Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D025805.443ON1272127266610.0
ZYRO0G01606g5.443ON1305132041780.0
SAKL0G02728g5.443ON1237121736350.0
Suva_8.1765.443ON1270126335770.0
Skud_15.2865.443ON1278122835690.0
YOR124C (UBP2)5.443ON1272122935590.0
Kpol_1062.235.443ON1266122735400.0
Smik_15.3015.443ON1272123335180.0
NDAI0C015505.443ON1295123034800.0
NCAS0H021005.443ON1269124234790.0
Kwal_55.213935.443ON1233124434460.0
KLTH0F15862g5.443ON1241122534170.0
TBLA0A064705.443ON1320126034030.0
KNAG0B041905.443ON1262125433210.0
KAFR0D050705.443ON1227122733190.0
TPHA0E017105.443ON1283122932610.0
CAGL0K10252g5.443ON1267127330380.0
KLLA0E02377g5.443ON1220122830350.0
Ecym_45145.443ON1246123130330.0
Kpol_1016.15.443ON1251121518930.0
ACL164C5.443ON138979118860.0
TPHA0J026205.443ON1225125415790.0
KLLA0A10791g1.369ON4841051273e-06
Kwal_34.162681.369ON449981263e-06
TBLA0C012001.369ON503361192e-05
NCAS0D006001.369ON493641183e-05
Ecym_27171.369ON483351165e-05
KLTH0H13354g1.369ON495391166e-05
TDEL0D024001.369ON494391156e-05
NDAI0H035501.369ON5021391131e-04
Smik_2.497.390ON745471141e-04
ZYRO0G01188g1.369ON500671122e-04
KNAG0C019401.369ON499511122e-04
SAKL0D10120g1.369ON492401103e-04
AEL029W1.369ON446501093e-04
KAFR0I026005.18ON12131111104e-04
NDAI0F034102.69ON870661094e-04
YMR304W (UBP15)5.18ON12301211086e-04
Suva_13.4955.18ON12301051070.001
Smik_14.1442.69ON763681050.001
KNAG0F012202.69ON784681050.001
NCAS0G018002.69ON875681050.001
KLLA0D08459g2.69ON750681050.001
NDAI0B034302.307ON856681050.001
KAFR0C045201.369ON499511040.001
Kpol_534.231.369ON496351040.002
ABL145W2.69ON749681040.002
Suva_14.1562.69ON788681040.002
CAGL0J11352g2.69ON771761040.002
Skud_13.4785.18ON12311051040.002
TDEL0A011002.69ON661681030.002
KAFR0A075802.69ON802681030.002
Smik_13.5215.18ON12311051030.002
Kpol_1003.532.307ON788511020.003
TBLA0B060802.307ON824651020.003
TBLA0B097602.69ON898681020.003
NDAI0G007802.307ON486691010.003
CAGL0K10494g1.369ON495511010.003
TPHA0A025101.369ON505511010.004
SAKL0D03322g3.270ON765571010.004
KAFR0A069102.307ON678481010.004
NCAS0G036802.307ON482561000.004
Kpol_1044.242.69ON724681000.004
KNAG0A054502.307ON764511000.005
Ecym_46857.390ON778551000.005
KAFR0L017307.390ON701771000.005
AGR370W7.390ON740731000.005
Skud_14.1482.69ON776681000.006
Kwal_33.144302.69ON51168990.006
Skud_6.941.369ON49938980.007
Smik_4.1152.307ON79050990.007
Skud_4.1332.307ON78750990.007
Suva_4.1252.307ON79350990.007
SAKL0E07106g2.307ON79149980.008
YDL122W (UBP1)2.307ON80950980.008
NCAS0B061302.307ON77051980.008
NCAS0B005808.742ON466170970.009
Kwal_27.114442.307ON75772980.009
TBLA0E017605.712ON121240980.010
ZYRO0A02420g2.307ON74549970.010
SAKL0E13002g2.69ON73968970.010
KNAG0C035807.390ON77641970.012
Smik_7.3141.369ON49933960.013
CAGL0H10582g2.307ON79048960.013
ZYRO0C09812g2.69ON70266960.014
YNL186W (UBP10)2.69ON79268960.014
TBLA0D010708.742ON48367950.014
KLTH0G10934g2.307ON75874960.015
KLTH0B07150g2.69ON75668960.016
CAGL0M13783g5.18ON119658960.016
NDAI0A016707.390ON84667950.017
NCAS0D023905.18ON121195960.018
Smik_13.4318.742ON47150950.018
Klac_YGOB_Anc_5.18b5.18ON116695950.019
SAKL0H00418g5.18ON1190105950.019
Suva_5.2177.390ON75466950.020
Suva_6.831.369ON50087940.020
YFR010W (UBP6)1.369ON49933940.021
NCAS0A143707.390ON72978940.022
Suva_2.507.390ON75051940.023
TPHA0A025401.137ON128628950.023
Kwal_26.95985.18ON119195940.024
AGL357W5.18ON1166105940.024
Kwal_27.108427.390ON71131940.024
AGR389C2.307ON77549940.026
TDEL0G023702.307ON74765940.026
TPHA0G008502.307ON78282940.027
KAFR0C004103.270ON76983940.027
TPHA0O016402.69ON74668940.028
TBLA0C070205.18ON124759940.028
KNAG0B023707.390ON75333930.034
Suva_4.2953.270ON78251930.036
KLLA0C06974g8.742ON44671920.036
Kpol_2001.541.137ON122329930.037
Suva_6.2761.137ON125689930.039
KLTH0B09944g5.18ON1189105920.042
YER098W (UBP9)7.390ON754105920.043
CAGL0M11198g8.742ON46150910.046
Smik_5.2447.390ON74966920.049
KNAG0J008003.270ON76543910.054
TDEL0C056401.137ON117830910.062
Skud_2.387.390ON74840910.063
Skud_5.2237.390ON74866900.065
Ecym_56715.18ON1176107910.066
YBL067C (UBP13)7.390ON74747900.072
NCAS0E026107.390ON717163900.073
YMR223W (UBP8)8.742ON47199890.080
KLTH0C06732g7.390ON71433890.088
TBLA0E025703.270ON78556890.091
NDAI0I025305.18ON119748890.098
Kpol_513.255.18ON119050890.11
KLLA0A00396g5.712ON101230890.11
NDAI0E008108.742ON49348880.11
YJL197W (UBP12)1.137ON125430890.12
Smik_10.371.137ON124730890.12
TDEL0B020805.712ON102526880.12
ZYRO0C17908g1.137ON120430880.13
Skud_10.221.137ON125530880.14
Ecym_40095.712ON151730880.14
SAKL0H04994g8.742ON45489870.14
ZYRO0A05962g8.742ON46566870.14
KNAG0E012905.18ON119637880.15
SAKL0F12430g7.390ON75431870.16
NDAI0E041807.390ON827140870.16
Skud_13.3928.742ON47350860.17
KAFR0F015601.137ON117129870.18
TPHA0L022905.18ON119358870.18
Kwal_55.196455.712ON97030870.19
Suva_13.4078.742ON47150860.19
KNAG0L022005.712ON116146870.20
TDEL0G004105.18ON118649860.21
TPHA0D046605.712ON104526860.22
KAFR0D021605.712ON84630860.23
Skud_2.1773.270ON78251860.23
NCAS0I031401.137ON1201105860.23
KLTH0F03674g1.137ON119850860.24
CAGL0G02563gsingletonON63145850.25
KAFR0A042108.742ON44055850.26
ZYRO0D07062g5.18ON119358860.26
Suva_9.305.712ON106249850.27
KLLA0E20351g7.390ON69731850.29
TBLA0D006207.390ON117131850.30
NCAS0G001705.712ON103026850.30
YIL156W (UBP7)5.712ON107126850.32
KLLA0E08801g2.307ON77149840.34
Kwal_33.136281.137ON116030850.35
Smik_9.135.712ON106052840.36
CAGL0I05522g7.390ON72466840.37
TPHA0E008707.390ON71531840.37
NDAI0F002005.712ON110526840.39
AFR296C5.712ON116930840.43
ZYRO0B03300g7.390ON81339830.44
Skud_9.125.712ON106426830.50
KLLA0C03476g1.137ON125229830.57
Kpol_1045.417.390ON71229820.57
Kpol_1018.937.390ON75533820.58
Smik_2.1893.270ON78251820.66
KLTH0E00814g5.712ON97430820.67
TDEL0C015707.390ON76533820.69
Kwal_26.91518.742ON45464810.76
CAGL0H06721g5.712ON108126820.77
CAGL0A04477g7.390ON77031810.78
AFR627C1.137ON128729820.80
SAKL0E15136g5.712ON103726810.81
TPHA0A052805.73ON2421101820.81
YBR058C (UBP14)3.270ON78152810.85
CAGL0L01639g1.137ON114729810.92
ZYRO0F01276g3.270ON77661810.94
TBLA0F011503.115ON112276811.0
Skud_11.3385.712ON71230801.1
Ecym_81401.137ON126433801.1
NDAI0B004801.137ON125329801.1
KNAG0C021801.137ON123129801.2
KLTH0C07326g3.270ON76230801.2
TDEL0B036708.742ON46349791.3
Kwal_14.20088.188ON42466781.4
AGR023C3.270ON78055791.5
KNAG0D019308.188ON98665791.6
ZYRO0B16544g5.712ON104426791.6
KAFR0H001505.712ON65643781.8
Suva_11.3355.712ON72449781.8
TBLA0J006001.137ON146229781.9
AGR139C8.202ON789110781.9
Kpol_251.73.270ON48061772.6
Kwal_56.230843.270ON76256772.7
KNAG0G015908.188ON67168772.7
TPHA0G005608.742ON46365762.7
KLTH0D12760g8.742ON45364762.8
KAFR0K018107.390ON71431772.8
TDEL0B009808.799ON155951772.9
ZYRO0C11572g5.73ON2406107772.9
Ecym_55448.202ON83470772.9
NCAS0I016203.270ON79556763.3
KLTH0H02992g6.266ON954169754.0
TDEL0D035503.270ON78042754.2
SAKL0C04246g1.137ON129729754.2
Kpol_1064.488.742ON46644744.8
NCAS0C046003.49ON581126744.8
KLTH0H07370g8.202ON78192754.9
NDAI0A074103.270ON81052745.6
KAFR0C025908.188ON97871746.3
KNAG0G029308.742ON45955736.4
NCAS0B027308.442ON165792746.5
Ecym_62488.742ON46648728.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D02580
         (1272 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....  2570   0.0  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...  1613   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...  1404   0.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...  1382   0.0  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...  1379   0.0  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...  1375   0.0  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...  1368   0.0  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...  1359   0.0  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....  1345   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...  1344   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...  1332   0.0  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...  1320   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...  1315   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....  1283   0.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...  1283   0.0  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....  1260   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...  1174   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...  1173   0.0  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  1172   0.0  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   733   0.0  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...   731   0.0  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   612   0.0  
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    54   3e-06
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    53   3e-06
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    50   2e-05
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    50   3e-05
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    49   5e-05
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    49   6e-05
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    49   6e-05
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    48   1e-04
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    49   1e-04
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    48   2e-04
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    48   2e-04
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    47   3e-04
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    47   3e-04
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    47   4e-04
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    47   4e-04
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    46   6e-04
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    46   0.001
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    45   0.001
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    45   0.001
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      45   0.001
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    45   0.001
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     45   0.001
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    45   0.001
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    45   0.002
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    45   0.002
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    45   0.002
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    45   0.002
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    45   0.002
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    44   0.002
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    44   0.002
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    44   0.002
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    44   0.003
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    44   0.003
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    44   0.003
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               44   0.003
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    44   0.003
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    44   0.004
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    44   0.004
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    44   0.004
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    43   0.004
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    43   0.004
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    43   0.005
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    43   0.005
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    43   0.005
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    43   0.005
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    43   0.006
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    43   0.006
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    42   0.007
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    43   0.007
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    43   0.007
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    43   0.007
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    42   0.008
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    42   0.008
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    42   0.008
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       42   0.009
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    42   0.009
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    42   0.010
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    42   0.010
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    42   0.010
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    42   0.012
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    42   0.013
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...    42   0.013
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    42   0.014
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    42   0.014
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    41   0.014
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    42   0.015
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    42   0.016
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    42   0.016
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    41   0.017
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    42   0.018
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    41   0.018
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    41   0.019
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    41   0.019
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    41   0.020
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    41   0.020
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    41   0.021
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    41   0.022
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    41   0.023
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    41   0.023
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    41   0.024
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    41   0.024
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    41   0.024
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    41   0.026
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    41   0.026
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    41   0.027
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    41   0.027
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    41   0.028
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    41   0.028
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    40   0.034
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    40   0.036
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    40   0.036
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    40   0.037
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    40   0.039
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    40   0.042
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    40   0.043
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    40   0.046
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    40   0.049
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    40   0.054
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    40   0.062
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    40   0.063
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    39   0.065
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    40   0.066
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    39   0.072
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    39   0.073
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    39   0.080
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    39   0.088
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    39   0.091
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    39   0.098
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    39   0.11 
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    39   0.11 
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    39   0.11 
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    39   0.12 
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    39   0.12 
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    39   0.12 
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    39   0.13 
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    39   0.14 
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    39   0.14 
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    38   0.14 
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    38   0.14 
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    39   0.15 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    38   0.16 
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    38   0.16 
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    38   0.17 
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    38   0.18 
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    38   0.18 
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    38   0.19 
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    38   0.19 
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    38   0.20 
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    38   0.21 
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    38   0.22 
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    38   0.23 
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    38   0.23 
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    38   0.23 
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    38   0.24 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    37   0.25 
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    37   0.26 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    38   0.26 
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    37   0.27 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    37   0.29 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    37   0.30 
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      37   0.30 
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    37   0.32 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    37   0.34 
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    37   0.35 
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    37   0.36 
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    37   0.37 
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    37   0.37 
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      37   0.39 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    37   0.43 
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    37   0.44 
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    37   0.50 
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    37   0.57 
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    36   0.57 
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    36   0.58 
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    36   0.66 
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    36   0.67 
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    36   0.69 
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    36   0.76 
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    36   0.77 
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    36   0.78 
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    36   0.80 
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    36   0.81 
TPHA0A05280 Chr1 complement(1190702..1197967) [7266 bp, 2421 aa]...    36   0.81 
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    36   0.85 
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    36   0.92 
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    36   0.94 
TBLA0F01150 Chr6 (287045..290413) [3369 bp, 1122 aa] {ON} Anc_3....    36   1.0  
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    35   1.1  
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    35   1.1  
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    35   1.1  
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    35   1.2  
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    35   1.2  
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    35   1.3  
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    35   1.4  
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    35   1.5  
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    35   1.6  
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    35   1.6  
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    35   1.8  
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    35   1.8  
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    35   1.9  
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    35   1.9  
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    34   2.6  
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    34   2.7  
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    34   2.7  
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    34   2.7  
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    34   2.8  
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    34   2.8  
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    34   2.9  
ZYRO0C11572g Chr3 complement(899998..907218) [7221 bp, 2406 aa] ...    34   2.9  
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    34   2.9  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    34   3.3  
KLTH0H02992g Chr8 complement(268190..271054) [2865 bp, 954 aa] {...    33   4.0  
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    33   4.2  
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    33   4.2  
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    33   4.8  
NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49      33   4.8  
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    33   4.9  
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    33   5.6  
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...    33   6.3  
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    33   6.4  
NCAS0B02730 Chr2 complement(459931..464904) [4974 bp, 1657 aa] {...    33   6.5  
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    32   8.1  

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 2570 bits (6661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1245/1272 (97%), Positives = 1245/1272 (97%)

Query: 1    MLQEDEKSGNVVQEIVSEDSLEAEKRLETPDLMDLGRETDHMVGNTKQADHLDTLTHRDS 60
            MLQEDEKSGNVVQEIVSEDSLEAEKRLETPDLMDLGRETDHMVGNTKQADHLDTLTHRDS
Sbjct: 1    MLQEDEKSGNVVQEIVSEDSLEAEKRLETPDLMDLGRETDHMVGNTKQADHLDTLTHRDS 60

Query: 61   GKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVLAYSRRI 120
            GKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVLAYSRRI
Sbjct: 61   GKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVLAYSRRI 120

Query: 121  SQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSSTLSENTV 180
            SQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSSTLSENTV
Sbjct: 121  SQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSSTLSENTV 180

Query: 181  YHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLEFDPTDPRLVDHAIYVSSD 240
            YHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLEFDPTDPRLVDHAIYVSSD
Sbjct: 181  YHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLEFDPTDPRLVDHAIYVSSD 240

Query: 241  TNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADCINTLLKI 300
            TNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADCINTLLKI
Sbjct: 241  TNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADCINTLLKI 300

Query: 301  FRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYFEFEPPN 360
            FRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYFEFEPPN
Sbjct: 301  FRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYFEFEPPN 360

Query: 361  LTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVYRTFNAIQIAFSKTT 420
            LTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVYRTFNAIQIAFSKTT
Sbjct: 361  LTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVYRTFNAIQIAFSKTT 420

Query: 421  WFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALDPENTGIYFD 480
            WFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALDPENTGIYFD
Sbjct: 421  WFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALDPENTGIYFD 480

Query: 481  ALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDSLLVSIYKSE 540
            ALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDSLLVSIYKSE
Sbjct: 481  ALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDSLLVSIYKSE 540

Query: 541  TMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXXXXXXXXXXXXXXX 600
            TMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAY               
Sbjct: 541  TMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYEILEVDESVDDDIIE 600

Query: 601  TAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGTLLYSEALS 660
            TAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGTLLYSEALS
Sbjct: 601  TAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGTLLYSEALS 660

Query: 661  MLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLILHFIDTGTI 720
            MLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLILHFIDTGTI
Sbjct: 661  MLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLILHFIDTGTI 720

Query: 721  DASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGNELRR 780
            DASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGNELRR
Sbjct: 721  DASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGNELRR 780

Query: 781  IGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNFEVEFEPTT 840
            IGG            QFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNFEVEFEPTT
Sbjct: 781  IGGREVSEAEVERSVQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNFEVEFEPTT 840

Query: 841  VNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNEDIDVSMTKEPSEEYKE 900
            VNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNEDIDVSMTKEPSEEYKE
Sbjct: 841  VNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNEDIDVSMTKEPSEEYKE 900

Query: 901  DIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINLD 960
            DIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINLD
Sbjct: 901  DIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINLD 960

Query: 961  EDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFS 1020
            EDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFS
Sbjct: 961  EDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFS 1020

Query: 1021 DERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYS 1080
            DERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYS
Sbjct: 1021 DERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYS 1080

Query: 1081 DSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKSQ 1140
            DSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKSQ
Sbjct: 1081 DSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKSQ 1140

Query: 1141 ELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHR 1200
            ELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHR
Sbjct: 1141 ELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHR 1200

Query: 1201 GEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEH 1260
            GEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEH
Sbjct: 1201 GEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEH 1260

Query: 1261 DIEPLKRIIDRD 1272
            DIEPLKRIIDRD
Sbjct: 1261 DIEPLKRIIDRD 1272

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 1613 bits (4178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 796/1320 (60%), Positives = 993/1320 (75%), Gaps = 68/1320 (5%)

Query: 1    MLQEDEKS----GNVVQEIVSEDSLEAEKRLETPDLMDLGRETDHMVGNTKQADHLDTLT 56
            ML +DE S    G   + + S   L  E  +ET  + +   E++ +  +  + + LDT  
Sbjct: 1    MLLKDESSEPAVGGSARGVASSSDLPPE-LVETEQIGETMSESE-ISEDPGKNELLDT-- 56

