: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60

Query: 59  XXXXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDA 118
                +DKEGYLSFWNDNISYALRGCI+IELALR KIR++DD ARKRFDVS+RLIEV+D 
Sbjct: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120

Query: 119 SKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 178
           SKTGEVLLDE L L+K DEPL IANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV
Sbjct: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180

Query: 179 LRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTI 238
           LRTEMKNFFLFDMATHP+TDTSCKEA+KRRVLSVLVSRNMEL+YNEYF +  +FK+IRT+
Sbjct: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240

Query: 239 ALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKE 298
           +LICG+Y ANVLENVL SLDY+KRDRA SRADEIL Q++++PF LDKATESG+S+NLNKE
Sbjct: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300

Query: 299 VKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           V+ E++QN    LQLEVVAGVFEVFSRMD LL
Sbjct: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  503 bits (1294), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 243/330 (73%), Positives = 281/330 (85%), Gaps = 1/330 (0%)

Query: 1   MSNLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKITENVKNPKXXXXXXXXX 60
           MS LQRRRVN+ +S  +S    SE  E   SKRVAYDPEEA + +N   PK         
Sbjct: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGE-SKRVAYDPEEAMLKDNATIPKLNLMEEVLL 59

Query: 61  XXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASK 120
              +DKEGYLSFWNDNISYALRGCI+IELALRGKI++++DSARKRFDVSERL+EV++A+K
Sbjct: 60  MGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATK 119

Query: 121 TGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 180
           TGEVLLDE L LMK DEPLTIANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGVLR
Sbjct: 120 TGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLR 179

Query: 181 TEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIAL 240
           TEMKNFFLFDM THP+TDTSCKEA+KRR+LSVLVSRNM+L+YNEYFP + SFKL+RT++L
Sbjct: 180 TEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSL 239

Query: 241 ICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVK 300
           ICG+Y ANVLENVL SLDYEKRDRA SRADEIL Q++Q+PF LDK TE+G+S+N+NKE++
Sbjct: 240 ICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQ 299

Query: 301 EELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           EE+  N D  L+LEVVAGVFEVFSRMD LL
Sbjct: 300 EEIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  499 bits (1286), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 243/332 (73%), Positives = 280/332 (84%), Gaps = 5/332 (1%)

Query: 1   MSNLQRRRVNRVDSGDESSLQASEFNETT--TSKRVAYDPEEAKITENVKNPKXXXXXXX 58
           MS LQRRRVN+ +S    S Q    N+ T    KRVAYDPEEAK+ ++   PK       
Sbjct: 1   MSGLQRRRVNKSES---ISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEV 57

Query: 59  XXXXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDA 118
                +DKEGYLSFWNDNISYALRGCI+IELALRGKI++++D ARKRFDVSERL+EV++A
Sbjct: 58  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINA 117

Query: 119 SKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 178
           +KTGEVLLDE L LMK DEPLTIANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGV
Sbjct: 118 TKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGV 177

Query: 179 LRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTI 238
           LRTEMKNFFLFDM THP+TDTSCKEA+KRR+LSVLVSRNM+L+YNEYFP +  FKLIRT+
Sbjct: 178 LRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTL 237

Query: 239 ALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKE 298
           +LICG+Y ANVLENVL+SLDYEKRDRA SRADEIL Q++Q+PF LDK TE+G+S+NLNKE
Sbjct: 238 SLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKE 297

Query: 299 VKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           V+EE+  N+D  LQLE VAGVFEVFSRMD LL
Sbjct: 298 VQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  497 bits (1279), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 244/344 (70%), Positives = 285/344 (82%), Gaps = 14/344 (4%)

Query: 1   MSNLQRRRVNRVDSGD-------------ESSLQASEFNETT-TSKRVAYDPEEAKITEN 46
           MS LQRRRVNR DS +              +S  A E+ ET+  +++VAYDPEEAK+ +N
Sbjct: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60

Query: 47  VKNPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRF 106
              PK            RD+EGYLSFWNDNISYALRGCI+IELALR KIRI+DDSARKRF
Sbjct: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120

Query: 107 DVSERLIEVVDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVR 166
           D+SERL+EVVD SKTGEVLLDETLQLMK DEPLTIANWIDLLSGETWNL+KINYQLKQVR
Sbjct: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180

Query: 167 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYF 226
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTD+SCKEA+KRR+LS +VSRNMELS+N YF
Sbjct: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240

Query: 227 PDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKA 286
           P++TSFK IRT+AL+C +Y A+VLENVL+SLDYE+RDRA+SRA+E+LE++ QYPFDL+K 
Sbjct: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300

Query: 287 TESGLSINLNKEVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
            +SG+S NLNKE + E+ ++ +  L LEVVAGV EVFSRMDMLL
Sbjct: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  486 bits (1250), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 232/330 (70%), Positives = 283/330 (85%), Gaps = 2/330 (0%)

Query: 1   MSNLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKITENVKNPKXXXXXXXXX 60
           MS LQRRRVN+ ++   + ++  E ++ T+S ++AYDPEE+K+  + K P          
Sbjct: 1   MSTLQRRRVNKSENAS-NGIEDRE-DDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEVLL 58

Query: 61  XXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASK 120
              RD+EGYLSFWND+ISYALRGCI+IELALR KIRI+D  AR RFD+SERLIEV+D+SK
Sbjct: 59  MGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSK 118

Query: 121 TGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 180
           TGEVLLDETLQLM  DEPL+IANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR
Sbjct: 119 TGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 178

Query: 181 TEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIAL 240
           TEMKNFFLFDMATHPV+D+SCKEA+KRR+LSVLVSRNME+SYN YFP++T+FKLIRT++L
Sbjct: 179 TEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSL 238

Query: 241 ICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVK 300
           I G+Y ANVLENV++SL+Y+KRD+A++RA+EIL Q++QYPFDL K ++ G+S+NLNKE++
Sbjct: 239 IAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQ 298

Query: 301 EELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           EEL  N    L+LEV+AGVFEVFSRMDMLL
Sbjct: 299 EELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  480 bits (1236), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 232/330 (70%), Positives = 274/330 (83%), Gaps = 2/330 (0%)

Query: 1   MSNLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKITENVKNPKXXXXXXXXX 60
           MS+LQRRR+NR++S    S    E  E + S ++AYDPEEAK+ ++V  P          
Sbjct: 1   MSSLQRRRLNRINSDTAESSNDDE--ERSKSTKIAYDPEEAKLKDDVTVPTLTLMEEVVL 58

Query: 61  XXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASK 120
               DK+GYLSFWNDNISY LRGCIIIELALR KIRI+DD ARKRFD+SERL+EVVD SK
Sbjct: 59  LGLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKRFDLSERLVEVVDGSK 118

Query: 121 TGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 180
           TGEVLLDE LQLMK DEPL+IANWIDLLSGETWN  KINYQLKQVRER++KGLVDKGVLR
Sbjct: 119 TGEVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQVRERISKGLVDKGVLR 178

Query: 181 TEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIAL 240
           TEMKNFFLFDMATHPVTDTSCKEA+KRR+LS LVSR MEL+YNEYFP+TT +K+IRTIAL
Sbjct: 179 TEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEYFPETTQYKVIRTIAL 238

Query: 241 ICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVK 300
           IC SY ANVLENVL+SL+YEKRD A++R++ IL ++ QYPF LDKA++  +SINL+K V+
Sbjct: 239 ICSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDKASDIKVSINLSKLVE 298

Query: 301 EELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           +E++QN    LQLE VAGVF+VFS+MDM+L
Sbjct: 299 DEIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  475 bits (1223), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 232/333 (69%), Positives = 279/333 (83%), Gaps = 4/333 (1%)

Query: 1   MSNLQRRRVNRVDSGDES-SLQASEFNETTTSKRVAYDPEEAKITENVKN--PKXXXXXX 57
           MS LQRRRVN+ DS +E+ S+  +   ++    +VAYDPEEA++  NV    P       
Sbjct: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNKVAYDPEEARM-RNVGGQVPVLTLMEE 59

Query: 58  XXXXXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVD 117
                 RDKEGYLSFWNDNISYALRGCI+IELALRGKI+I+DDSARKRF++SERL++V+D
Sbjct: 60  VLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVID 119