Query: 57   HRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVLAY 116
             +DSGK  LY E + +FPFKT+DRLLDD++HDL+FINS DH ILYSDL NGILK+PVL+Y
Sbjct: 57   -QDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSY 115

Query: 117  SRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSSTLS 176
            SR++ +   Y+ G+LVDQ+ LQT FEY S+SCP HN L V+MGVLIDV      T + L+
Sbjct: 116  SRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVATFNNLA 175

Query: 177  ENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTDPRLVDHAI 235
               ++HLKVTVKTR +LE TKKKAG+THYH + E+++H +D+QDL  FD  DP+L+D+AI
Sbjct: 176  TLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYAI 235

Query: 236  YVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADCIN 295
            YVSSD+NKL+LIE+F PEFD +E+ + +   +I  RY  AC RFD+LDP+ IPTQ DCIN
Sbjct: 236  YVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCIN 295

Query: 296  TLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYFE 355
            TL KIF+GPLNR++SEEP KTIN +NV LNS I+P WLTSKYGFELHVEKDE TGE   E
Sbjct: 296  TLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDILE 355

Query: 356  FEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDA-KTTSKVYRTFNAIQI 414
            + PP+LTNY  D KVRRLRESF R+C+ELIFLG+ +I LL ++A     KVYR F+ +Q 
Sbjct: 356  YAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQT 415

Query: 415  AFSKTTWFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALDPEN 474
             FS   WF++LGE+R+IFS ES+SPLD++++FI+LSAC+ YIDRDII+NYEAQC LDPEN
Sbjct: 416  NFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCTLDPEN 475

Query: 475  TGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDSLLV 534
             G+Y DAL +IANRKGAYQL+AYCGKQD VGQEALD AL +F IDSK+ D   ++DS+L+
Sbjct: 476  VGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLNDSVLL 535

Query: 535  SIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXXXXXXXXX 594
            SIYK+E+ +  N NRH +LKN+LRLLAK+KKS KLKF+ADYEPY+NV++AY         
Sbjct: 536  SIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEILEVDESV 595

Query: 595  XXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGTLL 654
                  TAY++ +NDSPGLKIDCDRALYTI V  RSL L N+L+QQ  +FQ Y+GP    
Sbjct: 596  DDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYFGPDQFS 655

Query: 655  YSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLILHF 714
            Y +ALS+LQ+NENAGD+T+LE+FQRKW++E  F++D  LKLK AL+KIG ERNSKLI HF
Sbjct: 656  YQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNSKLISHF 715

Query: 715  IDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHT 774
            IDTGT+DASCLPA+NWPTGLNNIGNTCYLNSLLQYYFS++ LR+YVL+Y+ T++HF ++ 
Sbjct: 716  IDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQ 775

Query: 775  GNELRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNFEV 834
                RRIGG            QFVYQLRDLF +MI++++RCVTPRKELAYLAF PS   V
Sbjct: 776  EYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYLAFVPSGLGV 835

Query: 835  EFE---PTTVNAQHEV----------------------------------SKIAESTNND 857
            EFE    +  NA   V                                  SK+ +++N+D
Sbjct: 836  EFELPNASQANANAPVEKENYVNIDSEPSPPPNDEPLLIDLDDDSDPNNHSKLNKNSNDD 895

Query: 858  ILMYGPTNRSDNDQTGPIELDSDSGNEDIDVSMTKEPSEEYKEDIPMSD-------AEKD 910
                G  N  DN Q G         + D+D+SMT  P+EE  E +  +D       + K 
Sbjct: 896  ----GKINEFDNSQAG-------ENDVDVDISMTDSPAEE--EKVTKADSGSSSNNSNKA 942

Query: 911  NIISTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINLDEDNEQNDLVK 970
              ++TSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPI+L +DNEQNDLVK
Sbjct: 943  VAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVK 1002

Query: 971  QLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLTMAEYG 1030
            QLFYG IKQ IIPL   T+++TK ER+LSLLVNIGDHPKDIYDALD YF DE L + EYG
Sbjct: 1003 QLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYG 1062

Query: 1031 DVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMVEK 1090
            DVKRTVAVT+FPTILQIQIQRVYYDRERFMPFKS+ PLPFNE +YMDRYSD+ +P ++ +
Sbjct: 1063 DVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINR 1122

Query: 1091 KKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKSQELKGLNNDFL 1150
            K+E+E+L  +L+ LK RQ+ELLS NELGLSRK A +ET N+LKSD++++Q ++  N   L
Sbjct: 1123 KRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGL 1182

Query: 1151 IEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYWV 1210
             ++L   +  I+ EL+ LYH+I +LE+ I  QF++FK IGYSLFAVFIHRGEASYGHYW+
Sbjct: 1183 AQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWI 1242

Query: 1211 YIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEHDIEPLKRIID 1270
            YIKDR K+G WRKYNDETITEVPE+EVFNF+EGNTATPYFLVYV+QGHE +IEPLKR+++
Sbjct: 1243 YIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLE 1302

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 1404 bits (3635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/1217 (58%), Positives = 882/1217 (72%), Gaps = 21/1217 (1%)

Query: 59   DSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVLAYSR 118
            D GK +LY  V   FPFKTSDRLLDD+  D+ F+NS++HDILYS LHNG+L+ P+L YSR
Sbjct: 34   DDGKTLLYPGVHLNFPFKTSDRLLDDIRSDMFFLNSEEHDILYSQLHNGVLRLPMLEYSR 93

Query: 119  RISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSSTLSEN 178
            + +   P S G L+DQ+TL+T +EY S +CP  NK+NV+MGVL+D  H    +   +   
Sbjct: 94   KKTT-QPCSVGYLLDQVTLKTKYEYESKTCPELNKINVFMGVLVD-QHIRPESLDDVINV 151

Query: 179  TVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLEFDPTDPRLVDHAIYVS 238
             +YHLK+TVKTR  LE  KK  GVTHYH I +  LH FD+QD+       +LVD A YVS
Sbjct: 152  PIYHLKITVKTRLHLERVKKHVGVTHYHLIDQ--LHSFDKQDIFMTTESEQLVDSATYVS 209

Query: 239  SDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADCINTLL 298
            SDTN+L+ IE+F PEF +E+    +S   +K RY+ AC++F  LDP+ +PTQ +C+NTL 
Sbjct: 210  SDTNRLLRIEIFKPEFTKED-LAIFSQEKVKERYASACEKFQDLDPTSVPTQVECLNTLF 268

Query: 299  KIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYFEFEP 358
            KIF+GPLNR++SE+ LKTI++DN  LNS+I+P+WLT KY F+L    DE TGE   EFEP
Sbjct: 269  KIFKGPLNRRSSEDILKTISADNKFLNSQIDPSWLTEKYDFKLVETTDEETGELIREFEP 328

Query: 359  PNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVYRTFNAIQIAFSK 418
            P+LT+Y++D  VR  RES+ RKC+ELIFLGKT+ +LL KD  +     R+FN  Q  FS 
Sbjct: 329  PDLTDYVQDWSVRSKRESYTRKCLELIFLGKTSAQLLPKDILSKDSKSRSFNLYQTNFST 388

Query: 419  TTWFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALDPENTGIY 478
            + WF +LG+ R+        P D +Y+FINLSA  YY D+DIIKNYE Q +LDPEN GIY
Sbjct: 389  SFWFHLLGDGRNFQDHNLQQPFDNDYHFINLSASSYYSDKDIIKNYETQISLDPENVGIY 448

Query: 479  FDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDSLLVSIYK 538
            FDAL YIAN KG YQL+AYCGKQ++VG+EALD AL +FGIDSKD DV +I D LL+SIYK
Sbjct: 449  FDALNYIANTKGGYQLIAYCGKQNIVGKEALDGALTVFGIDSKDTDVKSITDELLLSIYK 508

Query: 539  SETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXXXXXXXXXXXXX 598
            +E  A   + R TDLKNALRLLAK+K+S KLKF  DYEPY + S+AY             
Sbjct: 509  NELKAASVQKR-TDLKNALRLLAKFKESKKLKFHVDYEPYTSTSKAYQLLEIGESVDLDI 567

Query: 599  XXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGTLLYSEA 658
              TAY+I + D+PGLKIDCDRALYT+ V KRSL L N+L Q+CP FQ +Y      Y EA
Sbjct: 568  IQTAYTIRVADAPGLKIDCDRALYTLAVAKRSLVLFNFLTQECPIFQEFYNIDNWSYKEA 627

Query: 659  LSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLILHFIDTG 718
            LS+LQ+NENA D+ +LE+FQRKW QE     D  L LK ALTK+GIERNSKLI +FIDTG
Sbjct: 628  LSLLQVNENATDDVILEIFQRKWSQEPMTSPDQFLILKTALTKLGIERNSKLINNFIDTG 687

Query: 719  TIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRH---HTG 775
             +D SCLPA NWPTGLNNIGNTCYLNSLLQYYFS++PLR YVL YQ+ +  FR     TG
Sbjct: 688  IVDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYVLNYQKMLNCFRDIEDATG 747

Query: 776  NEL--RRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNFE 833
             E+  RRIG             QFVYQLRDLF+ M+++KER VTP KELAYLAFAPSN E
Sbjct: 748  GEISKRRIGSREVSKPEVERSVQFVYQLRDLFRDMVHTKERFVTPTKELAYLAFAPSNIE 807

Query: 834  VEFE-PTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNEDIDVSMTK 892
            VEFE PT      E   + E TN   ++    +  DN      E +  S +  +DV   +
Sbjct: 808  VEFEAPTITTVAPE--DLDERTNKLDIIDLAADGIDN------ETEKGSKSSLLDVHNQQ 859

Query: 893  EPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLES 952
            +P EE  EDI M   +++  ++ S RVAKISSDQLEN LE+GRQQDVTECIGNVLFQLES
Sbjct: 860  KP-EEQTEDIIMGGTQEEEAVNASMRVAKISSDQLENTLELGRQQDVTECIGNVLFQLES 918

Query: 953  ASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIY 1012
            ASDP +L+EDNEQ+DL+K+LFYGKIKQ +IP+   ++I+TKIER++SLLVNIGDHPKDIY
Sbjct: 919  ASDPWSLEEDNEQHDLIKELFYGKIKQHLIPVKNPSKIRTKIERFVSLLVNIGDHPKDIY 978

Query: 1013 DALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNE 1072
            DALD YF D+ L + E G+VKRTVAVT  P ILQIQIQRVYYDRERFMPFKSIEPLPF+E
Sbjct: 979  DALDLYFKDDLLQLDEDGEVKRTVAVTNLPKILQIQIQRVYYDRERFMPFKSIEPLPFSE 1038

Query: 1073 VLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYL 1132
             +YMDRY D+ DP M+ K+ ++++LK +L  LK RQ +LLS N+ GLS K + ++T  +L
Sbjct: 1039 TIYMDRYMDTDDPVMLAKRDDTKKLKEELRALKDRQHQLLSKNDTGLSFKGSLLQTKKFL 1098

Query: 1133 KSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYS 1192
            +S+++   E+   N   L+  +   I  ID EL+SLY  I  LE  I  QF EF KIGYS
Sbjct: 1099 QSEVLDKHEIAVENKGALVCHIDSMITKIDGELSSLYQKITALEVQIANQFNEFTKIGYS 1158

Query: 1193 LFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLV 1252
            LFA FIHRGEASYGHYW+YIKDR KNG WRKYNDE++TEVP++EVFNFTEGNTATPYFLV
Sbjct: 1159 LFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESVTEVPQSEVFNFTEGNTATPYFLV 1218

Query: 1253 YVRQGHEHDIEPLKRII 1269
            Y+++GHE +IEPLKR+I
Sbjct: 1219 YIKEGHEDEIEPLKRVI 1235

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 1382 bits (3577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/1263 (55%), Positives = 903/1263 (71%), Gaps = 45/1263 (3%)

Query: 38   ETDHMVGNTKQAD----------HLDTLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIH 87
            E  H V NT   D             T    D GK +LY +++T  P KTSDRLLDD++ 
Sbjct: 23   EKGHTVDNTTSIDDCPLYEASASQQSTRADVDDGKHLLYPDIATYLPLKTSDRLLDDILC 82

Query: 88   DLAFINSKDHDILYSDLH-NGILKAPVLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSI 146
            D AF NS D  ++   L  +GILK  +L+YS   S++ P + G+L DQ+ LQT  EY SI
Sbjct: 83   DTAFFNSTDPSVIERGLQTSGILKKSMLSYSNFRSRIRPDALGSLTDQVVLQTKTEYDSI 142

Query: 147  SCPGHNKLNVYMGVLID--VPHDYKITSSTLSENTVYHLKVTVKTRSILEHTKKKAGVTH 204
            SCP +NK+ V   V+ +  +P         + +  +YHLKVTVK R  LE  KK  GVT 
Sbjct: 143  SCPQYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQ 202

Query: 205  YHCISEADLHQFDRQDLE-FDPTDPRLVDHAIYVSSDTNKLVLIEVFLPEFDREEKTECW 263
            +H +    LH++D  DL  FD +DP L D+ IYVS DTNKL+LIE+F PEFD  E+ + +
Sbjct: 203  FHALDH--LHEYDLADLSTFDSSDPNLKDYGIYVSDDTNKLILIEIFNPEFDSPEERDSF 260

Query: 264  SGTAIKTRYSEACQRFDTLDPSEIPTQADCINTLLKIFRGPLNRQNSEEPLKTINSDNVV 323
            +  AI+ RY++ C + ++L+ +E P+Q DC  TL KIF+GPL R+++ +P+KTI+S N+V
Sbjct: 261  TTAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKGPLARKSTADPIKTIDSGNIV 320

Query: 324  LNSRINPNWLTSKYGFELHVEKDESTGESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIE 383
            LN+ +NP WLTSKYGF+   E DE T ES+ E+ PP++ +Y+ D K+R++RES++RKC++
Sbjct: 321  LNTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVDYVGDWKIRKIRESYVRKCLQ 380

Query: 384  LIFLGKTAIELLGKDA--KTTSKVYRTFNAIQIAFSKTTWFKMLGEHRSI----FSFESA 437
            LIF G+ +  LL  ++  K T  V +  ++IQ +FS   WF++LGE R+     F+ ++ 
Sbjct: 381  LIFWGQLSASLLAPNSLLKNTKSV-KGLSSIQTSFSILPWFQLLGESRARILLNFNEQAH 439

Query: 438  SPLDANYNFINLSACFYYIDRDIIKNYEAQCALDPENTGIYFDALTYIANRKGAYQLVAY 497
            SPLDA  +FINLS   YY DRDII+NYEA  +LDPEN G+YFDALTYIANRKGAYQ++AY
Sbjct: 440  SPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLYFDALTYIANRKGAYQIIAY 499

Query: 498  CGKQDVVGQEALDQALKLFGIDSKDVDVATIDDSLLVSIYKSETMANPNE---NRHTDLK 554
            CGKQD++GQEAL+ AL +F ID KD D+A ++++ L+SIYK ET +N N+   N  T+LK
Sbjct: 500  CGKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYKFET-SNKNKAASNHLTNLK 558

Query: 555  NALRLLAKYKKSDKLKFFADYEPYKNVSRAYXXXXXXXXXXXXXXXTAYSISINDSPGLK 614
            NALRLLAKY KSDKLKF+ D+EPY+ +S+AY               TAYSI INDSPGLK
Sbjct: 559  NALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDEDIIKTAYSIKINDSPGLK 618

Query: 615  IDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGTLLYSEALSMLQLNENAGDETVL 674
            +DCDRALYTI + KRSL L N+L  +CP FQ YYGP  L Y EAL +LQ+NENA DET+L
Sbjct: 619  LDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQEALKLLQVNENASDETIL 678

Query: 675  EVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLILHFIDTGTIDASCLPADNWPTGL 734
            ++F+ KW  E  +E D  L LKAALTKI IERNS LI +F+ TGTID + LP +NWPTG+
Sbjct: 679  KIFKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLLTGTIDPNSLPPENWPTGI 738

Query: 735  NNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGN--ELRRIGGXXXXXXXXX 792
            NNIGNTCYLNSLLQYYFS+APLR Y+L YQ+T+ +F  H  N   +RR+GG         
Sbjct: 739  NNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISEGEVE 798

Query: 793  XXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNFEVEFEPTTVNAQHEVSKIAE 852
               QF++QLR+LF AM++S+ERCVTP KELAYLAFAPSN EVEFE         V    E
Sbjct: 799  RSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEVEFE---------VEGNKE 849

Query: 853  STNNDILMYGPTNRSDN-DQTGPIELD---SDSGNEDIDVSMTK-EPSEEYKEDIPMSDA 907
            S +  IL    T  ++  ++  PI +D    ++ N D++      E +E    +I M+D 
Sbjct: 850  SNDATILKEEETGGANAINEQDPILIDFEVDENTNGDVEKDENNHEKTESNDVEIIMTDD 909

Query: 908  EKDNIISTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINLDEDNEQND 967
              D  +++ TRVAKISSDQLENALEMGRQQDVTECIGNVLFQ+ES S+PI  DEDNEQ D
Sbjct: 910  ATD--LASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYD 967

Query: 968  LVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLTMA 1027
            L+KQLFYG  KQ I+PL+ + +++TK+ER+LSLLVNIGDHPKDIYDA DSYF DE LTMA
Sbjct: 968  LIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMA 1027

Query: 1028 EYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYSDSQDPKM 1087
            EYGDVKRTVAVT FPTILQ+QIQRVYYDRERFMPFKSIEPLPF EV+YMDRY+D+ +  +
Sbjct: 1028 EYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTL 1087

Query: 1088 VEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKSQELKGLNN 1147
            + KK+E+EQLK +   +K RQ+ELL+ +  GL+RK A++ETI  L+S ++++  L   + 
Sbjct: 1088 LAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDK 1147

Query: 1148 DFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHRGEASYGH 1207
              LI+ LK  + DID EL SLY DI  LE+ I  QF++FK+ GYSLF+VFIHRGEASYGH
Sbjct: 1148 KNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGH 1207

Query: 1208 YWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEHDIEPLKR 1267
            YW+YIKDR++NG WRKYNDETI+EVPE EVFNF EGNTATPYFLVYV+QG E DIEPLKR
Sbjct: 1208 YWIYIKDRNQNGVWRKYNDETISEVPEEEVFNFNEGNTATPYFLVYVKQGQEADIEPLKR 1267

Query: 1268 IID 1270
            I++
Sbjct: 1268 ILE 1270

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 1379 bits (3569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/1228 (55%), Positives = 893/1228 (72%), Gaps = 19/1228 (1%)

Query: 59   DSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLH-NGILKAPVLAYS 117
            D GK +LY +++T  P KTSDRLLDD++ D  F+NS D +++   L  +GIL+  +L+YS
Sbjct: 54   DDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYS 113

Query: 118  RRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSS--TL 175
               S + P + G+L DQ+T+QT  EY SISCP +NK+ V+  V+++     +  SS   +
Sbjct: 114  SFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDI 173

Query: 176  SENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLE-FDPTDPRLVDHA 234
                +YHLKVTVK R  LE  KK  GVT +H +    LH++DR DL  FD +DP+L+D+ 
Sbjct: 174  VRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDH--LHEYDRVDLSTFDSSDPKLMDYG 231

Query: 235  IYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADCI 294
            IYVS DTNKL+LIE+F PEF+  E+ E ++  AIK RY++ C + ++L+  E P+Q DC 
Sbjct: 232  IYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCF 291

Query: 295  NTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYF 354
             TL KIF+GPL R++ EEP+KTI+S N+VLN+ +N  WLTSKYGF+   E DE T + + 
Sbjct: 292  YTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFT 351

Query: 355  EFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAK-TTSKVYRTFNAIQ 413
            E+ PP++  Y+ D   R++RESF++KC++LIF G+ +  LL  ++    +K  +  +++Q
Sbjct: 352  EYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQ 411

Query: 414  IAFSKTTWFKMLGEHRS---IFSFESA-SPLDANYNFINLSACFYYIDRDIIKNYEAQCA 469
             +FS + WF +LGE R+   + S E A SPLDA  +FINLS   YY DRDII+NYEA  +
Sbjct: 412  TSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSS 471

Query: 470  LDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATID 529
            LDP+N G+YFDALTYIANRKGAYQL+AYCGKQ+++GQEAL+ AL  F ID K+ ++A ++
Sbjct: 472  LDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELN 531

Query: 530  DSLLVSIYKSET--MANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXX 587
            ++ L+SIYK ET   +    N  T+ KNALRLLAKY KSDKLKF+ D+EPY+ +S+AY  
Sbjct: 532  EATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591

Query: 588  XXXXXXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLY 647
                         TAYSI INDSPGLK+DCDRALYTI + KRSL L N+L  +CP F  Y
Sbjct: 592  LSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKY 651

Query: 648  YGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERN 707
            YGP  L Y EAL +LQ+NENA DETVL++F++KW+ E+ FE D  L L+AALT+I IERN
Sbjct: 652  YGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERN 711

Query: 708  SKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETM 767
            S LI +F+ TGTID + LP +NWPTG+NNIGNTCYLNSLLQYYFS+APLRRY+LEYQ+T+
Sbjct: 712  SNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTL 771

Query: 768  EHFRHHTGN--ELRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYL 825
            ++F  H  N   +RRIGG            QF+YQLR+LF AM++S+ERCVTP KELAYL
Sbjct: 772  DNFNDHLSNSGHVRRIGGREISRGEVERSIQFIYQLRNLFYAMVHSRERCVTPSKELAYL 831

Query: 826  AFAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELD-SDSGNE 884
            AFAPSN EVEFE          + I+  +  ++     T   + D +  I+L+  D  N 
Sbjct: 832  AFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPS-LIDLEMEDKTNS 890

Query: 885  DIDVSMTKEPSEEYKE--DIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTEC 942
            D+D  +    + E  E  DI ++  E    +++ TRVAKI SDQLENALEMGRQQDVTEC
Sbjct: 891  DVDKDIENVKANEANEANDIEITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTEC 950

Query: 943  IGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLV 1002
            IGNVLFQ+ES S+PI  DEDNEQ DL+KQLFYG  KQ+I+PL+ + +++TK+ER+LSLLV
Sbjct: 951  IGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLV 1010

Query: 1003 NIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPF 1062
            NIGDHPKDIYDA DSYF DE LTM EYGDVKRTVAVT FPTILQ+QIQRVYYDRERFMPF
Sbjct: 1011 NIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPF 1070

Query: 1063 KSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRK 1122
            KSIEPLPF EV+YMDRYSD+++P ++ KK+E+EQ+K  L  +K RQ+ELL  +E GL+RK
Sbjct: 1071 KSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRK 1130

Query: 1123 AAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQ 1182
             A++E+I  L+S+++ ++     +N  +I  LK +I DID EL SLY+DI  LE+ I  Q
Sbjct: 1131 DAFLESIKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQ 1190

Query: 1183 FEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTE 1242
            F++F++ GYSLF+VFIHRGEASYGHYW+YIKDR+  G WRKYNDETI+EV E EVFNF E
Sbjct: 1191 FDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISEVQEEEVFNFNE 1250

Query: 1243 GNTATPYFLVYVRQGHEHDIEPLKRIID 1270
            GNTATPYFLVYV+QG E DIEPLKRI++
Sbjct: 1251 GNTATPYFLVYVKQGQESDIEPLKRILE 1278

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 1375 bits (3559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/1229 (55%), Positives = 887/1229 (72%), Gaps = 29/1229 (2%)

Query: 59   DSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHN-GILKAPVLAYS 117
            D GK +LY +++T  P KTSDRLLDD++ D  F+NS D  ++   L + GILK  +L+YS
Sbjct: 54   DDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYS 113

Query: 118  RRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSSTLSE 177
               S + P   G+L DQ+  QT  EY SISCP +NK++V+  V+ + P   +   ST  +
Sbjct: 114  TFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFN-PSLAEQQISTFDD 172

Query: 178  NT---VYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLE-FDPTDPRLVDH 233
                 +YHLKV+VK R  LE  KK  GVT +H +    LH++DR DL  FD +DP L+D+
Sbjct: 173  IVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDH--LHEYDRVDLSTFDSSDPNLLDY 230

Query: 234  AIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADC 293
             IYVS DTNKL+LIE+F PEF+  E+ E ++  AIK RY+  C + ++LD SE P+Q DC
Sbjct: 231  GIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDC 290

Query: 294  INTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESY 353
              TL KIF+GPL R++  EP KTI+S N+ LN+ +NP WLTSKYGF+   E DE T E +
Sbjct: 291  FYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIF 350

Query: 354  FEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAK-TTSKVYRTFNAI 412
             E+ PP++ +Y+ D + R++RESF+RKC++LIF G+ +  LL  ++    +K  +  +++
Sbjct: 351  TEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSL 410

Query: 413  QIAFSKTTWFKMLGEHRSIFSFESA----SPLDANYNFINLSACFYYIDRDIIKNYEAQC 468
            Q +FS   WF +LGE R+     S     SPLDA  +FINLS   YY DRDII+NYE+  
Sbjct: 411  QTSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLS 470

Query: 469  ALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATI 528
            +LDPEN G+YFDALTYIANRKGAYQL+AYCGKQD++GQEAL+ AL +F I+ K+ +++ +
Sbjct: 471  SLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISEL 530

Query: 529  DDSLLVSIYKSET--MANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYX 586
            +++ L+SIYK ET   +    N  T+LKNALRLLAKY KSDKLKF+ D+EPY+ +S+AY 
Sbjct: 531  NEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYD 590

Query: 587  XXXXXXXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQL 646
                          TAYS+ INDSPGLK+DCDRALYTI + KRSL L N+L ++CP F  
Sbjct: 591  TLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSN 650

Query: 647  YYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIER 706
            YYGP  L Y EAL +LQ+NENA DET+L++F++KW  E  +E D  L L+AALTKI IER
Sbjct: 651  YYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIER 710

Query: 707  NSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQET 766
            NS LI +F+ TGTID + LP +NWPTG+NNIGNTCYLNSLLQYYFS+APLRRYVLEYQ+T
Sbjct: 711  NSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKT 770

Query: 767  MEHFRHHTGN--ELRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAY 824
            +E+F  H  N   +RRIGG            QF+YQLR+LF AM++++ERCVTP KELAY
Sbjct: 771  VENFNDHLSNSGHIRRIGGREISRGEVERSIQFIYQLRNLFYAMVHTRERCVTPSKELAY 830

Query: 825  LAFAPSNFEVEFE---PTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDS 881
            LAFAPSN EVEFE      V+    +S   + T +D      T   D   T  I+L+ + 
Sbjct: 831  LAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTDDAFT---TKIKD---TSLIDLEMED 884

Query: 882  G-NEDIDVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVT 940
            G N D+     ++ +E    D  +S+ E    +++ TRVAKISSDQLENALEMGRQQDVT
Sbjct: 885  GLNGDVGTDANRKKNE--SNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVT 942

Query: 941  ECIGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSL 1000
            ECIGNVLFQ+ES S+PI  DEDNEQ DLVKQLFYG  KQ+I+PL+ + +++TK+ER+LSL
Sbjct: 943  ECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSL 1002

Query: 1001 LVNIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFM 1060
            L+NIGDHPKDIYDA DSYF DE LTM EYGDV RTVAVT FPTILQ+QIQRVYYDRER M
Sbjct: 1003 LINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLM 1062

Query: 1061 PFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLS 1120
            PFKSIEPLPF EV+YMDRY+D+++P ++ KKKE+E++K +L  +K RQ+ELLS ++ GL+
Sbjct: 1063 PFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLT 1122

Query: 1121 RKAAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTID 1180
            RK A++E+I  L+SD IK   LK    + +I+ L+ ++ +ID EL  LY+DI  LE  I 
Sbjct: 1123 RKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKIS 1182

Query: 1181 KQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNF 1240
             QF++FK+ GYSLF+VFIHRGEASYGHYW+YIKDR++NG WRKYNDETI+EV E EVFNF
Sbjct: 1183 HQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFNF 1242

Query: 1241 TEGNTATPYFLVYVRQGHEHDIEPLKRII 1269
             EGNTATPYFLVYV+QG E DIEPLKRI+
Sbjct: 1243 NEGNTATPYFLVYVKQGQEGDIEPLKRIL 1271

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 1368 bits (3540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 676/1227 (55%), Positives = 896/1227 (73%), Gaps = 18/1227 (1%)

Query: 54   TLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPV 113
            +++ +D GK++LY +     PFKTS+RLLD+++  + +I   + D  +++  NG+LK  +
Sbjct: 47   SVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNGLLKKQL 106

Query: 114  LAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSS 173
            L+YS+    + P+S GT+VDQI LQT FEY S +CP  N + V +GVLID  H    T  
Sbjct: 107  LSYSKSRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLSTFD 166

Query: 174  TLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTDPRLVD 232
             +++  +YHLK+TVK RS LE TK+  GV  YH +    LH FD+QDL  FDP DP+LVD
Sbjct: 167  DVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDS--LHPFDQQDLLNFDPKDPKLVD 224

Query: 233  HAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQAD 292
            HAIYVS DTNKLVL+E+F PEFD EE+    +  AIK R+ +A +++DTLD  EIPTQ D
Sbjct: 225  HAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQID 284

Query: 293  CINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGES 352
            CINT+ KIF+GPL R++++EP+KT++SDNVVLNS++NP WL +KYGF+  +E +E T E 
Sbjct: 285  CINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFQELIETEEETEEQ 344

Query: 353  YFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAK-TTSKVYRTFNA 411
              ++ PPNL ++  D+ VR+ RE+  RKC+ELI+LGK +I L+  + K + SK  RTFN 
Sbjct: 345  LIDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNL 404

Query: 412  IQIAFSKTTWFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALD 471
            +Q +FS   W ++L E+++I + +    ++ +Y+ I+LSA ++Y DRDII+NYE QC LD
Sbjct: 405  LQTSFSTLFWSQILDENKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQNYELQCKLD 464

Query: 472  PENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDS 531
            P N GIYFD+L +IAN +G+Y L+ YC KQD+VGQEAL+QALK F +D   +D++  +D+
Sbjct: 465  PANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDA 524

Query: 532  LLVSIYKSETMANPNE-NRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXXXXX 590
            + ++IYK+E   + N+  R T+L+NALR+LAK+K S +LKF+ DYEPY ++ RA+     
Sbjct: 525  IFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEV 584

Query: 591  XXXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGP 650
                      TAYSI +ND+PGLKIDCDRALYT+ V KRS+ L+N+L Q+CP FQ +YGP
Sbjct: 585  DESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGP 644

Query: 651  GTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKL 710
                YSEAL  LQ+NENA D+T+LE+FQR+W  ++  ++D +L LK+ LTKI  ERNSKL
Sbjct: 645  DQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKL 704

Query: 711  ILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHF 770
            I  +++TG ++  CLPADNWP GLNNIGNTCYLNSLLQYYF ++PLR YV +YQ+T+E  
Sbjct: 705  ISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAV 764

Query: 771  RH--HTGNELRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFA 828
             +    G + RRIGG            QFVYQLRDLF  MI+S  RCVTP KELAYLAFA
Sbjct: 765  ENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFA 824

Query: 829  PSNFEVEF-EPTTVNAQHEVSKIAESTNNDILMYG-----PTNRSDNDQTGPIELDSDSG 882
            PSN EVEF +P  + + +      E  + DI+        P  +S        ++++   
Sbjct: 825  PSNVEVEFDQPNELQSGN-----GEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSPE 879

Query: 883  NEDIDVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTEC 942
            N+ I++  + + S   K +    +        TSTRVAKIS DQLENALE+GRQQDVTEC
Sbjct: 880  NQLIEIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDVTEC 939

Query: 943  IGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLV 1002
            IGNVLFQLESAS+PI+L+ED+EQ DL+K+LFYGK KQ+IIPL  + EI+ KIER++SLLV
Sbjct: 940  IGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLV 999

Query: 1003 NIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPF 1062
            N+ DHPKD+YDALD YFSDE LTM EYG+VK+++AVTEFPTILQIQIQRVYYDRERFMPF
Sbjct: 1000 NVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPF 1059

Query: 1063 KSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRK 1122
            KSIEPLPF+E +YMDRY+++ D  +++KK E+ +LK QLS ++ RQKELLS NELGLSRK
Sbjct: 1060 KSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRK 1119

Query: 1123 AAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQ 1182
             A+MET  +L SD ++ Q ++  N   LI++L  ++ DID ELT LY+DI  +E  ID+Q
Sbjct: 1120 EAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQ 1179

Query: 1183 FEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTE 1242
            F++F+ IGYSLFAVFIHRGEASYGHYWVYIKD +KNG WRKYNDETITEVPE EVFNFTE
Sbjct: 1180 FDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTE 1239

Query: 1243 GNTATPYFLVYVRQGHEHDIEPLKRII 1269
            GNTATPYFLVYV+Q + ++IEPLKRI+
Sbjct: 1240 GNTATPYFLVYVKQENLNEIEPLKRIV 1266

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 1359 bits (3518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/1233 (54%), Positives = 884/1233 (71%), Gaps = 17/1233 (1%)

Query: 49   ADHLDTLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHN-G 107
            A H       D GK +LY +++T  P KTSDRLLDD++ D  F+NS D  ++   L   G
Sbjct: 44   ASHQSAPVDFDDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTG 103

Query: 108  ILKAPVLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHD 167
            IL+  +L+YS   S + P + G++ DQ+ +QT  EY S SCP +NK++V+  V+++    
Sbjct: 104  ILRESMLSYSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLT 163

Query: 168  YKITSS--TLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLE-FD 224
             +  SS   + +  +YHLKVTVK R  LE  KK  GVT +H I    LH++DR D   FD
Sbjct: 164  EQHVSSFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDF--LHEYDRVDFSTFD 221

Query: 225  PTDPRLVDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDP 284
             +DP L+D+ IYVS DTNKL+LIE+F PEFD  E+ E ++  AIK RYS+ C   ++LD 
Sbjct: 222  SSDPNLMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDK 281

Query: 285  SEIPTQADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVE 344
            +  P+QADC  TL KIF+GPL R++  EP+KTI+S N+ LN+ +NP WLTSKYGF++  E
Sbjct: 282  NNTPSQADCFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSE 341

Query: 345  KDESTGESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAK-TTS 403
             DE T E + E+ PP++ +Y++D KVR++RESF+RKC++L+F G+ +  LL  ++    +
Sbjct: 342  IDEETNERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNT 401

Query: 404  KVYRTFNAIQIAFSKTTWFKMLGEHRS---IFSFESASPLDANYNFINLSACFYYIDRDI 460
            K  +  + +Q +FS   WF +LGE RS   + S ES SPLDA  +F+NLS   YY DRDI
Sbjct: 402  KSVKGLSCLQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDI 461

Query: 461  IKNYEAQCALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDS 520
            I+NYE+  +LDP+N G+YFDALTYIANRKGAYQL+AYCGKQD++GQEAL+ AL +F I+ 
Sbjct: 462  IRNYESLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEP 521

Query: 521  KDVDVATIDDSLLVSIYKSET--MANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPY 578
            K+ ++A ++++ L+SIYK ET   +       T+LKNALRLLAKY KSDKLKF+ D+EPY
Sbjct: 522  KECNIAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPY 581

Query: 579  KNVSRAYXXXXXXXXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLL 638
            + +S+AY               TAYS+ INDSPGLK+DCDRALYTI + K+SL L N+L 
Sbjct: 582  RALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLT 641

Query: 639  QQCPDFQLYYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAA 698
             +CP F  YYG   L Y EAL +LQ+NENA DET+L++F++KW  E+ +E D  L LKAA
Sbjct: 642  DECPQFLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAA 701

Query: 699  LTKIGIERNSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRR 758
            LTKI IERNS LI +F+ TGTID + LP +NWPTG+NNIGNTCYLNSLLQYYFS+APLRR
Sbjct: 702  LTKISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRR 761

Query: 759  YVLEYQETMEHFRHHTGN--ELRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCV 816
            Y+L+YQ+T+E+F  H  N   +RRIGG            QF+YQLR+LF AM++S+ERCV
Sbjct: 762  YILDYQKTVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCV 821

Query: 817  TPRKELAYLAFAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIE 876
            TP KELAYLAFAPSN EVEFE    N   + + I      +      T + ++ ++   +
Sbjct: 822  TPSKELAYLAFAPSNIEVEFE-VEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSK 880

Query: 877  LDSDSGNEDIDVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQ 936
            ++ ++  +        E +E     I   D   D  +++ TRVAKISSDQLENALEMGRQ
Sbjct: 881  MEDNTNRDTHRNPSNTEKNEPNNVQIVGGDDTTD--LNSLTRVAKISSDQLENALEMGRQ 938

Query: 937  QDVTECIGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIER 996
            QDVTECIGNVLFQ+ES S+PI  DEDNEQ DLVKQLFYG  KQ+I+PL+ + +++TK+ER
Sbjct: 939  QDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVER 998

Query: 997  YLSLLVNIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDR 1056
            +LSLL+NIGDHPKDIYDA DSYF DE LTM EYGDV RTVAVT FPTILQ+QIQRVYYDR
Sbjct: 999  FLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDR 1058

Query: 1057 ERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNE 1116
            ERFMPFKSIEPLPF EV+YMDRY+D+++P ++ KK E+E++K +L  +K RQ+ELLS + 
Sbjct: 1059 ERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDN 1118

Query: 1117 LGLSRKAAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLE 1176
             GL+RK A++E+I  L+S +++   LK      +I  L+ ++ +ID EL SLY++I  LE
Sbjct: 1119 SGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLE 1178

Query: 1177 NTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETE 1236
              I  QF++FK+ GYSLF+VFIHRGEASYGHYW+YIKDR+ NG WRKYNDET++EV E E
Sbjct: 1179 EKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDE 1238

Query: 1237 VFNFTEGNTATPYFLVYVRQGHEHDIEPLKRII 1269
            VFNF EGNTATPYFLVYV+QG E DIEPLKRI+
Sbjct: 1239 VFNFNEGNTATPYFLVYVKQGQEADIEPLKRIL 1271

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 1345 bits (3480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/1230 (54%), Positives = 878/1230 (71%), Gaps = 30/1230 (2%)

Query: 59   DSGKEVLYREVST-KFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVLAYS 117
            D G  +LY ++ T  FP KTS+R++DD++ DL+FIN  +         NGIL+  ++ YS
Sbjct: 76   DPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLS-----FKNGILQESMIMYS 130

Query: 118  RRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSSTLSE 177
            +       Y FG++VDQ+ LQT +EY S++CP +NKL V  G+L+++P +       +S+
Sbjct: 131  KERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVDEIISK 190