Query: 118 ASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKG 177
            +KTGEVLLDETLQLMK DEPL+IA+WIDLLSGETWN++KINYQLKQVRERLAKGLVDKG
Sbjct: 120 GTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKG 179

Query: 178 VLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRT 237
           VLRTEMKNFFLFDMATHPVTD+SCKEA+KRRVLS+LVSRNMELSYN YFP+TT FK+IRT
Sbjct: 180 VLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRT 239

Query: 238 IALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNK 297
           IALICG+Y ANVLEN+L SLD+E  D A++RADE++ Q++++PFDL+  T  G+S+NLN+
Sbjct: 240 IALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNR 299

Query: 298 EVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           EV++EL+      LQLEV+AGV EVFSRMD LL
Sbjct: 300 EVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  471 bits (1213), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 234/335 (69%), Positives = 274/335 (81%), Gaps = 6/335 (1%)

Query: 1   MSNLQRRRVN-RVDSGDESSLQASEFNETTT----SKRVAYDPEEAKITENVKNPKXXXX 55
           MS LQRRR   R DS   S   +++ NE T     S+RVAYDPEE KI  N+  P+    
Sbjct: 1   MSTLQRRRKQARSDSVGSSGTDSND-NEPTNRQAESRRVAYDPEEDKIRNNMSVPQLTLM 59

Query: 56  XXXXXXXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEV 115
                   RDKEGYLSFWNDNISYALRGCIIIELALRGKIRI+DD ARKRF++SERL+EV
Sbjct: 60  EEVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPARKRFELSERLVEV 119

Query: 116 VDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVD 175
           VD+SKTGEVLLDE LQ+M+ DEPL I+NW+DLLSGETWN+ KINYQLKQVRER++KGLVD
Sbjct: 120 VDSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINYQLKQVRERISKGLVD 179

Query: 176 KGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLI 235
           KGVLRTEMKNFFLFDMATHPVTD+SCKEA+KRR+LS+LV+R  E +YN+YFP+TTSFK I
Sbjct: 180 KGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYNDYFPETTSFKYI 239

Query: 236 RTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINL 295
           RTI+LIC +Y ANVLENVL SL+Y+KRD  L+RA+E+LEQ++QYPFDL+K TE G SINL
Sbjct: 240 RTISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDLEKQTEFGTSINL 299

Query: 296 NKEVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           N  VKEE+  +    L LEVVAGVFEVFS+MD+LL
Sbjct: 300 NALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  469 bits (1208), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 225/332 (67%), Positives = 269/332 (81%), Gaps = 4/332 (1%)

Query: 3   NLQRRRVNRVDSGDES----SLQASEFNETTTSKRVAYDPEEAKITENVKNPKXXXXXXX 58
           +LQRRRVN+ + G  S      +  E  +   S +VAYDPE+ K+ EN K P        
Sbjct: 2   SLQRRRVNKAEVGGTSVELTQRKHGEDEDDKGSHKVAYDPEDQKLRENTKEPTLTLMEEV 61

Query: 59  XXXXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDA 118
                +DKEGYLSFWND+ISY+LRGCI+IELALRGKIR+++D+ARKRFD+SERL+EV++ 
Sbjct: 62  LLMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRFDLSERLVEVIET 121

Query: 119 SKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 178
           SKTGE LLDETL LMK +EPL+I NWIDLLSGETWNLLKI+YQLKQVRERLAKGLVDKGV
Sbjct: 122 SKTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVRERLAKGLVDKGV 181

Query: 179 LRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTI 238
           LRTEMKNFFLFDMATHPV D+SCKE++KRR+LSVLV RN+ L Y EYFP++ +FK +RTI
Sbjct: 182 LRTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYFPESVAFKYLRTI 241

Query: 239 ALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKE 298
           ALICG+Y ANVLENVL+SLDYEKR+R  SRA+EIL Q++QYPF LDK  E+G+S+NL  +
Sbjct: 242 ALICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKDVETGISVNLYNQ 301

Query: 299 VKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           VKEE+ +N    LQLEVVAGVFEVFSRMD  L
Sbjct: 302 VKEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  466 bits (1199), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 241/365 (66%), Positives = 275/365 (75%), Gaps = 35/365 (9%)

Query: 1   MSNLQRRRVNR---------VDS---------GDESSLQASEFNETTTSKRVAYDPEEAK 42
           MS LQRRR  +         VDS         G  +S      + T  S ++AYDPEEAK
Sbjct: 1   MSTLQRRRRPQDGSNKGMVDVDSDNNDSSRILGSNNSNNNVSNSNTFGSSKIAYDPEEAK 60

Query: 43  I-----------------TENVKNPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCI 85
           +                   N   P             RDKEGYLSFWNDNISYALRGCI
Sbjct: 61  LLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI 120

Query: 86  IIELALRGKIRIIDDSARKRFDVSERLIEVVDASKTGEVLLDETLQLMKYDEPLTIANWI 145
           +IELALRGKIRI+DDSARKRFD+SERLIEV D SKTGEVLLDETLQLMK DEPLTIANWI
Sbjct: 121 LIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANWI 180

Query: 146 DLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAL 205
           DLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTD+SCKEA+
Sbjct: 181 DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 240

Query: 206 KRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRA 265
           KRRVLSVLVSRNME +YNEYFP  T FK+IRTIALICG+Y ANVLENVL+SLDYEK D A
Sbjct: 241 KRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNA 300

Query: 266 LSRADEILEQYTQYPFDLDKATESGLSINLNKEVKEELSQNKDCPLQLEVVAGVFEVFSR 325
           ++RADE++ Q++++PFDL+K T + +S+NLN+ V++EL +N    LQLEV+AGV EVFSR
Sbjct: 301 IARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSR 360

Query: 326 MDMLL 330
           MD LL
Sbjct: 361 MDTLL 365

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  461 bits (1185), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/328 (67%), Positives = 263/328 (80%), Gaps = 5/328 (1%)

Query: 3   NLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKITENVKNPKXXXXXXXXXXX 62
           +LQRRRVN+ D+ +      +E +      ++ YD +EAK+ +N   PK           
Sbjct: 2   SLQRRRVNKGDTTESIPQIDNEHDH-----KIVYDEQEAKLRDNTSVPKLTLMEEVLLMG 56

Query: 63  XRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASKTG 122
            +DK+GYLSFWNDNISYALRGCI+IELALRGKIR +DD ARKR+DVSERLIEV+D SKTG
Sbjct: 57  LKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTG 116

Query: 123 EVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE 182
           EVLLDE+L LMK D P +I  WIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE
Sbjct: 117 EVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE 176

Query: 183 MKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIALIC 242
           MKNFFLFDMATHP+TDT+CKE++KRR+LS+LVSRN EL+YN YFP   SFK IRT++LIC
Sbjct: 177 MKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLIC 236

Query: 243 GSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVKEE 302
           G+Y ANVLENVL +LDYE RD   +RADEIL Q++++PF LDK T +G+S+NLNKE+ +E
Sbjct: 237 GAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQE 296

Query: 303 LSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           L+ +    LQLEVVAGVFEVFSRMD LL
Sbjct: 297 LNNHPGSDLQLEVVAGVFEVFSRMDTLL 324

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  449 bits (1156), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/330 (65%), Positives = 266/330 (80%), Gaps = 1/330 (0%)

Query: 1   MSNLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKITENVKNPKXXXXXXXXX 60
           MS +QRRR+NR+ + DES    ++ + +  SK VA+DPEEAKI ++V  PK         
Sbjct: 1   MSGVQRRRINRISNEDESDHSDNDQSRSNVSK-VAFDPEEAKIKDDVSVPKLTLMEEVVL 59

Query: 61  XXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASK 120
               D EGYLSFWNDNISY LRGCI+IELALRGKIRIIDDSARK FD+SERLIEV+DASK
Sbjct: 60  LGLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKSFDLSERLIEVIDASK 119

Query: 121 TGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 180
           TGEVLLDETLQLMK DEP +I +WIDLLSGETWN  K+NYQLKQVRERL+KGLVDKGVLR
Sbjct: 120 TGEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQVRERLSKGLVDKGVLR 179

Query: 181 TEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIAL 240
           TEMKNFFLFDMATHPV D+SCKE+LKRR++S LV R + L YNEYFP++T+FK+IRT++L
Sbjct: 180 TEMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNEYFPESTTFKVIRTVSL 239

Query: 241 ICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVK 300
           I  +Y ANVLENVL +L+YEKRD+ALSRA+ +L  +  YPF L    ++ +SINLN+ V+
Sbjct: 240 IITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLVNEPDNRISINLNQLVE 299

Query: 301 EELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           +E+  N    LQLEV+AGVF+VF++MD+++
Sbjct: 300 DEIKANPKTALQLEVLAGVFDVFAKMDVII 329

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  448 bits (1153), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 222/332 (66%), Positives = 264/332 (79%), Gaps = 6/332 (1%)

Query: 3   NLQRRRVNRVDSGDE----SSLQASEFNETTTSKRVAYDPEEAKITENVKNPKXXXXXXX 58
           +LQRRRVN+  +G+E    +SL  S+  E  T K VAYDPEE K+ EN + P        
Sbjct: 2   SLQRRRVNKT-AGNETVGGASLNRSDEEEGMTHK-VAYDPEEQKLRENTREPTLTLMEEV 59

Query: 59  XXXXXRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDA 118
                +DKEGYLSF N+NISYALRGCI+IELALRG+I+++DD+ R+RFD SERLIEVVD 
Sbjct: 60  LLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDG 119

Query: 119 SKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 178
           SKTGE LLDE L LMK  EPLTI NW+DLLSGETWN LKINYQL+QVRERLAKGLVDKGV
Sbjct: 120 SKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGV 179

Query: 179 LRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTI 238
           LRTEMKNFFLFDM THPV DTSCKE++KRR+LSVLV RN+EL Y E FP+T +FK +RTI
Sbjct: 180 LRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTI 239

Query: 239 ALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKE 298
           ALIC ++ ANVLE VL++LDYEKRDR  SRA+E+L Q++QYPF LDK  E+G+S+NLN+ 
Sbjct: 240 ALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRL 299

Query: 299 VKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           V+EEL +N    L LEVVAGV +V+SRMD LL
Sbjct: 300 VQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  353 bits (905), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 163/264 (61%), Positives = 211/264 (79%)

Query: 64  RDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASKTGE 123
           RDKEGYLSFWN+N+S+ LRGCI+IELA RG I++IDD +RKRFD+S+RLIEVV+  KTGE
Sbjct: 10  RDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIEVVNPKKTGE 69

Query: 124 VLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEM 183
            LLDETLQ+MK +E  +I+ WIDLLSGETWN+ KIN QLKQVRER++KGLVDKG+LRTEM
Sbjct: 70  FLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLVDKGILRTEM 129

Query: 184 KNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIALICG 243
           KNFFLFDMATHPV D  CKE +K+R+LSVL+ +   +  +EYFP+T   + +RTIALI  
Sbjct: 130 KNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRCLRTIALILS 189

Query: 244 SYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVKEEL 303
           +Y  +VLENV + LDY+K+D    R  EIL+Q + YPF+ D  + + ++ NLN+ V+ EL
Sbjct: 190 AYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATNLNQLVENEL 249

Query: 304 SQNKDCPLQLEVVAGVFEVFSRMD 327
           S++K+  L+LE +AGVFEVF +MD
Sbjct: 250 SKDKNLNLKLETIAGVFEVFLKMD 273

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  308 bits (790), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 148/311 (47%), Positives = 206/311 (66%), Gaps = 1/311 (0%)

Query: 21  QASEFNETTTSKRVAYDPEEAKITENVKNPKXXXXXXXXXXXXRDKEGYLSFWNDNISYA 80
             S  N         +DPEE+     +  P             +DK+GYLSFWNDNISY 
Sbjct: 77  HYSLINPNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYV 136

Query: 81  LRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVV-DASKTGEVLLDETLQLMKYDEPL 139
           LRGCI+IELALR KI++IDD  R  +DVS R+IEVV   +KTG  LLDE L +M  + P 
Sbjct: 137 LRGCILIELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPE 196

Query: 140 TIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDT 199
           +I NWIDLLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D 
Sbjct: 197 SIMNWIDLLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDI 256

Query: 200 SCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIALICGSYRANVLENVLTSLDY 259
             KE++K+R+ S+LV ++  L YN YFP+  +FK+IR++ LIC +Y A+VL++ L +++Y
Sbjct: 257 GSKESVKQRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNY 316

Query: 260 EKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVKEELSQNKDCPLQLEVVAGV 319
           +  D A  +A+++ E  + +P +LD+   SG+ +++ K+++ EL Q+    L LEVVAGV
Sbjct: 317 DDSDNAFKKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGV 376

Query: 320 FEVFSRMDMLL 330
            +V  RMD LL
Sbjct: 377 LQVILRMDSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  207 bits (526), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 107/269 (39%), Positives = 173/269 (64%), Gaps = 7/269 (2%)

Query: 64  RDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKR-FDVSERLIEVVDASKTG 122
           +DKEGY+S W+  +SY LR C+IIELALRGKI+ + +  +K+     E  IEV+D S TG
Sbjct: 77  KDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAPHECKIEVIDGSITG 136

Query: 123 EVLLDETLQLMKYDEP-LTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 181
           + LLD+TL LMK ++   ++++WI LLSGE+ N LK +YQL  VR+R+ + LV+ G+L  
Sbjct: 137 DPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRKRIERILVETGILSK 196

Query: 182 EMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIALI 241
           + K      + THP+ D  CK A++ R+  +L +  ++L   +YFPDT S++++RTI L 
Sbjct: 197 QTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFPDTVSYRVLRTIVLA 256

Query: 242 CGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVKE 301
           C +Y A++L+      + E       RA  +L  ++++PF+L++A +     +LN++V +
Sbjct: 257 CAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQAVQP----DLNEKVSK 311

Query: 302 ELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330
           EL ++ +   QLEVVAG  +V + +D +L
Sbjct: 312 ELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7.39
           YOR353C
          Length = 891

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 93  GKIRIIDDSARKRFDVSERLIEVVDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSG-E 151
           GK  + D  A K  D+++   + +D SK    +LDE LQL+  ++PL +  ++  +   +
Sbjct: 723 GKQVLTDSLASKIRDLTDTCCQAMDLSK----ILDERLQLLLNNDPLIVEKYLSTVEKLK 778

Query: 152 TWNLLKINYQLKQV 165
           TW   KIN  LK +
Sbjct: 779 TWE--KINAFLKSI 790

>TBLA0B03140 Chr2 (732288..735989) [3702 bp, 1233 aa] {ON} Anc_8.824
           YML104C
          Length = 1233

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 132 LMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNF 186
           L KY EP    NW +LL   + N+LK   Q+ ++++ L+K + D+     E+K+F
Sbjct: 266 LSKYSEP---DNWNELLLSVSKNILKERDQVYEIKKILSKEIRDENFHNEEVKSF 317

>NDAI0A00320 Chr1 (45071..46564) [1494 bp, 497 aa] {ON} Anc_1.33
          Length = 497

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 3/96 (3%)

Query: 210 LSVLVSRNMELSYNEYFPDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRALSRA 269
           L VL +   ++  ++ +     F L      + G Y   VL NVL  L       A  R 
Sbjct: 294 LKVLPTTKYDVDIDQKYSANPGFHLFE--KRVSGMYLGEVLRNVLVDLHKRGLIFAQYRT 351

Query: 270 DEILEQYTQYPFDLDKATESGLSINLNKEVKE-ELS 304
           ++ L    Q PF+LD    S + I+ +  ++E ELS
Sbjct: 352 EKQLPHRLQTPFELDSEVLSHIEIDDSTGLRETELS 387

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,735,775
Number of extensions: 1285846
Number of successful extensions: 4658
Number of sequences better than 10.0: 38
Number of HSP's gapped: 4769
Number of HSP's successfully gapped: 38
Length of query: 330
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 220
Effective length of database: 40,868,139
Effective search space: 8990990580
Effective search space used: 8990990580
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)