Query: 178  NTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTDPRLVDHAIY 236
              +YHLK+TVKTR +LE +KK+AG+T YH +   DLH FD++DL  FDP +P L+D+AIY
Sbjct: 191  VPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIY 250

Query: 237  VSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADCINT 296
            VSSDTN+L+LIE+F  EFD  E+ E +    IK+RY EAC++FDTLDP  +PT  DC+NT
Sbjct: 251  VSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNT 310

Query: 297  LLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYFEF 356
            +LK+ + PL R+N+ + ++T++S+N +L+S  NP WL  KY F  H   DE+TG+   E+
Sbjct: 311  VLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEY 370

Query: 357  EPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELL---GKDAKTTSKVYRTFNAIQ 413
            EPP+L +Y++  KVR LRE +IR+C++LIF GK  ++L       A   SK YR FN + 
Sbjct: 371  EPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFNLLN 430

Query: 414  IAFSKTTWFKMLGEHRSIFSFES-----ASPLDANYNFINLSACFYYIDRDIIKNYEAQC 468
               S    +++L + +S F   +     +  LD N++FINLS   YY DRDIIKNYE   
Sbjct: 431  TTTSTNPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLI 490

Query: 469  ALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATI 528
            ALDP N G YFDAL+YIANRKG+YQL+AYCGKQDVVGQE ++ ALK F ID   V++ +I
Sbjct: 491  ALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLESI 550

Query: 529  DDSLLVSIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXXX 588
            DDSLL+SIYK+E++    +    +LKNA+RL AK + S +LKF+ D+EPY+NV++AY   
Sbjct: 551  DDSLLLSIYKNESVKEGAD--FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETL 608

Query: 589  XXXXXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYY 648
                        TAYSI   D+PGLKIDCDRALYTI +++RS+ L N+LL+ C +FQ YY
Sbjct: 609  EIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYY 668

Query: 649  GPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNS 708
              G   Y +AL +LQ+NENA DE +L+ FQ KW  E   E+D  L  K AL K+G+ERNS
Sbjct: 669  NIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNS 728

Query: 709  KLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETME 768
            KLI +F+  G ID SCLP +NWPTG+NNIGNTCYLNSLLQYYFS++PLR YVL Y +T E
Sbjct: 729  KLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYE 788

Query: 769  HFRHHTGNE--LRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLA 826
             F     N   +RRIGG            QF+YQLRDLF AMIY+ +RCVTPR+ELAYLA
Sbjct: 789  DFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLA 848

Query: 827  FAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNEDI 886
            FAPSN EVEFE    +A+ +VS   +   +D L+       D D  G  E    S  EDI
Sbjct: 849  FAPSNVEVEFENGVTDAKEDVSHYNDDKTSDTLI--KIGEGDED-LGEAERTEASPTEDI 905

Query: 887  DVSMTKE---PSEEYKEDIPMSDAEKDNIIST--STRVAKISSDQLENALEMGRQQDVTE 941
               MT +    + +  + I   D   +N I    ST+VAKISSDQLENALEMGRQQDVTE
Sbjct: 906  --YMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQDVTE 963

Query: 942  CIGNVLFQLESASDPINLD-EDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSL 1000
            CIGNVL+QLES S+P+ ++ EDNEQ+DLVKQLFYG+IKQ IIPL+   E + K+ER+LSL
Sbjct: 964  CIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSL 1023

Query: 1001 LVNIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFM 1060
            LVN+GDHP+DIYDALD YF DE LTM EYG+VKRTVA+T+FPTILQ+QIQRVYYDRERFM
Sbjct: 1024 LVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFM 1083

Query: 1061 PFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLS 1120
            PFKSIEPLPF+  +YMDRY D+ DP+++E ++ + ++KA+L +LK RQ+ELLS NE+GLS
Sbjct: 1084 PFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLS 1143

Query: 1121 RKAAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTID 1180
            RK AY ET+N+L+S+ ++ Q +     D L   LK++  DID EL+++Y+ I +LE TI 
Sbjct: 1144 RKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETIS 1203

Query: 1181 KQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNF 1240
             QFE+FKK+GYSLFAVFIHRGEASYGHYWVYIKD ++NG WRKYNDET++EVP+ EVFNF
Sbjct: 1204 HQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNF 1263

Query: 1241 TEGNTATPYFLVYVRQGHEHDIEPLKRIID 1270
            TEGNTATPYFLVYV++G E DIEPLKRII+
Sbjct: 1264 TEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 1344 bits (3479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/1242 (55%), Positives = 892/1242 (71%), Gaps = 42/1242 (3%)

Query: 59   DSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFI------NSKDHDILYSDLHNGILKAP 112
            D GK++LY  V   FP KT++RL+DD+I DL+F+      N    DI  + L NGILK  
Sbjct: 36   DDGKQLLYPNVENHFPMKTAERLIDDIIADLSFLTGIAVDNGSRGDI-DTMLGNGILKQS 94

Query: 113  VLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITS 172
            +L YS+  +Q   +  G+L+DQ+TLQT +EY S++CP  NKL V+ GVL +  +  +IT+
Sbjct: 95   MLNYSKVKNQPGSFEMGSLIDQVTLQTKYEYKSVTCPELNKLQVFFGVLFN--NSTQITN 152

Query: 173  -STLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLE-FDPTDPRL 230
               +++  +YHLKVTVKTR+ LE TKK AGVT +H + +  LH +D+QD+  F+P DP L
Sbjct: 153  LDEVTQFPIYHLKVTVKTRNHLELTKKHAGVTQFHLVDQ--LHVYDKQDIPTFNPEDPNL 210

Query: 231  VDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQ 290
            +D+AIYVS+DTNKL+LIEVF PEF   ++ E +    I  RY +AC++FDTL+P+E PTQ
Sbjct: 211  LDYAIYVSNDTNKLILIEVFKPEFQSADEIESFKSENINERYQKACEQFDTLNPNEPPTQ 270

Query: 291  ADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTG 350
             DC+NTL K+F+GPL+R++S+EP KTI+S N  LNS INP WLTSKYGF + V++D    
Sbjct: 271  LDCLNTLFKVFKGPLSRKSSDEPSKTIDSTNKTLNSHINPEWLTSKYGFNIVVDEDLPNA 330

Query: 351  ESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAK-TTSKVYRTF 409
            +   E+EPP L NY+ED +VRRLRE++IR+C++LIF GK +I L   D     SK Y++ 
Sbjct: 331  QQSVEYEPPELVNYVEDFEVRRLRETYIRRCLQLIFWGKLSINLRINDPTLKNSKSYKSI 390

Query: 410  NAIQIAFSKTTWFKMLGEHRSIFSF--ESASPLDANYNFINLSACFYYIDRDIIKNYEAQ 467
            NA+Q  F+ T   ++       F    ES SPLD N++FINLSAC++Y DRD+I+NYE  
Sbjct: 391  NALQTNFTITPLLQLFKGSGQNFLMGPESRSPLDFNFHFINLSACYHYTDRDVIRNYERL 450

Query: 468  CALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVAT 527
            C LDP+N G+YFDAL YIAN KG+YQL+AYCGKQD+VGQEALDQALK F +D  +VD+  
Sbjct: 451  CHLDPQNVGVYFDALNYIANTKGSYQLIAYCGKQDIVGQEALDQALKSFNLDPMEVDITK 510

Query: 528  IDDSLLVSIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXX 587
            I+DS+L+++YK+E   + ++    +LKNA+RL AK K S KLKF+ D+EPY+ V++AY  
Sbjct: 511  INDSVLLTLYKNELKISTSD--IPNLKNAMRLFAKVKHSSKLKFYIDHEPYRRVAQAYET 568

Query: 588  XXXXXXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLY 647
                         TAY I + DSPGL +DCDRALYTI + KRSL L  +L+++CPDFQ Y
Sbjct: 569  LDIDESVDDDIVQTAYDIKVVDSPGLTMDCDRALYTIAIHKRSLLLFTFLIERCPDFQEY 628

Query: 648  YGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERN 707
            Y P    Y +ALSM Q+NENA DE +++ FQ +W  E+ FE +  +    AL +IG++RN
Sbjct: 629  YCPDRFTYHDALSMFQVNENAADELIIKNFQARWFNESVFEPESFVICVHALVEIGLQRN 688

Query: 708  SKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETM 767
            S LI +F+ TG ID +CLP  +WP G+NNIGNTCYLNSLLQYYFS+APLR YVL+Y +T+
Sbjct: 689  SSLISNFLQTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSIAPLRNYVLQYSKTI 748

Query: 768  EHFR--HHTGNELRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYL 825
            E F+   +  + +RRIGG            QF+YQLRDLF AM+YS ERCVTPR+ELAYL
Sbjct: 749  EDFKTLENNASTVRRIGGREVSNNEVERSIQFIYQLRDLFHAMVYSNERCVTPRRELAYL 808

Query: 826  AFAPSNFEVEFE-----PTTVNAQHEVSKIAESTNND----ILMYGPTNRSDNDQTGPIE 876
            AFAPSN EVEFE     P T     EV+      + D     +  G  + SDN      E
Sbjct: 809  AFAPSNIEVEFETNENQPATQQDNPEVTTAELGQDKDEKERSVDSGDISMSDNITPKDAE 868

Query: 877  LDSDS---GNEDIDVS-MTKEPSEEYKEDIPMSDAEKDNIIS---TSTRVAKISSDQLEN 929
             + D     N++ DVS +   P++    DI M+D   D ++S   TST+VAKISSDQLEN
Sbjct: 869  EEEDQVAESNKNQDVSAIVSSPTK----DIIMTD-NTDTVVSNEGTSTKVAKISSDQLEN 923

Query: 930  ALEMGRQQDVTECIGNVLFQLESASDPINLDE-DNEQNDLVKQLFYGKIKQTIIPLAKST 988
            ALEMGRQQDVTECIGNVLFQLES S+P++L E DNEQ+DLVKQLFYG+++QTI+PLA   
Sbjct: 924  ALEMGRQQDVTECIGNVLFQLESGSEPLDLHENDNEQDDLVKQLFYGELEQTIVPLANPD 983

Query: 989  EIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQ 1048
            + + K+ER+LSLLVNIGDHP+DIYDALD YF DE L M EYGDVKRTVAVT+FPTILQIQ
Sbjct: 984  QRRPKLERFLSLLVNIGDHPRDIYDALDLYFKDEYLKMEEYGDVKRTVAVTKFPTILQIQ 1043

Query: 1049 IQRVYYDRERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQ 1108
            IQRVYYDRE+FMPFKSIEPLPF E +YMDRYS + +P+++ +K E+  +K +L  LK +Q
Sbjct: 1044 IQRVYYDREKFMPFKSIEPLPFEEKIYMDRYSVTDNPELIARKNETLLMKEKLVELKKKQ 1103

Query: 1109 KELLSVNELGLSRKAAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSL 1168
            ++LLS N +GLS+K +Y+E    L SD ++SQ +     D ++  LK   A ID EL  L
Sbjct: 1104 RDLLSRNSVGLSKKDSYIELGKLLSSDSLESQGIILPEKDEMVSSLKTLTAGIDDELNQL 1163

Query: 1169 YHDIAKLENTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDET 1228
            Y +I++LE TI+ QF EFK IGYS+FAVFIHRGEASYGHYW+YIKDRS+NG WRKYNDET
Sbjct: 1164 YAEISQLEETINGQFNEFKGIGYSIFAVFIHRGEASYGHYWIYIKDRSQNGIWRKYNDET 1223

Query: 1229 ITEVPETEVFNFTEGNTATPYFLVYVRQGHEHDIEPLKRIID 1270
            ++EVPE EV+NFTEGNTATPYFLVYV++G E +IEPLKRII+
Sbjct: 1224 VSEVPEEEVYNFTEGNTATPYFLVYVKEGEEQEIEPLKRIIE 1265

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 1332 bits (3446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/1244 (53%), Positives = 871/1244 (70%), Gaps = 39/1244 (3%)

Query: 39   TDHMVGNTKQADHLDTLTH-----RDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFIN 93
            T++ VGN   A  L++  +     +D+GK +LY +    FPFKTS+RLLDD+  +LA+ N
Sbjct: 11   TEYEVGNEGSAPGLESNLNDGQPIKDTGKTLLYADAGNLFPFKTSERLLDDIKLELAYKN 70

Query: 94   SKDHDILYSDLHNGILKAPVLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNK 153
            S +HDILYS+LH G+L+ P+L YSR+ +    Y+ G LVDQ+ L+T +EY S +CPG NK
Sbjct: 71   SIEHDILYSELHKGVLRLPILEYSRKPTDDV-YNIGHLVDQVVLKTRYEYDSKTCPGLNK 129

Query: 154  LNVYMGVLIDVPHDYKITSSTLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADL 213
            + V+MGVL++     KI    +++ +VYHLKVTVKTR  LE T+K+AGV  YH + E  L
Sbjct: 130  ITVFMGVLLNSSQMPKIYDD-VTQASVYHLKVTVKTRLHLERTRKQAGVPQYHLLPE--L 186

Query: 214  HQFDRQDLEF-DPTDPRLVDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRY 272
            H FD++DL   D  DP L+D  +YVSSDTNKL+ IE+F PEF + + TE +   AIK RY
Sbjct: 187  HPFDKEDLLLTDAEDPHLIDSVMYVSSDTNKLICIEIFKPEFSQADLTE-FCPDAIKKRY 245

Query: 273  SEACQRFDTLDPSEIPTQADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNW 332
            S AC ++  LDP  IP+QA+C +TLLKIF+GPLNR+  E+ LKTI++DN  LNS+++P W
Sbjct: 246  SSACDKYPDLDPDMIPSQAECFSTLLKIFKGPLNRRGPEDVLKTISADNKFLNSQLDPKW 305

Query: 333  LTSKYGFELHVEKDESTGESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAI 392
            LT K+ F+L    D     S  EF+PP+LTNY++D  VR LRES+ RKC+ELIFLGK + 
Sbjct: 306  LTEKFAFKLCQANDTDEAGSAMEFQPPDLTNYVDDVSVRELRESYTRKCLELIFLGKMSS 365

Query: 393  ELLGKDAKTTSKVYRTFNAIQIAFSKTTWFKMLGEHRSIFSFESASPLDANYNFINLSAC 452
             L+ K+        R+F   Q + S + +F +L E R +  + S   +D NYNF+NLS+C
Sbjct: 366  SLMTKEDIAKDSRARSFQLYQTSNSLSFFFHLLNETRGVMDYGSQE-IDRNYNFMNLSSC 424

Query: 453  FYYIDRDIIKNYEAQCALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQA 512
            +YY D+DIIKNYE Q  LD EN GIYFDALTYIAN KG+Y L+AYC KQDVVG+EALD A
Sbjct: 425  YYYTDKDIIKNYETQALLDRENIGIYFDALTYIANLKGSYALIAYCRKQDVVGKEALDSA 484

Query: 513  LKLFGIDSKDVDVATIDDSLLVSIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFF 572
            L LFGID  D  + TI D LL+ +Y+ E  +  +  +H  LKNALRLLAK K S  L+F+
Sbjct: 485  LSLFGIDPSDTSLMTIPDELLLGVYRKEC-SQGSTQKHATLKNALRLLAKAKNSSTLQFY 543

Query: 573  ADYEPYKNVSRAYXXXXXXXXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLR 632
            A YEPY NV +AY               TAY+I + DSPGLKIDCDRA+YT+ V KRS+ 
Sbjct: 544  AAYEPYDNVHQAYSLLEVDESVDVDVIQTAYTIKVADSPGLKIDCDRAIYTLAVTKRSMP 603

Query: 633  LLNYLLQQCPDFQLYYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYL 692
            L N+L++QCP F+ +Y    L Y +ALS+LQ+NENA D+ +LEVFQRKW+ ET    D  
Sbjct: 604  LFNFLVEQCPVFEEFYSADKLTYHDALSLLQVNENASDDIILEVFQRKWNHETVLSPDQF 663

Query: 693  LKLKAALTKIGIERNSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFS 752
            LK  +ALTKIG  RNS LI  +++TGTID  CLPA NWPTGLNNIGNTCYLNSLLQYYF 
Sbjct: 664  LKSSSALTKIGQVRNSLLINRYLETGTIDVRCLPARNWPTGLNNIGNTCYLNSLLQYYFC 723

Query: 753  LAPLRRYVLEYQETMEHFRHHTGN--ELRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIY 810
            ++PLR+++++YQ+T+  F    GN    RRIGG            QFVYQLRDLF  MI+
Sbjct: 724  ISPLRQFIVDYQKTLAEFHDSIGNLGSKRRIGGREVSESEVERSVQFVYQLRDLFTDMIH 783

Query: 811  SKERCVTPRKELAYLAFAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDND 870
            ++ R VTPRKELAYLAFAPSN EVEFE T       V    E++ ND+ +   T   +  
Sbjct: 784  TESRFVTPRKELAYLAFAPSNIEVEFEGTPT-----VEPAKENSENDVEVIDLTAEGE-- 836

Query: 871  QTGPIELDSDSGNEDIDV-----SMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSD 925
                        +ED+D+     S T+  + +  ED  M+D      + +STRVAKIS+D
Sbjct: 837  -----------ASEDVDMLKPAESETQVVTTQLNEDTVMNDVIATEPMVSSTRVAKISTD 885

Query: 926  QLENALEMGRQQDVTECIGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLA 985
            QLENALEMGRQQDVTECIGNVLFQLESASDPINLD D EQ DL+K+LF+GK+KQ + PL 
Sbjct: 886  QLENALEMGRQQDVTECIGNVLFQLESASDPINLDSDGEQRDLIKELFFGKLKQDLAPLK 945

Query: 986  KSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTIL 1045
              ++I+TKIER++SLLVN+GDHPK++YDALD YF D+ L + E GDVKRT+A+ E P +L
Sbjct: 946  DPSKIRTKIERFVSLLVNVGDHPKNVYDALDQYFKDDVLQL-EDGDVKRTLAIKELPVVL 1004

Query: 1046 QIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLK 1105
            QIQIQRVYYDRE+FMPFKSIEPLPF + +YMDRY D+QD +M +K++E+ + K +L  LK
Sbjct: 1005 QIQIQRVYYDREKFMPFKSIEPLPFRDTIYMDRYMDTQDAEMQQKRQEAAKYKNELESLK 1064

Query: 1106 IRQKELLSVNELGLSRKAAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQEL 1165
            +RQK LL  N  G+S K + +ET  +L+S +++   ++    D  ++ ++  +  ID EL
Sbjct: 1065 LRQKALLEKNGNGMSFKTSLLETERFLESGVLEQNAIEIQKKDSALKAIESMLLKIDNEL 1124

Query: 1166 TSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYN 1225
            + +Y  I  L+  +   F+ FK++GYSLFAVFIHRGEASYGHYW+YIKD ++NG WRKYN
Sbjct: 1125 SEIYSRITALDQKLSSHFDNFKELGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYN 1184

Query: 1226 DETITEVPETEVFNFTEGNTATPYFLVYVRQGHEHDIEPLKRII 1269
            DET+TE PE EVFNFTEGNTATPYFLVYV+ GHE +I+PL R+I
Sbjct: 1185 DETVTEAPENEVFNFTEGNTATPYFLVYVKNGHESEIQPLHRVI 1228

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 1320 bits (3417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/1225 (53%), Positives = 864/1225 (70%), Gaps = 28/1225 (2%)

Query: 53   DTLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAP 112
            D  + +D+GK +LY +  + FPFKTS+RLLD++  +LA+ NS  HDILYS LH+G+LK P
Sbjct: 30   DGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALHSGVLKLP 89

Query: 113  VLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITS 172
            VL YSR+     P+S G L+DQ+ L+T +EY S +CPG NK++V+MGVL+  P       
Sbjct: 90   VLEYSRKPVP-DPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVS-PSIVPREP 147

Query: 173  STLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLEF-DPTDPRLV 231
              L+   +YHLK+TVKTR  LEHT+K+AGV  YH +SE  LH  D+QDL   + +DP L+
Sbjct: 148  EDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSE--LHPSDKQDLFLAEESDPSLL 205

Query: 232  DHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQA 291
            D A+YVSSDTNKLV IE+F PEF  E+    +S  +I+ R++EAC +F  LDP ++P+QA
Sbjct: 206  DSAMYVSSDTNKLVCIEIFKPEFSHED-LATFSPDSIRRRFAEACGKFPDLDPEKVPSQA 264

Query: 292  DCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGE 351
            +C +TLLKIF+GPLNR++ ++ LKTI++DN  LNS+I P WLT ++ F+L   +     E
Sbjct: 265  ECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPE 324

Query: 352  SYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVYRTFNA 411
            +  E++PP+LT+Y+ +  VR+LRE + RKC+EL+FLGK A+ L+ KD        R+F+ 
Sbjct: 325  TALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSRARSFHL 384

Query: 412  IQIAFSKTTWFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALD 471
             QI++S + +F +LGE R +  + +   +D NY+FINLSAC YY D+DIIKNYE Q  LD
Sbjct: 385  YQISYSPSFFFHLLGETRGVMDYGTQE-IDKNYHFINLSACHYYSDKDIIKNYETQARLD 443

Query: 472  PENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDS 531
            PEN GIYFDAL +IAN KG+YQL+ YC KQDVVG+EALD AL LFGID+ D D++T+ D 
Sbjct: 444  PENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDD 503

Query: 532  LLVSIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXXXXXX 591
            LL+ IY+ E+ +  ++ + + LKN+LRL+AK KKS  L+F+  YEPY N  +AY      
Sbjct: 504  LLLGIYRKES-SQASQQKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLEVN 562

Query: 592  XXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPG 651
                     TAY++ + DSPGLKIDCDRA+YTI V +RS+ L N+L +QCP F  +Y   
Sbjct: 563  ESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYSAD 622

Query: 652  TLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLI 711
             L Y EAL++LQ+NENA D+ +LEVFQRKWHQE     D  L   +ALTKIG  RNS LI
Sbjct: 623  KLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSLLI 682

Query: 712  LHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFR 771
              +++TG ID SCLPA NWPTGLNNIGNTCYLNSLLQYYF ++PLR+ ++EYQ+T+  F 
Sbjct: 683  NRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFH 742

Query: 772  HHTGN--ELRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAP 829
               G+    RRIGG            QFVYQLRDLF  M++++ R VTP KELAYLAFAP
Sbjct: 743  QSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAFAP 802

Query: 830  SNFEVEFEPTTVNAQ------HEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGN 883
            SN EVEFE T  +         E   I E+T    L   P    D +   P+     S +
Sbjct: 803  SNIEVEFEGTPSSGSVGEAEDEEEGAIKETTEVIDLTSVPNAEQDIEMLDPVP----SES 858

Query: 884  EDIDVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTECI 943
            E I       P ++ K+D   +       I TSTRVAKISSDQLENALEMGRQQDVTECI
Sbjct: 859  EMIVEQFVDSPKDDKKQDAAEA-------IGTSTRVAKISSDQLENALEMGRQQDVTECI 911

Query: 944  GNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVN 1003
            GNVLFQLESAS+P  LD D EQ DL+KQLF+GK++Q + PL   T+++TKIER++SLLVN
Sbjct: 912  GNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVN 971

Query: 1004 IGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFK 1063
            +GDHPKD+YDALD YF ++ L + E GDV R+VA+ E P +LQIQIQRVYYDRERFMPFK
Sbjct: 972  VGDHPKDVYDALDQYFKNDVLQL-EDGDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFK 1030

Query: 1064 SIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKA 1123
            SIEPLPF + +YMDRY D++DP M++K++E+  LK +L  LK +Q+ LL  N  G+S K+
Sbjct: 1031 SIEPLPFEDSIYMDRYMDTEDPVMLKKREEAATLKKELVTLKEKQRSLLDKNGSGMSFKS 1090

Query: 1124 AYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQF 1183
            + +ET  +L+SD++++ +++  N +  I+ +   +  ID+EL S+YH IA LE  +   F
Sbjct: 1091 SLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHF 1150

Query: 1184 EEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEG 1243
            ++FK+ GYSLFAVFIHRGEASYGHYW+YIKD  KNG WRKYNDE++TE PE+EVFNF+EG
Sbjct: 1151 DDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEG 1210

Query: 1244 NTATPYFLVYVRQGHEHDIEPLKRI 1268
            NTATPYFLVYV+ G E  IEPL R+
Sbjct: 1211 NTATPYFLVYVKNGQESQIEPLHRV 1235

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 1315 bits (3403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/1260 (52%), Positives = 867/1260 (68%), Gaps = 55/1260 (4%)

Query: 59   DSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFI---NSKDHDILYSDLH---------- 105
            D GK +LY   S    FKT+DRLLDDL+ DL+++   NS +H    ++ +          
Sbjct: 62   DDGKHILYDSFSNHSFFKTADRLLDDLMIDLSYMLFNNSSEHINDNNNNNDNNHNNNNNT 121

Query: 106  --------------NGILKAPVLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGH 151
                          NGIL+ P   YS+     + ++ GT+VDQI LQT FE+ S++CP  
Sbjct: 122  SNSNNDTNEIKTYINGILRLPSHQYSKDRYSKFTFAMGTIVDQINLQTRFEFKSVTCPEF 181

Query: 152  NKLNVYMGVLIDVPHDYKITSSTLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEA 211
            N ++V +GVL+D      + +       VYH K+TVKTRS LE TKK  G++H+H I   
Sbjct: 182  NDVHVLLGVLMDNRSQAPLGTFL----PVYHFKITVKTRSYLEKTKKHVGISHFHLIDFD 237

Query: 212  DLHQFDRQDLEF---DPTDPRLVDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAI 268
            DLH+FD++DLE    D     L+D AI++S DTNKLV++E+F PEF+  E+ E +S  +I
Sbjct: 238  DLHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEIFKPEFNELEEIESFSQESI 297

Query: 269  KTRYSEACQRFDTLDPSEIPTQADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRI 328
              RY  AC RF  LD  +IPTQ +C+NT+ KIF+GPLN +N  EPLK IN+DN +LNS  
Sbjct: 298  AERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKNINEPLKAINADNPLLNSHW 357

Query: 329  NPNWLTSKYGFELHVEKDESTGESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLG 388
            NPNWL +KYGF   ++ +  T E + E+ PPNL +YI D   R LRES+IRKC+ELIF+ 
Sbjct: 358  NPNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDINTRALRESYIRKCLELIFIS 417

Query: 389  KTAIELLG-KDAKTTSKVYRTFNAIQIAFSKTTWFKMLGEHRSIFSFESASPLDANYNFI 447
            K  I L+G  D +  SK  R+FN +Q  F+ + W + L EH+     ++ + LD  Y++I
Sbjct: 418  KRNISLMGPNDLQYNSKAIRSFNILQTVFTTSFWHQFLYEHKP--QLDTYNKLDYEYHYI 475

Query: 448  NLSACFYYIDRDIIKNYEAQCALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQE 507
            NL   FYY +RDII+NY    ALDP N GIY+DAL YIA  K +YQL+++  KQDV+GQE
Sbjct: 476  NLLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYIAQSKNSYQLISFVSKQDVIGQE 535

Query: 508  ALDQALKLFGIDSKDVD-VATIDDSLLVSIYKSE-TMANPNENRHTDLKNALRLLAKYKK 565
            AL+QAL LF ID+ D   ++T+ +S++ +IYK+E   AN +  R  ++KNALRLLAKYK 
Sbjct: 536  ALNQALTLFNIDNNDSSAISTLTESMIFTIYKTERKQANISSARLAEMKNALRLLAKYKH 595

Query: 566  SDKLKFFADYEPYKNVSRAYXXXXXXXXXXXXXXXTAYSISINDSPGLKIDCDRALYTIG 625
            SD+LKF+ADYEPY + S+ Y               TAY+I +ND+PGLKIDCDRAL T+ 
Sbjct: 596  SDRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAYTIKVNDAPGLKIDCDRALLTVA 655

Query: 626  VRKRSLRLLNYLLQQCPDFQLYYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQET 685
             R++SL L  +LLQ+CP F  +YG     Y +AL+ LQ+NENA DET+LE+FQ++W  + 
Sbjct: 656  TRRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQVNENATDETILEIFQQRWSNDK 715

Query: 686  AFESDYLLKLKAALTKIGIERNSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNS 745
            + + D +L L++AL+KI  E+NSKLI +FIDTG +D +CLP +NWP GLNNIGNTCYLNS
Sbjct: 716  SLDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPTCLPVENWPAGLNNIGNTCYLNS 775

Query: 746  LLQYYFSLAPLRRYVLEYQETMEHFRHHTG-----NELRRIGGXXXXXXXXXXXXQFVYQ 800
            LLQYYFS+ PLR ++L+YQ TM+HF++         + RRIGG            QF+YQ
Sbjct: 776  LLQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEKRRRIGGREVNELEVERSVQFIYQ 835

Query: 801  LRDLFQAMIYSKERCVTPRKELAYLAFAPSNFEVEFEPTTV--------NAQHEVSKIAE 852
            +RDLF+ MI+S+ RCV+PR+ELAYLAF PSN EVEFE  +         NAQ  V    E
Sbjct: 836  VRDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFESASTEDDMGDKSNAQDAVVLQDE 895

Query: 853  STNNDILMYGPTNRSDNDQTGPIELDSDSGNEDIDVSMTKE--PSEEYKEDIPMSDAEKD 910
            + N+  +     N  D +    +   +D    D    +T     S+E  +  P  +   +
Sbjct: 896  AKNDTDINLTEVNLIDLEPATKVSTSNDQPTMDAIEILTNSDNKSKELSKTNPFREVSPN 955

Query: 911  NIISTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINLD-EDNEQNDLV 969
              I+ STRVAKISSDQLENA EMGRQQDVTECIGNVLFQLE+  DPI+LD EDNEQ DLV
Sbjct: 956  EDITISTRVAKISSDQLENAFEMGRQQDVTECIGNVLFQLETGFDPISLDNEDNEQYDLV 1015

Query: 970  KQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLTMAEY 1029
            K+LFYGK KQ+IIPL  ++  + K+ER+LSLLVNI DHPKDIYDAL+ YF+DE LTM EY
Sbjct: 1016 KELFYGKTKQSIIPLNHNSNERIKVERFLSLLVNITDHPKDIYDALNQYFADEFLTMEEY 1075

Query: 1030 GDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMVE 1089
            GDVK+T+++TE+P ILQIQIQRVYYDRERFMPFKSIEPLPF +V+YMDRY++S DP+++ 
Sbjct: 1076 GDVKKTLSMTEYPKILQIQIQRVYYDRERFMPFKSIEPLPFEQVIYMDRYAESSDPELIS 1135

Query: 1090 KKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKSQELKGLNNDF 1149
            KK+E+ QLK +L   + RQKELLS NELGLSRK A METI +LKS +I    +   N D 
Sbjct: 1136 KKEETAQLKLKLKEYRARQKELLSKNELGLSRKEAMMETIKFLKSPVILENGIDTTNKDV 1195

Query: 1150 LIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYW 1209
            L+ +L+Q +  I+ EL++LY+ I +L+N ID QF++FKK+ YSLFAVFIHRGEASYGHYW
Sbjct: 1196 LVRELQQYVDGINNELSNLYNKINQLQNRIDHQFDDFKKLAYSLFAVFIHRGEASYGHYW 1255

Query: 1210 VYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEHDIEPLKRII 1269
            VYIKD SKNG WRKYNDE++TEVPE EVFNFTEGNTATPYFLVYV+Q    DIEPLKRII
Sbjct: 1256 VYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTATPYFLVYVKQDSLSDIEPLKRII 1315

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 1283 bits (3321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/1254 (52%), Positives = 868/1254 (69%), Gaps = 46/1254 (3%)

Query: 37   RETD-HMVGNTKQADHLDTLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSK 95
            R+TD  M  + K     D L   D GK +LY ++    P KTSDRL+DD++ DL+ +N +
Sbjct: 31   RDTDVDMESSLKSVSPTDQLP--DDGKHLLYTDLKNGSPMKTSDRLIDDILCDLS-LNGQ 87

Query: 96   DHDILYSDLHNGILKAPVLAYSRRISQLYPYS-FGTLVDQITLQTSFEYPSISCPGHNKL 154
               +L S+   GILK   + YS++  QL   S  G+L+DQ+  QT FEY S+SCP HNKL
Sbjct: 88   SQCLL-SEQSQGILKLLPIIYSKQRQQLQNVSILGSLLDQVLFQTKFEYSSVSCPQHNKL 146

Query: 155  NVYMGVLIDVPHDYKITSSTLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLH 214
             V++GVL++V   ++ T   +  + ++HLKVTVKTRS LE  KK AGV+ +  +    LH
Sbjct: 147  QVFLGVLLNVSSSFESTDDVV-RSPLFHLKVTVKTRSQLELYKKHAGVSQFFSVDS--LH 203

Query: 215  QFDRQDL-EFDPTDPRLVDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYS 273
             +D++DL  FDP D RL+D+AIYVSSDTNKLVLIE+F PEF+  E+ E ++   I+ RY 
Sbjct: 204  SYDKEDLGTFDPEDTRLIDYAIYVSSDTNKLVLIEIFHPEFNTSEEIESFTVDGIRKRYV 263

Query: 274  EACQRFDTLDPSEIPTQADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWL 333
            + C R D+L+P +IP Q DC+NTL K F+ P+N+ +   PL+TI + N +LNS +N NWL
Sbjct: 264  DTCSRLDSLNPEDIPNQFDCLNTLYKTFKNPINKTDPSAPLQTIKASNPILNSHMNANWL 323

Query: 334  TSKYGFELHVEKDESTGESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIE 393
            T +YGF L   ++E   + Y   EPPN T YI D KVR+++E +IRKC++LIF  K  IE
Sbjct: 324  TERYGFTLLPGENEDDEDEY---EPPNFTTYIMDPKVRKMKECYIRKCLQLIFWAKLMIE 380

Query: 394  LLGKDAKT----TSKVYRTFNAIQIAFSKTTWFKMLGEHRSIF--SFESASPLDANYNFI 447
            ++    ++    +SK +++ + I +  +    +++ GE ++ F  S +     D NY+FI
Sbjct: 381  VVDNTQRSKLAASSKSFKSLSGIAVQNTSKPLYQLFGESKNAFLNSNDQNYMWDTNYHFI 440

Query: 448  NLSACFYYIDRDIIKNYEAQCALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQE 507
             LSA ++Y DRDII NYE    +D  N GIYFDA+ +IANRKG+YQL+AYCGKQ++VG E
Sbjct: 441  ALSASYHYNDRDIIMNYETYSVIDKGNIGIYFDAIQFIANRKGSYQLLAYCGKQNIVGHE 500

Query: 508  ALDQALKLFGIDSKDVDVATIDDSLLVSIYKSETMANPNENRHTDLKNALRLLAKYKKSD 567
            AL+ A++ F +D   +D+  +D SLL+S+YK E ++N N +  +DLKNALR+LAK+K + 
Sbjct: 501  ALEAAMRAFKLDPAAIDINKLDISLLLSMYKHEQISNQNTSHLSDLKNALRVLAKFKDNR 560

Query: 568  KLKFFADYEPYKNVSRAYXXXXXXXXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVR 627
             +KF+ D+EPYK VS+AY               TAYSI +NDSPGLKI+C RALYTI + 
Sbjct: 561  FVKFYVDHEPYKTVSQAYNELEVDESVDDDIIQTAYSIKVNDSPGLKIECIRALYTIAIN 620

Query: 628  KRSLRLLNYLLQQCPDFQLYYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAF 687
            KRS+ L NYL+++CP+FQ +YGP    Y +AL+++Q+NENA DE +L++FQ+KW+ E   
Sbjct: 621  KRSMALFNYLIEECPEFQDFYGPEKYSYEQALAIIQVNENASDEMILQIFQKKWNDEPLV 680

Query: 688  ESDYLLKLKAALTKIGIERNSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLL 747
            E D  L LKAAL K+ IE+NSKLI HF+ TG ID SCLP +NWP GLNNIGNTCYLNSLL
Sbjct: 681  EYDQFLSLKAALLKLCIEKNSKLISHFLTTGLIDPSCLPVENWPIGLNNIGNTCYLNSLL 740

Query: 748  QYYFSLAPLRRYVLEYQETMEHFRHHTGNEL--RRIGGXXXXXXXXXXXXQFVYQLRDLF 805
            QYYF++APLR Y+  YQ T E F     +    RRIGG            QF YQLRDLF
Sbjct: 741  QYYFAIAPLRNYICSYQSTTESFEATDTDAKINRRIGGRQVCASEVERSIQFTYQLRDLF 800

Query: 806  QAMIYSKERCVTPRKELAYLAFAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTN 865
              MI+S  RCV+P +ELAYLAF+PSN EVEF+          S IA  +     + G   
Sbjct: 801  NGMIFSNSRCVSPTQELAYLAFSPSNIEVEFDAG--------SGIASESGGTFSLNG--- 849

Query: 866  RSDNDQTGPIELDSDSGNEDIDVSMTKEPS-------EEYKEDIPMSDAE-KDNIISTST 917
                D   P  L     NED+ ++   EP           + D+P+   +    +I++ST
Sbjct: 850  ---KDTDAP--LTDMPLNEDVTMTEAGEPQLDDTGLLAPVEADVPVDQMKLAKEVINSST 904

Query: 918  RVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKI 977
            +VAKI SDQLENALE+GRQQDVTECIGNVL+QLESASDPI LDEDNEQ DL+K LFYGK 
Sbjct: 905  KVAKIGSDQLENALELGRQQDVTECIGNVLYQLESASDPIKLDEDNEQYDLIKHLFYGKT 964

Query: 978  KQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVA 1037
            +Q I+PL+ ST++++K ER+LSLLVN+ DHPKDIYDALDSYF +E LT+ EYGDV+RTVA
Sbjct: 965  RQDIVPLSNSTDVRSKYERFLSLLVNVSDHPKDIYDALDSYFMEEYLTLEEYGDVRRTVA 1024

Query: 1038 VTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQL 1097
            +TEFPTILQIQIQRVYYDRERFMPFKSIEP+PFN  LYMDRY+ + DP M+ K++E+ +L
Sbjct: 1025 ITEFPTILQIQIQRVYYDRERFMPFKSIEPIPFNSTLYMDRYAATDDPVMLTKRRETSEL 1084

Query: 1098 KAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKS-QELKGLNNDFLIEQLKQ 1156
            K +L   K+RQ+ELLS N++GLSRK AY ET+  L+SD ++    ++G +   ++  L  
Sbjct: 1085 KTRLRECKVRQQELLSRNDMGLSRKEAYTETMKMLQSDFLEQVPSVRGEDQTAVVSGLSD 1144

Query: 1157 SIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRS 1216
             +A ID+EL  LY +I +LE  ID QF+ F+K+GYSLFAVFIHRGEASYGHYWVY+KD  
Sbjct: 1145 MVASIDEELVQLYTEIGQLETQIDHQFDSFQKVGYSLFAVFIHRGEASYGHYWVYVKDFK 1204

Query: 1217 KNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEHDIEPLKRIID 1270
             +G WRKYNDET++EVPE EVFNFTEGN ATPYFLV V+Q HE DIEPL RIID
Sbjct: 1205 NSGIWRKYNDETVSEVPEEEVFNFTEGNNATPYFLVLVKQTHEQDIEPLHRIID 1258

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 1283 bits (3319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/1227 (54%), Positives = 871/1227 (70%), Gaps = 38/1227 (3%)

Query: 54   TLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPV 113
            +L   D GK++LY  V    PFKT DRL+DD+++DLAFIN  D     S    GILK+  
Sbjct: 31   SLPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSD----LSSEFKGILKSSP 86

Query: 114  LAYSRRISQLYP-YSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITS 172
            L YS+R  +L P Y  GT +DQITLQT +EY SISCP HN++NV+ GVLID   +   + 
Sbjct: 87   LTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNMENPTSF 146

Query: 173  STLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTDPRLV 231
              ++E  +YHLKVTVKTR+ LEH KK  G++HYH I+E  LH FD+QDL  FD +D  L+
Sbjct: 147  DAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITE--LHPFDKQDLLTFDESDENLI 204

Query: 232  DHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQA 291
            D A YVSSDTNKL+LIE+F PEF  EE+ E +    I +RY   C+++D+L+   IP+Q 
Sbjct: 205  DFAAYVSSDTNKLILIEIFKPEFSSEEEIESFKTEHITSRYQLVCEQYDSLNSDTIPSQV 264

Query: 292  DCINTLLKIFRGPLNRQNSE-EPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTG 350
            DC  TL ++F+GPL+R++++ +P+KTIN+ N  LNS ++  WL SKYGF+ +  ++    
Sbjct: 265  DCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEAN 324

Query: 351  ESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGK-DAKTTSKVYRTF 409
            +   E+EPP+L ++  D K+R+LR+S+ RKC++L F GK + +LL K + +   K YR F
Sbjct: 325  DQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFF 384

Query: 410  NAIQIAFSKTTWFKMLGEHRSIFSFE--SASPLDANYNFINLSACFYYIDRDIIKNYEAQ 467
            N +    S T  F++  +       +  SASPLD NY+FINLS+ +YY DRDII+NYE  
Sbjct: 385  NKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETL 444

Query: 468  CALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVAT 527
            C +D  N GIYFDALTYIAN KG+YQL++YCGKQDVVGQE L  +L++ G+D+  VD+ +
Sbjct: 445  CNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKS 504

Query: 528  IDDSLLVSIYKSETMANPNE-NRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYX 586
            ++DSLL SIYK E  A+  +  R T+LK+A+R++ K  +S KL+FF D+EPY NV  AY 
Sbjct: 505  LNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYN 564

Query: 587  XXXXXXXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQL 646
                          TAY+I INDSPGLK+DCD+ALYTI +R RS+ L N+L++QCPDF  
Sbjct: 565  LLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFIT 624

Query: 647  YYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIER 706
            YYGP  L + +ALS+LQ+NENA DE V+++FQ++W Q+   E D LL LKAALTKI  E+
Sbjct: 625  YYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQLLILKAALTKIASEK 684

Query: 707  NSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQET 766
            NSKLI +F++TG IDA+ L  +NWP GLNNIGNTCYLNSLLQYYFS+APLR Y+L Y+ +
Sbjct: 685  NSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744

Query: 767  MEHFRHHTGNELRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLA 826
            + ++     +  RRIGG            QF+YQLRDLF  MIYSK RC+TP+ ELAYLA
Sbjct: 745  ISNYEIDETSNKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAYLA 804

Query: 827  FAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNEDI 886
            FAPSN EVEF  + V          E T  D+           D+ G I+L  D  N+++
Sbjct: 805  FAPSNIEVEFAASEV----------ERTTVDLPF---------DKEGDIDL-VDLSNDNL 844

Query: 887  DVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTECIGNV 946
            +   T   ++E   DI ++  +K  + +TST+ AKISSDQLENALEMGRQQDVTECIGNV
Sbjct: 845  N---TTNNAQEVTSDISVATEDK-VMTNTSTKTAKISSDQLENALEMGRQQDVTECIGNV 900

Query: 947  LFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGD 1006
            L+Q+ESAS PI LDED EQ DL+K+LFYGK KQ I+PL+  ++ +TK E + SLLVNI D
Sbjct: 901  LYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISD 960

Query: 1007 HPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIE 1066
            HP+DIYDAL+S F+ E L M EYGDV+RTV++T FP ILQIQIQRVYYDRERFMPFKSIE
Sbjct: 961  HPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIE 1020

Query: 1067 PLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYM 1126
            PLPF+  +YMDRY+   +  +  KK E+++L+ +L  LK RQ ELL+ NELGLSRK +Y+
Sbjct: 1021 PLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYL 1080

Query: 1127 ETINYLKSDL-IKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEE 1185
            ETIN+L  +  + SQ L  LN   +IE+L+++I++ID EL+ +Y +I  +EN ID QF+E
Sbjct: 1081 ETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFDE 1140

Query: 1186 FKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNT 1245
            F+ IGYSLFAVFIHRGEASYGHYWVYIKD  ++G WRKYNDET+TEV E EVFNFTEGNT
Sbjct: 1141 FRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDETVTEVNEEEVFNFTEGNT 1200

Query: 1246 ATPYFLVYVRQGHEHDIEPLKRIIDRD 1272
            ATPYFLV+V+  ++ DIEPLKRII  D
Sbjct: 1201 ATPYFLVFVKDYYKGDIEPLKRIIADD 1227

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 1260 bits (3261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/1229 (51%), Positives = 864/1229 (70%), Gaps = 27/1229 (2%)

Query: 55   LTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAF---INSKDH--DILYSD-LHNGI 108
            L   D G ++LY+ +    P KTS+R+LDD++ ++     INSK++   + Y++  +N I
Sbjct: 64   LNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSI 123

Query: 109  LKAPVLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDY 168
            LK P++ YS+  + ++P S G++VDQI +Q+ FEY S++CP HNK+ V+MGVLID     
Sbjct: 124  LKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDSTQKA 183

Query: 169  KITSSTLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTD 227
              T   LS   + H+K+TVKTR++LE T++  G++ +H + E  LH FD++DL  FD   
Sbjct: 184  N-TLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKE--LHPFDQKDLLTFDKNA 240

Query: 228  PRLVDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEI 287
              L+DHAIYVS DTNKL+LIE+F PEFD +E+   ++   I  RY  +    +     +I
Sbjct: 241  ANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDI 300

Query: 288  PTQADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDE 347
            PT  +CINTL K+F+GPL R++S +P+K INSDN +L   +NP WL SKYGF + +EKD 
Sbjct: 301  PTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDV 360

Query: 348  STGESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDA-KTTSKVY 406
             TG+ + E+EPP+LT+Y+ +++ R++RES  RKC+ELIF GK  I LL K+  + +SK  
Sbjct: 361  ETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINLLSKEELEKSSKSL 420

Query: 407  RTFNAIQIAFSKTTWFKMLGEHRSI-FSFESASPLDANYNFINLSACFYYIDRDIIKNYE 465
            RTFN +Q +FS T++FK+L + R +    E+ S  + +Y+FINLS  ++Y +RDII+ +E
Sbjct: 421  RTFNLLQTSFS-TSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYHYSERDIIQMFE 479

Query: 466  AQCALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDV 525
                +DP+N G Y+D+L +IAN KG+YQL+AYC K D+VGQE+L+ A+K F +D     +
Sbjct: 480  VISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTAL 539

Query: 526  ATIDDSLLVSIYKSETMANP-NENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRA 584
            ++++DS+++SIY++E      ++ RH +L+NAL++LA YKKS KLKFF DYEPY N   A
Sbjct: 540  SSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKKLKFFVDYEPYLNTRTA 599

Query: 585  YXXXXXXXXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDF 644
            Y               TAYSI +ND+PGLK+DCDRALYTI + +RS+ L N+LL+    F
Sbjct: 600  YNMLEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISLFNFLLENNLIF 659

Query: 645  QLYYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGI 704
            Q YY   T  Y+ ALS+LQ+NENA DE +LEVFQ+KW +E     D+LLKLKAALTKI  
Sbjct: 660  QEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHLLKLKAALTKIAF 719

Query: 705  ERNSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQ 764
            +RNSKLI +F++TG ID SCLPA+NWPTGLNNIGNTCYLNSLLQYYF+++PLR  ++ Y 
Sbjct: 720  QRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYT 779

Query: 765  ETMEHFRHHTGNE--LRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKEL 822
            +T++   ++   +   RR+GG            QFVYQLRDLF  MIYS  RCVTP+KEL
Sbjct: 780  KTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKEL 839

Query: 823  AYLAFAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSG 882
            AYLAFAPSN EVEF+     +Q +      + + + +  G   ++DN     ++ DS+ G
Sbjct: 840  AYLAFAPSNVEVEFDSEDGKSQRD------NISTETVDVGADGKNDN---LLVDFDSNIG 890

Query: 883  NEDIDVSMTKEPSEEYKEDIPMSDAEKDNIIS--TSTRVAKISSDQLENALEMGRQQDVT 940
                D  +  +      + I   + +K N +   TSTRVAKIS DQLENALEMGRQQDVT
Sbjct: 891  ANGRDEKLLVDLDSNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENALEMGRQQDVT 950

Query: 941  ECIGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSL 1000
            ECIGNVL QLESAS P++LD+D EQNDL+K  F  K KQ+IIPL KS   + KIER+LSL
Sbjct: 951  ECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSL 1010

Query: 1001 LVNIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFM 1060
            LVNIGDHPK+IYDALD YF+DE L M EYG+V++T+++TEFP+ILQIQIQRVYYDRE+F+
Sbjct: 1011 LVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKFI 1070

Query: 1061 PFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLS 1120
            PFKSIEPLPF  VLYMDRY++  + ++++ K ++  +K +L+ +K RQKELLS NELGLS
Sbjct: 1071 PFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGLS 1130

Query: 1121 RKAAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTID 1180
            RK + +ET   L SD++ +  +       LI Q++ ++ +ID+ELT+L+++I  +E  I 
Sbjct: 1131 RKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNIS 1190

Query: 1181 KQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNF 1240
              F+EF+ I Y+LFAVFIHRGEASYGHYW YIKD  +N  WRKYNDETITEVP++EVFNF
Sbjct: 1191 NMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNF 1250

Query: 1241 TEGNTATPYFLVYVRQGHEHDIEPLKRII 1269
             EGNTATPYFLVYV+  +  DIEPLKRI+
Sbjct: 1251 IEGNTATPYFLVYVKNENIDDIEPLKRIV 1279

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 1174 bits (3038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/1273 (49%), Positives = 854/1273 (67%), Gaps = 60/1273 (4%)

Query: 41   HMVGNTKQAD-------HLDTLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFIN 93
            H  G+  +AD         D     D G+++LY  + T  P KTSDRLLDD++  + F+ 
Sbjct: 14   HFGGDPPEADLQGEPIPSADVTNIEDDGRQLLYPNIGTHLPLKTSDRLLDDILCSVGFLT 73

Query: 94   SKDHDILYSDLHNGILKAPVLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNK 153
            S D+          IL +  L YS++   +   + G   DQ+ +QT +EYPS SCP HNK
Sbjct: 74   SGDN--------KSILNSNTLEYSKQRPHIKGSAVGFFQDQVIIQTKYEYPSKSCPEHNK 125

Query: 154  LNVYMGVLIDVPHDYKITSSTLSENT---VYHLKVTVKTRSILEHTKKKAGVTHYHCISE 210
            + V MG+LI   +  K     +SE T   +YH+K++VK RSILE++KK  GV+ Y+ + +
Sbjct: 126  IFVIMGILIGTDYLEKAEKKQISEVTEIPIYHVKISVKVRSILENSKKLVGVSRYYKLDQ 185

Query: 211  ADLHQFDRQDL-EFDPTDPRLVDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIK 269
              LH +DR D   +DPTD +L+D A+Y + DTNK+VLIE++ PEFD E+K    S   IK
Sbjct: 186  --LHDYDRVDFPSYDPTDSKLLDSALYATDDTNKIVLIEIYKPEFDPEDKDLSVSSVQIK 243

Query: 270  TRYSEACQRFDTLDPSEIPTQADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRIN 329
             R+++A ++F  L   E PTQ D INTL K+F+GPL R++ + P K+I +++ +L S +N
Sbjct: 244  NRFAQAKEKFPQLAKEESPTQLDSINTLFKLFKGPLKRKSDDAPQKSIEAEHPLLISNMN 303

Query: 330  PNWLTSKYGFELHVEKDESTGESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGK 389
            P+ L + +GF  +  ++   GE    +  P+L NY+ D  +++LR++F RKC+ELI  G 
Sbjct: 304  PSALVTHFGF-TYTNENIPGGE----YMAPDLVNYLGDPNIQKLRDTFTRKCLELIAYGN 358

Query: 390  TAIELLGKDAKTT---SKVYRTFNAIQIAFSKTTWFKMLG-------------EHRSIFS 433
              I  L ++  +T   SK YR    IQ  FS  +W ++LG             EH+    
Sbjct: 359  IIISSLPQNITSTAEFSKKYRILRTIQPEFSLFSWLQLLGDFKSRNIELLNVNEHKGYHL 418

Query: 434  FESA-----SPLDANYNFINLSACFYYIDRDIIKNYEAQCALDPENTGIYFDALTYIANR 488
             E+      SP D + NF NLS C +Y +RDII+NYE    LD  N GIYFD+L+ +ANR
Sbjct: 419  QEAQKRVYYSPFDIDSNFTNLSVCLHYAERDIIQNYERLITLDEPNIGIYFDSLSVVANR 478

Query: 489  KGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDSLLVSIYKSETMANPNEN 548
            KG+YQL++YCGKQDV+GQEAL  +L +FGID   V + ++D++LL+S+YK E   NP+ N
Sbjct: 479  KGSYQLLSYCGKQDVIGQEALQNSLAVFGIDYTKVTLESLDENLLLSVYKHEWKENPDNN 538

Query: 549  RHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXXXXXXXXXXXXXXXTAYSISIN 608
            R +DLKNALRLLAKY  SD LKF+ DYEPY+ + +AY               TAY+I IN
Sbjct: 539  RISDLKNALRLLAKYFTSDYLKFYVDYEPYRIIQKAYDLLEIDESVDEDIIQTAYTIKIN 598

Query: 609  DSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGTLLYSEALSMLQLNENA 668
            D+PGLKIDCDRALYTI   +RSL L N+L  QCP+FQ YYG  +L Y ++  +LQ+NEN 
Sbjct: 599  DAPGLKIDCDRALYTIAYSRRSLMLFNFLFDQCPEFQRYYGAQSLGYHQSFEILQINENI 658

Query: 669  GDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLILHFIDTGTIDASCLPAD 728
             +  +L VFQ+KW      E D LLK +AALTKI +ERNS L+L+F++TG I+ + LPA+
Sbjct: 659  TEPNLLHVFQQKWKNTLLEEPDQLLKYRAALTKIALERNSNLLLNFLETGNINPNSLPAE 718

Query: 729  NWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGNEL--RRIGGXXX 786
            NWPTG+NNIGNTCYLNSLLQ+YF+++PLR Y+++YQ+T+     +  + +  RRIGG   
Sbjct: 719  NWPTGINNIGNTCYLNSLLQFYFAISPLREYIVQYQKTIADLSSNPDSIISKRRIGGRQV 778

Query: 787  XXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNFEVEFEPTTVNAQHE 846
                     QF+YQLRDL+  MI+S +RCVTP++ELAYLAFAPS+ +VEFE      +  
Sbjct: 779  GKNEIERSVQFLYQLRDLYNDMIFSSQRCVTPKRELAYLAFAPSSIDVEFE--NAKTKSP 836

Query: 847  VSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNEDIDVSMTKEPSE--EYKEDIPM 904
            +S I  S +       P+   + D    IE   +  NE+I+ +   E ++      DI M
Sbjct: 837  ISNIEGSNSTTDSQPMPSTGENIDHNMDIE-QEERNNEEINSTNNIESNDLVSNNHDIEM 895

Query: 905  SDAEKDN-----IISTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINL 959
             D +K+N     I  T+ +VAKI  +QLENALE+GRQQDVTECIGNVLFQLES+S P +L
Sbjct: 896  LDTDKENEGNMEIEDTAIKVAKIDPEQLENALELGRQQDVTECIGNVLFQLESSSSPTSL 955

Query: 960  DEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYF 1019
             ED+EQNDL+K+LF+G+  Q I PL   +  +TK+ER++SLLVNI DHPKD+YDALD YF
Sbjct: 956  SEDHEQNDLIKELFFGETNQHIKPLKADSVTRTKVERFVSLLVNIADHPKDVYDALDLYF 1015

Query: 1020 SDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRY 1079
             +E LTM EYG+VKR +A+ +FPTILQIQIQRVYYDRERFMP+KSIEPLPF   +Y+DRY
Sbjct: 1016 KEEYLTMEEYGEVKRELAIKKFPTILQIQIQRVYYDRERFMPYKSIEPLPFESDIYLDRY 1075

Query: 1080 SDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKS 1139
            +D+ D K+++K++E+ +LK QL   K RQKELLS NELGLSR+ AY ET N+L+S+++++
Sbjct: 1076 ADTDDVKLLQKREETAELKRQLRSFKERQKELLSRNELGLSRRDAYKETANFLRSEVLQN 1135

Query: 1140 QELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIH 1199
              +   + D L  +L++S + +  EL+ LY  I  LE  I+ QF++F + GY+LFAVFIH
Sbjct: 1136 TNISISDPDLLATKLEESASKVADELSDLYVKITNLEEKINHQFDDFTEHGYTLFAVFIH 1195

Query: 1200 RGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHE 1259
            RGEASYGHYWVYIKD   N  WRKYNDET+TEVPE EV NFTEGNTATPYF+V+V++GHE
Sbjct: 1196 RGEASYGHYWVYIKDFV-NSIWRKYNDETVTEVPEEEVMNFTEGNTATPYFIVFVKKGHE 1254

Query: 1260 HDIEPLKRIIDRD 1272
             DIEPLKR+I+++
Sbjct: 1255 KDIEPLKRMIEKN 1267

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 1173 bits (3035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/1228 (48%), Positives = 815/1228 (66%), Gaps = 63/1228 (5%)

Query: 59   DSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVLAYSR 118
            D GK +LY ++S  FPFKT DR+LDD+     F+             + ++K P+L YSR
Sbjct: 39   DDGKTLLYGDISKSFPFKTCDRILDDIRISPWFLKK---------FGSSVMKQPMLQYSR 89

Query: 119  RISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLID---VPHDYKITSSTL 175
               QL P++   L+DQ+ L++ ++Y S++CPG N ++V   +L+D    P+D+       
Sbjct: 90   ERQQLQPWNLVHLIDQVNLRSRYDYDSMTCPGKNTISVMFALLVDPNFTPNDFDDIDKF- 148

Query: 176  SENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTDPRLVDHA 234
                 +HLK+TVK RS LE+  +  G+THYH +    LH FD++D+   +  D RLVD +
Sbjct: 149  -PEYFFHLKITVKRRSYLENFNRHVGITHYHVLEPESLHPFDKRDIFIMEEKDCRLVDQS 207

Query: 235  IYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADCI 294
            I+VS+DTNKL+L+E+  PEF+ E   E +    I+ RY  ACQ FD L+P +IP+QA+C+
Sbjct: 208  IFVSADTNKLILVEIIKPEFNSENLAE-YRTAKIEERYKNACQEFDLLNPDDIPSQAECL 266

Query: 295  NTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYF 354
             TL  IF+ PL R+++    K I+ D+V LNS+IN +WLT+ + F L     E   +S  
Sbjct: 267  KTLFMIFKNPLQRKSANSEFKIISRDSVALNSQINTDWLTTMFDFSLQKTAVEDNVQSGE 326

Query: 355  EFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIEL---LGKDAKTTSKVYRTFNA 411
            E++PP+L +YI D KVR +RE++ RK +E++ +GK ++ L   LG + KT +K    F+ 
Sbjct: 327  EYKPPDLVDYITDFKVRGIREAYTRKSMEVVLIGKQSMLLENELGTEKKTVAKC---FSN 383

Query: 412  IQIAFSKTTWFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALD 471
               + S T WF +L  H+ I  F    P D NY+FINLS  F YID+DIIKNYE Q ALD
Sbjct: 384  QHFSASHTWWFNILN-HQHIEPF----PYDINYHFINLSVAFKYIDKDIIKNYETQIALD 438

Query: 472  PENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDS 531
             EN   YFDAL Y+ N KG+YQL+AYCGKQDVVG E L+ AL++FG+D  D+D + +D +
Sbjct: 439  QENISHYFDALQYVTNAKGSYQLIAYCGKQDVVGYEDLNNALQVFGLDPTDIDASLLDAN 498

Query: 532  LLVSIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXXXXXX 591
             ++  Y S  + + ++N+  DL+NALR+L KY  S K+ F  +YEPY NV +AY      
Sbjct: 499  TMIEYYNSHLLRS-SDNQRKDLRNALRVLGKYLGSQKMLFLVEYEPYYNVQQAYTLLKVD 557

Query: 592  XXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPG 651
                     TAY+I+I D+PGLK D DRA++TI + +RS+ LLN L  +CP+F  YY   
Sbjct: 558  ETVDDDIIQTAYTINIADAPGLKKDYDRAIFTIALDRRSIFLLNVLTDECPEFAQYYNCT 617

Query: 652  TLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLI 711
             + Y EAL++++++ NA D+ +LEVFQ+KW        DYLLKLK AL  IG  RNSKLI
Sbjct: 618  DISYDEALNIIEIDMNASDDVILEVFQKKWSHGIMTGPDYLLKLKMALQNIGFTRNSKLI 677

Query: 712  LHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE----TM 767
             HF+DTG +D SCLP   WP G+NN+GNTCYLNSLLQ++F++ PLR ++L Y +     +
Sbjct: 678  NHFLDTGIVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILNYDDDSAKLL 737

Query: 768  EHFRHHTGNELRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLAF 827
            +   +H+    RRIGG            QFVY LRDLF  MI++  RCVTP KEL YLAF
Sbjct: 738  DASEYHSR---RRIGGREVSKQEELRSVQFVYHLRDLFNDMIHTNSRCVTPTKELVYLAF 794

Query: 828  APSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNEDID 887
            APSN EVEF   TV AQ E+  +      D                P +      + D D
Sbjct: 795  APSNVEVEFGDDTV-AQKELIDLTTDVVED----------------PTDTTRHLASCDDD 837

Query: 888  VSMTKEPSEEYKEDIPMSDAEKDNIIST---STRVAKISSDQLENALEMGRQQDVTECIG 944
            + M + P       + + + +  +   T   S +VAKIS+DQLEN LE+GRQQDVTECIG
Sbjct: 838  IIMCQSP-------VALPEHKTSSEAGTQQYSVQVAKISADQLENTLEIGRQQDVTECIG 890

Query: 945  NVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNI 1004
            NVL QLE AS+P++L++D EQNDLVKQLFYG+IKQ +IP+     ++TK ER+LSLLVN 
Sbjct: 891  NVLAQLEIASEPLSLEDDLEQNDLVKQLFYGRIKQDLIPVNDEASVRTKYERFLSLLVNT 950

Query: 1005 GDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKS 1064
            GDHPKDIYDALD YF ++ L + EYGDVKRTV+++E P +LQIQIQRVYYDRE+FMPFKS
Sbjct: 951  GDHPKDIYDALDFYFQNDYLNLEEYGDVKRTVSISELPAVLQIQIQRVYYDREKFMPFKS 1010

Query: 1065 IEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAA 1124
            IEPLPF E LYMDRY  ++DPK++ + +++ +LK +L  LK RQ++LLS NE+GL+ K++
Sbjct: 1011 IEPLPFGETLYMDRYMATEDPKLLAEIQQNAELKQKLQDLKQRQRKLLSQNEIGLTLKSS 1070

Query: 1125 YMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFE 1184
             +ET  +L+S  +K+ ++   N    I  +   I +ID+EL SL++ I  LE TI +QF 
Sbjct: 1071 LIETKKFLQSGTLKAHDIDADNIPSSIAYIDILINNIDEELKSLFNKITDLETTISQQFS 1130

Query: 1185 EFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGN 1244
            EFK IGYSLFAVFIHRGEASYGHYWVYIKD +KNG WRKYND+++TEVP++EVFNFTEGN
Sbjct: 1131 EFKHIGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGN 1190

Query: 1245 TATPYFLVYVRQGHEHD-IEPLKRIIDR 1271
            TATPYFLVYVR+G E + IEPLKRI+ +
Sbjct: 1191 TATPYFLVYVREGQEQETIEPLKRILQQ 1218

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 1172 bits (3033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1231 (50%), Positives = 825/1231 (67%), Gaps = 36/1231 (2%)

Query: 58   RDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVLAYS 117
            R+ GK VLY  VS  +PFKTSDRLLDD+   L+F+       L     NG+LK+P+L YS
Sbjct: 27   REGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFV-------LEGVRGNGVLKSPMLDYS 79

Query: 118  RRISQLYPYSFGTLVDQITLQTSFEYPSISCP------GHNKLNVYMGVLIDVPHDYKIT 171
            +   +L  +S G L+DQ+ LQTS+EY S+          H+K+NV+MG+L D P     +
Sbjct: 80   KERGELRAWSIGYLLDQVLLQTSYEYASLGGSGGGGGDKHSKINVFMGLLCD-PMVKLCS 138

Query: 172  SSTLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLEF-DPTDPRL 230
               +   + YHL+VTVKTR  LE  K++ G+  YH ++  DLH  D+QDL F +  D  +
Sbjct: 139  EDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVN--DLHPADKQDLCFFEDDDECV 196

Query: 231  VDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQ 290
            +D A YVSS TN+LV IE+  PEF  EE +E ++  +I+ RY   C+++  L+   +P Q
Sbjct: 197  IDSATYVSSGTNRLVRIEILKPEFTAEEWSE-FTPDSIRKRYLSICEKYPDLNRENVPNQ 255

Query: 291  ADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTG 350
            A+C+NTL K+F+ PL+RQ+S++ LKTI+++N VLNS+++PNWL  K+GFEL  E  E  G
Sbjct: 256  AECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFEL-CEVQEEDG 314

Query: 351  ESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVYRTFN 410
               +E++PP+ TNY+ D  VR LRE +IRK +EL+F+GK +I LL K+    S   R+F 
Sbjct: 315  RKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLPKEVVAASSKLRSFQ 374

Query: 411  AIQIAFSKTTWFKMLGEH-RSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCA 469
              Q  FS T WF++LGE  R+ F+ +   P D N +FINLS  +YY DRDII+NYE+Q  
Sbjct: 375  LYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQIL 434

Query: 470  LDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATID 529
            LDP+N GIY+D LT+IAN KG++QL+ +  KQ++VGQEAL+ AL+LF ID  + D   I 
Sbjct: 435  LDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQIP 494

Query: 530  DSLLVSIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXXXX 589
            D +L+S YK E     N  +H DL+NALRLLAKYK+S+KLKF+ + EP++  S+AY    
Sbjct: 495  DEMLLSCYKEECKYG-NTRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYSILE 553

Query: 590  XXXXXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYG 649
                       TAY+I ++D+PGLK+DCDRALYT+ + KRS+ L NYLLQ+CP FQ +Y 
Sbjct: 554  IDESVDIDIIETAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQFYH 613

Query: 650  PGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSK 709
                 Y+ AL  LQ+N NA D+ +LE+F+RKW +E     D  L LK AL KI  ERNSK
Sbjct: 614  ISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHERNSK 673

Query: 710  LILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQET--- 766
            LI HF++TG ID + L + NWPTGLNNIGNTCYLNSLLQYYF+++PLR Y+  Y++T   
Sbjct: 674  LINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASD 733

Query: 767  -MEHFRHHTGNELRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYL 825
             + +         RRIGG            QFVYQLRDLF  M +SKERCVTP +ELAYL
Sbjct: 734  LLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYL 793

Query: 826  AFAPSNFEVEFEP--------TTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIEL 877
            +F+PS   VEFE         TT+  + E     ++   DI + G    ++      I  
Sbjct: 794  SFSPSTTNVEFESAAQVPFRDTTILLEQEPPN-EDTEVFDISIEGSNVETEAAAEDIIAD 852

Query: 878  DSDSGNEDIDVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQ 937
            D+    ++         +   ++   MS+  ++N   TST VAKIS DQLEN LE+GRQQ
Sbjct: 853  DNIDTKDESSSLSPSTSTSSSQKGNSMSNIVEENEPITSTCVAKISPDQLENTLEIGRQQ 912

Query: 938  DVTECIGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERY 997
            DVTECIGNVL+Q+ESAS P+N DE +EQ DLVKQLFYGK+KQ +IP+    + +TK ER+
Sbjct: 913  DVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIENPEKRRTKFERF 972

Query: 998  LSLLVNIGDHPKDIYDALDSYFSDERLTMA-EYGDVKRTVAVTEFPTILQIQIQRVYYDR 1056
            +SLLVN+GDHPKDIYDALD YF D+ L +  +   V+R+VAV E PTILQIQIQRVYYDR
Sbjct: 973  MSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTILQIQIQRVYYDR 1032

Query: 1057 ERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNE 1116
            E+ MPFKS EPLPF E LYMDRY  S + +++ KK+ES QL   L  +K R+K++LS N+
Sbjct: 1033 EKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQRRKKILSKND 1092

Query: 1117 LGLSRKAAYMETINYLKSDLIKSQELK-GLNNDFLIEQLKQSIADIDQELTSLYHDIAKL 1175
             GL+ K +  ET  +L+S ++   E K  +    LI+QL     +ID+EL++L   I  +
Sbjct: 1093 AGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKELSNLDDKIKDM 1152

Query: 1176 ENTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPET 1235
            EN+I  +F++F   GY+LFAVFIHRGEASYGHYWVYIKDR  +G WRKYNDE++TEVPE+
Sbjct: 1153 ENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPES 1212

Query: 1236 EVFNFTEGNTATPYFLVYVRQGHEHDIEPLK 1266
            EVF+FTE NTATPYFLVY++ GHEH+IEPLK
Sbjct: 1213 EVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
            [3756 nt, 1252 aa]
          Length = 1251

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/1215 (37%), Positives = 671/1215 (55%), Gaps = 101/1215 (8%)

Query: 75   FKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVLAYSRRISQLYPYSFGTLVDQ 134
            FKTSDR++DD++ DL+FINS   +I    L+ GIL+ P   YS+  S    Y    L ++
Sbjct: 106  FKTSDRIIDDILIDLSFINSSADEIKELGLNKGILRLPTTDYSKFRSSFSEYKIINLSNK 165

Query: 135  ITL-QTSFEYPSISCPGHNKLNVYMGVL---IDVPH-DYKITSSTLSENTVYHLKVTVKT 189
              L    FEY S +    NK+  +  +L    D  + DY+  +   S+N  YHLKV++KT
Sbjct: 166  NNLINYRFEYESKTNHQDNKILEFFSILHKPKDASNLDYESMAKFWSQNEFYHLKVSIKT 225

Query: 190  RSILEHTKKKAGVTHYHCISEADLHQFDRQD-LEFDPTDPRLVDHAIYVSSDTNKLVLIE 248
            R+ LE +KK   + H++ I E   ++ D+ D + F+P +P L+D+AI++SS+TNK+VL+E
Sbjct: 226  RNQLELSKKHTPIQHFYVIDE--FNEEDKLDFINFNPDNPNLLDYAIFISSNTNKVVLVE 283

Query: 249  VFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADCINTLLKIFRGPLNRQ 308
            +F  EF+  +K        +   Y +       L   ++PTQ D +  L+  F    N  
Sbjct: 284  IFKSEFNLNDKLIILDDLQVLNNYEKYKNSNHKL---KLPTQTDVLLVLMYCFNKQQNFD 340

Query: 309  N---SEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYFEFEPPNLTNYI 365
            N   SE+ +K    D+  +   +NP+WLT +  F L  ++DES           N  N I
Sbjct: 341  NIHSSEDEIKL--KDSKAIKISLNPSWLTER--FSLKFQEDESL----IFMNLRNNLNLI 392

Query: 366  EDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVYRTFNAIQIAFSKTTWFKML 425
              +K +R  + F R  +EL  L K+A + L K     + + +  + I I  S + W ++L
Sbjct: 393  --KKEKRRFDVFTRCLLELFVLIKSAPQKLVKCNSKDTNIIKVVDTISINSSLSFWSQIL 450

Query: 426  GEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALDPENTGIYFDALTYI 485
            GE++SI S  + +    +  FINLS    Y + +I+KNYE    L+P+  G+YFD+L ++
Sbjct: 451  GEYKSILSQNNFNQYSKHAEFINLSILPTYTESEIVKNYEILTILNPDKIGVYFDSLKFV 510

Query: 486  ANRKGAYQ-LVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDSLLVSIYKSETMAN 544
            +     Y+ L  Y  K +++G E  +Q+LK+F +D   ++     DS+L   Y +     
Sbjct: 511  SQCLTQYENLADYVNKNEIIGNEEFNQSLKIFKMDK--LEFTNCSDSVLWEKYLTYYEDK 568

Query: 545  PNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXXXXXXXXXXXXXXXTAYS 604
              +  H  L+N+++ L+  K S  LKF   YEPYKN   A+                +Y+
Sbjct: 569  NFDYNHAILRNSIKSLSIVKNSPILKFLCKYEPYKNPDNAFVTLNIHESVDSDTIIVSYT 628

Query: 605  ISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGTLLYSEALSMLQL 664
              IND    K   D+AL TI + ++ L L + L + C DF   Y    + Y  AL  +  
Sbjct: 629  TKINDMKDKKQHLDKALLTIAIDRKDLSLFHTLYENCKDFVNLYHSMNIEYKTALQAIDS 688

Query: 665  NENAGDETVLEVFQRKWHQ----ETAFESDY--LLKLKAALTKIGIERNSKLILHFIDTG 718
            +E   D  ++  F+++W++       F  D   LL L+  +  I   RNS L+ ++I+ G
Sbjct: 689  SELNSDNELILSFKKRWYRIDVNNDTFGDDTVNLLTLRKVMMVISSNRNSLLLNNYIEYG 748

Query: 719  TIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGNEL 778
             ++   LP+ +WP GLNNIGNTCYLNSLLQYYF+++PLR Y++ + +     R     E 
Sbjct: 749  IVNPKFLPSKSWPVGLNNIGNTCYLNSLLQYYFAISPLREYLINFNDIELDGREMKNLEK 808

Query: 779  RRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNFEVEFEP 838
            RR+GG            QFVYQLRDL+  M++S  R V+PR +LAYLAFAPS+  +EF  
Sbjct: 809  RRVGGRNLSIAEFHRSIQFVYQLRDLYGEMVHSSSRKVSPRLQLAYLAFAPSDTPIEFRD 868

Query: 839  TTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSG-NEDIDVSMTKEPSEE 897
               NA  +    ++ TN                 G  E  S  G N +++     + S +
Sbjct: 869  GIQNAIGKNDYYSDKTN-----------------GGSESSSIKGLNSNLNSDSDADSSLD 911

Query: 898  YKEDIPMSDAEKDNIISTSTR-----VAKISSDQLENALEMGRQQDVTECIGNVLFQLES 952
               +  +   +   II TST      + KISS QLE  LEMG QQDVTECI NVLFQ+E+
Sbjct: 912  SDSESSLLTFDNLPIIKTSTTNLPTLIPKISSSQLETTLEMGSQQDVTECIENVLFQIEA 971

Query: 953  ASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIY 1012
            AS+PI++DEDNEQ DLVKQLF+GK +Q I P  + +++  K ER+LSLLV++ D P+DIY
Sbjct: 972  ASNPISIDEDNEQVDLVKQLFFGKTEQKIKPFNEVSKVHPKRERFLSLLVSVSDKPRDIY 1031

Query: 1013 DALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNE 1072
            DALD+YF DE   M EYG VK+++ ++ FPTILQ+QIQRVYYD E+ +PFK +EPL F+E
Sbjct: 1032 DALDTYFKDEVFDMEEYGKVKKSLTISSFPTILQVQIQRVYYDIEKGVPFKDLEPLRFSE 1091

Query: 1073 VLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYL 1132
             LY+DRY++  D K+ EKK E   LK +L  L   +KEL   N+                
Sbjct: 1092 SLYLDRYANDIDEKLAEKKIEVASLKKRLKGLITIKKELEKKND---------------- 1135

Query: 1133 KSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYS 1192
                                         + E+ ++  +I  +E  ID  F EF K GYS
Sbjct: 1136 -----------------------------NVEIRTISKEINDVETKIDTAFSEFHKHGYS 1166

Query: 1193 LFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLV 1252
            LFAVFIHRG+A++GHYW+YIKD   +GTWRKYND  +TE+   EVFNF+EGN++TPYFLV
Sbjct: 1167 LFAVFIHRGQATFGHYWIYIKDFKNHGTWRKYNDHEVTEILPIEVFNFSEGNSSTPYFLV 1226

Query: 1253 YVRQGHEHDIEPLKR 1267
            Y++ G E D+EPLKR
Sbjct: 1227 YIKNGSEFDVEPLKR 1241

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/791 (47%), Positives = 514/791 (64%), Gaps = 25/791 (3%)

Query: 55  LTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVL 114
           L   D G+ VLY  ++ + P KTSDRLLDD+   ++           S+    +L+AP+L
Sbjct: 17  LEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL----------SEEGREVLRAPML 66

Query: 115 AYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSST 174
            Y+R+ +    +S G L+DQ+ LQTSFEY S +C   N+++V+MGVL D P     +   
Sbjct: 67  EYARQRANARTWSVGYLLDQVVLQTSFEYTSRTC-AQNRVHVFMGVLCD-PGQRFASQDE 124

Query: 175 LSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTDPRLVDH 233
           L    +YHL+VTVK R  LE  ++  GV  YH + E  LH +D+ D   F+  DP +VD 
Sbjct: 125 LVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDE--LHPWDKPDFCLFEDGDPAVVDS 182

Query: 234 AIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADC 293
           A YV+S TN+LV IEV  PEF  +E  E ++G  I+ RY E C+R   LDPS+IP+QA+C
Sbjct: 183 ATYVASGTNRLVRIEVLRPEFGPDELQE-FTGERIRARYLEVCKRHPDLDPSDIPSQAEC 241

Query: 294 INTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFEL-HVEKDESTGES 352
           +NTL K+F+ PL+RQ +++ LKTI++DN VLNS++  NWL +K+GFEL  +E+D   G+ 
Sbjct: 242 LNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIEED---GQK 298

Query: 353 YFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVYRTFNAI 412
            +E++PP+ T ++E+ +VRR RES+IRK +ELIFLGK ++ L+ KD   ++   R+F   
Sbjct: 299 IYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKLRSFQLY 358

Query: 413 QIAFSKTTWFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALDP 472
           Q  FS + W+ ++GE+      +   P D NY+F++LS+ +YY DRDIIKNYEAQ ALDP
Sbjct: 359 QTHFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDP 418

Query: 473 ENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDSL 532
            N  IY+D L+++AN KG+ QL+ Y  KQ+VVG EAL  AL+LF +D    D   + D  
Sbjct: 419 ANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEF 478

Query: 533 LVSIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYXXXXXXX 592
           L+  YK E   +    +H DL+NALRLLA+YK+SDKLKF+ + EP+ N  +AY       
Sbjct: 479 LLESYK-EVCKDSGPQKHADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKLLEIDE 537

Query: 593 XXXXXXXXTAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGT 652
                   TAYSI ++D+PGLK+DC RALYT+ V KRS+ L N L QQCP F  +Y    
Sbjct: 538 SVDIDIIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSY 597

Query: 653 LLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLIL 712
           L Y  AL  L +N NA D+ +LE+FQRKW  +     + LL LK ALTKIG ERNSKLI 
Sbjct: 598 LSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLIN 657

Query: 713 HFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRH 772
           HF++TG +D + LPA NWPTG+NNIGNTCYLNSLLQYYF+++PLR Y+L Y  T  +  +
Sbjct: 658 HFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTASNLLN 717

Query: 773 HTGNE----LRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFA 828
           +  +      RRIGG            QFVYQLR LF  M++S+ER VTP +EL YL+F+
Sbjct: 718 NAVSSSDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFS 777

Query: 829 PSNFEVEFEPT 839
           PS+ EVEFEP 
Sbjct: 778 PSSTEVEFEPV 788

 Score =  405 bits (1042), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 227/449 (50%), Positives = 299/449 (66%), Gaps = 20/449 (4%)

Query: 826  AFAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNED 885
            A +P +F V ++ ++  A    ++   S+  +  +      ++    GP+E      N+D
Sbjct: 955  AASPDDFSVRYQASSDTANTGSTRPNPSSTPESGLSDSAANAEYTSAGPLEDRQAVENDD 1014

Query: 886  I--DVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTECI 943
               D++M   P  E  E              TST VAKISSDQLEN LE+GRQQDVTECI
Sbjct: 1015 SGKDITMVGSPEAEGPE--------------TSTYVAKISSDQLENTLEIGRQQDVTECI 1060

Query: 944  GNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVN 1003
            GNVL+Q+ESAS P++LDE+ EQ DLVKQLFYGK+KQ +IPL      +TKIER++SLLVN
Sbjct: 1061 GNVLYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVN 1120

Query: 1004 IGDHPKDIYDALDSYF-SDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPF 1062
            IGDHPKDIYDALDSYF  D      + G V+R+VAV E P +LQIQIQRVYYDRE+FMPF
Sbjct: 1121 IGDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPF 1180

Query: 1063 KSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRK 1122
            KS EPLPF E LYMDRY  + + ++  KK+++  L+ +L RL+ R++ LL+ N+ G++  
Sbjct: 1181 KSTEPLPFGEKLYMDRYLATDNAELNAKKQQAIGLREELERLRERRRRLLAKNDHGVTLS 1240

Query: 1123 AAYMETINYLKSDLIKSQELKGLNNDF--LIEQLKQSIADIDQELTSLYHDIAKLENTID 1180
            AA  +T  +L +  + S   + L   +      L      +D+EL +L   IA +++ I 
Sbjct: 1241 AALADTRRFLDAAELTSGS-RQLQEQYHATTSHLDALRVALDEELAALDAHIASVQDAIA 1299

Query: 1181 KQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNF 1240
             +F+ F   GYSL AVFIHRGEASYGHYWVYIKD    G WRKYNDE++TEVPE+EVF+F
Sbjct: 1300 HRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDF 1359

Query: 1241 TEGNTATPYFLVYVRQGHEHDIEPLKRII 1269
            +E NTATPYFLVYV++ HE DIEPLKR++
Sbjct: 1360 SEENTATPYFLVYVKEAHELDIEPLKRLL 1388

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/1254 (32%), Positives = 650/1254 (51%), Gaps = 134/1254 (10%)

Query: 56   THRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFIN---SKDHDILYSDLHNGILKAP 112
            T  D G  +LY+ +  +  FKTS R+LDD++ D+AF++    K  DI   D  +G+L  P
Sbjct: 66   TSIDDGMHLLYQNIEKEGVFKTSQRILDDILTDIAFMSLDSEKSDDI---DFKDGVLNLP 122

Query: 113  VLAYSRRISQLYPYS---FGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLI-DVPHDY 168
             + YS     + P+    F T  +   +    ++ S++ P +N +    G+L+  +P   
Sbjct: 123  TIKYSLWRKYIKPFKIILFNT--NNPVVDVKLQHKSVTSPKNNTITELYGLLVPKIPRRS 180

Query: 169  KITS--STLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEAD-LHQFDRQDL-EFD 224
            ++ +    +    +Y +++TVKTR  LEH KK   +T Y  + + D LH+ D+ D  +F+
Sbjct: 181  ELNTFDEYIRSKPLYSIRITVKTRHRLEHKKKHIALTPYFLLDDFDKLHEVDKSDFPKFN 240

Query: 225  PTDPRLVDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDP 284
                 L+D +IY+SSDTNK++LIE+F P F++ E     S  ++  R +E     + L P
Sbjct: 241  KDSKDLLDFSIYISSDTNKIILIEIFKPAFNQTELDYLLSSASVLNRSNELDNLHEELQP 300

Query: 285  ----SEIPTQADCINTLLKI----FRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSK 336
                + +  Q D I  LL       +G   R+  ++    + SD+V L + ++  WL   
Sbjct: 301  DYNDAIVEEQIDTIEILLHCIMQNLKGSPERELEKQKTSFLLSDDVKLGTYVDIKWLEEN 360

Query: 337  YGFELHVEK---------DESTGESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFL 387
            +  ++  +K         DE+   S   F+ PN  N  +  K+ R         +EL++L
Sbjct: 361  FDIKVKEQKRKDHVSITLDEALKLS---FDDPNPKNQAKFDKITRY-------AMELMYL 410

Query: 388  GKTAIELLGKDAKTTSKVYRT-FNAIQIAFSKTTWFKMLGEHRSIFSFESASPLDANYNF 446
            GK        + +    +  T F  +++  + + W ++L E++SIFS +  S    + +F
Sbjct: 411  GKVLQSFYSNEEEIEEYMEDTIFKQVKVHHTTSFWTQILNEYQSIFSSQKTSTRCVDEHF 470

Query: 447  INLSACFYYIDRDIIKNYEAQCALDPENTGIYFDALTYIANRKGAYQLV-AYCGKQDVVG 505
            INL       ++DII NYE Q   DP+N   YF++L Y++ +   Y ++  YC +  ++ 
Sbjct: 471  INLCIDSNVSEKDIITNYEIQLRTDPDNDSKYFESLKYVSRKFPDYIVLEKYCKENVIIS 530

Query: 506  QEALDQALKLFGIDSKDVDVATIDDSLLVSIYKSETMANPNENRH--TDLKNALRLLAKY 563
            + A   AL++F   S++   A    S +   Y     +N N +     DL ++   LA  
Sbjct: 531  KAAYLHALEIFKY-SEEYFNAIEHVSEIWDKYTELVQSNNNNDDQYRVDLVDSFYSLATV 589

Query: 564  KKSDKLKFFADYEPYKNVSRAYXXXXXXXXXXXXXXXTAYSISINDSPGLKIDCDRALYT 623
            KKS  L +   YEP+ +   AY                AY++ I + P  KI  DRAL+ 
Sbjct: 590  KKSSPLIYITKYEPFFHPVTAYLKLNVDAKLDSENIVLAYTMQIREVPEHKIQFDRALFA 649

Query: 624  IGVRKRSLRLLNYLLQQCPDFQLYYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQ 683
            I +++  L LL  L Q C  F        L   +A  ++ + + + + +++  F + W +
Sbjct: 650  IAIQRHDLSLLYVLKQNCSAFNECISNIILTSDDAFEIIGMPKTSSELSIINTFTKYWKE 709

Query: 684  ETAFESDYLLKLKAALTKIGIERNSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYL 743
                     +   AAL ++   R S L+ HF + G ++   + ++ WPTG+NNIGNTCYL
Sbjct: 710  TDDSNPVNFILASAALREVSKHRASALLRHFYEFGKVNPKMIDSELWPTGINNIGNTCYL 769

Query: 744  NSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGNEL--RRIGGXXXXXXXXXXXXQFVYQL 801
            NSLLQYYFS+   R ++  YQ ++E    ++  E+  RR+GG            QF+YQ+
Sbjct: 770  NSLLQYYFSITLFREFIENYQ-SIESDLLNSNAEMSKRRVGGREIQNNEINRSVQFIYQV 828

Query: 802  RDLFQAMIYSKERCVTPRKELAYLAFAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMY 861
            +DLF+ M+++K R VTP  +LAYLAFAP+N E++F+  +     E  ++  +T++ I + 
Sbjct: 829  QDLFKLMVHTKSRKVTPSNQLAYLAFAPNNAEIKFKHKSELESSEEHQL--TTSHSIALS 886

Query: 862  GPTNRSDNDQTGPIELDSDSGNEDIDVSMTKEPSEEYKEDIPMSDAEKDNIISTSTR-VA 920
              T+ S           SD   +D D+S+                    N  S S R VA
Sbjct: 887  SATSISH----------SDIDTQDHDISL--------------------NSTSYSNRLVA 916

Query: 921  KISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQT 980
             ++ D LE  LE+G QQDVTECI  VL+Q+E+ S P+ LD DNEQ DLVK+LFYG+  Q 
Sbjct: 917  MVTRDDLETTLEIGNQQDVTECINTVLYQVETGSMPLYLDADNEQMDLVKELFYGETIQE 976

Query: 981  IIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTE 1040
            I P+ K  +   K E Y SLLVNI D P D+Y+ LD YF+DE ++M EYG+VK+T+++T+
Sbjct: 977  ICPIKKFIKGHEKRELYSSLLVNILDSPTDLYEVLDEYFADEYMSMEEYGEVKKTLSITK 1036

Query: 1041 FPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKES---EQL 1097
             PTIL IQIQRVYYD+E+ +P+K    LPF   +++DRY       +   KKE+   E+ 
Sbjct: 1037 LPTILNIQIQRVYYDKEKLVPYKCGTALPFKNEIFLDRY-------IKGNKKENDVLEKA 1089

Query: 1098 KAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQS 1157
            + +L   K++ +EL+S                           E   +N         +S
Sbjct: 1090 RLELKLAKVKYRELVS---------------------------EYNSVN---------KS 1113

Query: 1158 IADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSK 1217
            I+D    + + Y  I +L   I+++  +  KI YSLFAVFIHRG+AS+GHYWVYI+D  +
Sbjct: 1114 ISD---RIITTYDRIEELNAVIEEEVTKDAKIRYSLFAVFIHRGQASFGHYWVYIRD-FE 1169

Query: 1218 NGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEHDIEPLKRIIDR 1271
            NG WRKYND  +T   E E+F   +G+ +TPYFL YV    +  ++PL R + R
Sbjct: 1170 NGIWRKYNDHQVTGAHEDEIFKCVDGDISTPYFLAYVDSSKKSIVKPLVRDVTR 1223

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 42/105 (40%), Gaps = 23/105 (21%)

Query: 714 FIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHH 773
           F++  T     +  D  P GL N+GNTCY N+ LQ  + + PLR  VL Y E        
Sbjct: 88  FLEDLTDKERLMQEDTIPMGLRNMGNTCYFNASLQALYRIKPLREKVLAYNEPNPDLHG- 146

Query: 774 TGNELRRIGGXXXXXXXXXXXXQFVYQLRDLFQAMIYSKERCVTP 818
                                 Q V QLR+ F A    KE+  TP
Sbjct: 147 ----------------------QLVIQLRNCFNAFAQRKEKEFTP 169

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTA-TP 1248
            Y+L  V  H+G  S  GHY  +++D +    W KYND+ +  V   +V     G  + + 
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYNDDKVYVVTREKVEQLAGGGESDSA 474

Query: 1249 YFLVY 1253
              L+Y
Sbjct: 475  LILIY 479

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 43/98 (43%), Gaps = 25/98 (25%)

Query: 731 PTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQ---ETMEHFRHHTGNELRRIGGXXXX 787
           P GL N+GNTCY+NS LQ  + + PLR  VL Y+   E     +HH              
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPREKPSEEQHH-------------- 104

Query: 788 XXXXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYL 825
                   Q V +LR  FQ +    +  VTP   LA L
Sbjct: 105 --------QLVSELRRCFQQLKDKPQESVTPMLLLAML 134

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPY 1249
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ ++ + + ++ +   G  +   
Sbjct: 380  YNLIGVITHQGANSESGHYQSFIRDEVDENKWYRFNDDKVSIIEKEKIESLAGGGESDSA 439

Query: 1250 FLVYVR 1255
             ++  R
Sbjct: 440  LILIYR 445

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 26/36 (72%)

Query: 731 PTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQET 766
           P GL N+GNTCYLN+ LQ  F + PLR  +L Y+++
Sbjct: 108 PIGLKNLGNTCYLNATLQCLFRIEPLREMILNYKQS 143

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTA-TP 1248
            Y+L  +  H+G  S  GHY  +I+DR     W K+ND+ +T V + ++     G  + + 
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVTIVDKEKIETLAGGGESDSA 493

Query: 1249 YFLVY 1253
              L+Y
Sbjct: 494  LILLY 498

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query: 713 HFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY-------QE 765
           HFI+  T D      D+ P GL N+GNTCY+N+ LQ  F +  +R  +L Y       Q+
Sbjct: 88  HFIEDLTPDQQMQKFDSNPIGLQNMGNTCYMNATLQALFRVDSIRDLILNYDPAKASPQD 147

Query: 766 TMEH 769
            M H
Sbjct: 148 EMHH 151

 Score = 39.3 bits (90), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPY 1249
            Y+L  +  H+G  S  GHY  +I+D +    W K+ND+ ++ V E E      G   +  
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVS-VVEKEKIEALAGGGESDS 482

Query: 1250 FLVYVRQG 1257
             L+ + +G
Sbjct: 483  ALILMYKG 490

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%)

Query: 731 PTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
           P G+ N+GNTCY+N+ LQ  F + PLR  VLE+ E
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVLEFDE 135

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTA-TP 1248
            Y L  V  H+G  S  GHY  +I+D + +  W +++D+ +T + + ++ +   G  + + 
Sbjct: 415  YDLIGVITHQGANSESGHYQAFIRDDA-DEKWYRFDDDKVTAIEKEKIESLAGGGESDSA 473

Query: 1249 YFLVY 1253
              L+Y
Sbjct: 474  LILIY 478

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 26/39 (66%)

Query: 731 PTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEH 769
           P GL N+GNTCY+NS LQ  + + PLR  +L +Q   E+
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNFQPPKEN 143

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTA-TP 1248
            Y+L  V  H+G  S  GHY  +I+D +    W ++ND+ ++ + + ++ +   G  + + 
Sbjct: 426  YNLIGVITHQGANSESGHYQSFIRDEADENKWYRFNDDKVSVIEKEKIESLAGGGESDSA 485

Query: 1249 YFLVY 1253
              L+Y
Sbjct: 486  LILIY 490

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%)

Query: 727 ADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
           A++ P G  N+GNTCYLN+ LQ  + + PLR  +L+Y +
Sbjct: 104 ANDLPIGFQNMGNTCYLNATLQALYRIEPLRDMILDYNQ 142

 Score = 39.3 bits (90), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTA-TP 1248
            Y L  V  H+G  S  GHY  +I+D      W  +ND+ ++ VP+ ++     G  + + 
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDEDKWYNFNDDKVSVVPKEKIEGLAGGGESDSA 484

Query: 1249 YFLVY 1253
              L+Y
Sbjct: 485  LILIY 489

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 65/139 (46%), Gaps = 21/139 (15%)

Query: 656 SEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLIL--- 712
           S+  + L+L   A + T + + ++K+  +    +D +  L +      I+ NS +++   
Sbjct: 24  SKTTTALELKTQAEELTQVPISRQKYMVKGGLSNDSMTDLDSV-----IKPNSTIMMLGT 78

Query: 713 -------------HFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRY 759
                        HFI+  + D      D+ P G  N+GNTCY+N+ LQ  +    +R+ 
Sbjct: 79  PDANLITKPKSQNHFIEDLSPDQQLQKMDSTPIGFQNMGNTCYMNATLQALYRTDDIRQM 138

Query: 760 VLEYQETMEHFRHHTGNEL 778
           +L+Y+   +   ++  +E+
Sbjct: 139 ILDYKPPAQSSTYNPEDEM 157

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPY 1249
            Y+L  +  H+G  S  GHY  +++D +    W K+ND+ +T V E E      G   +  
Sbjct: 433  YNLIGIITHQGANSESGHYQAFMRDENDENKWYKFNDDKVT-VVEKEKIEALAGGGESDS 491

Query: 1250 FLVYVRQG 1257
             L+ + +G
Sbjct: 492  ALILMYKG 499

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 29/47 (61%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGNELR 779
           G  N GNTCY NS+LQ  ++L+PLR  +L++ E      H   NE+R
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSPLRENILQFPEKPIESGHPRKNEMR 187

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTAT 1247
            Y L  + +H G    +GHY V +    K G W  ++DET+  V E  V  FT    N AT
Sbjct: 602  YELAGIVVHMGGGPQHGHY-VSLCKHQKFG-WLLFDDETVEAVKEETVLEFTGESANMAT 659

Query: 1248 PYFLVY 1253
             Y L Y
Sbjct: 660  AYVLFY 665

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 5/67 (7%)

Query: 697 AALTKIGIERNSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPL 756
           A L     E+N      FI+    +     + + P G  N+GNTCYLNS LQ  + + PL
Sbjct: 78  AGLVSKPAEKN-----QFIEDLAPEEQLQRSSDLPIGFQNMGNTCYLNSTLQALYRIKPL 132

Query: 757 RRYVLEY 763
           R  +L Y
Sbjct: 133 RELILSY 139

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTA-TP 1248
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V + ++ + + G  + + 
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVSVVDKEKIESLSGGGESDSA 490

Query: 1249 YFLVY 1253
              L+Y
Sbjct: 491  LILIY 495

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%)

Query: 713 HFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           HFI+  + D      +  P G  N+GNTCYLN+ LQ  F +  LR  +L Y
Sbjct: 89  HFIEDLSPDQQVSRFNELPIGFKNMGNTCYLNATLQSLFRMDQLRELILNY 139

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPY 1249
            Y+L  V  H+G  S  GHY  +I+D +    W K+ND+ ++ V E E      G   +  
Sbjct: 430  YNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKVSIV-EKERVEALAGGGESDS 488

Query: 1250 FLVYVRQG 1257
             L+ + QG
Sbjct: 489  ALILMYQG 496

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%)

Query: 731 PTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHF 770
           P GL N+GNTCY+N+ LQ  + + PLR  +L + +   +F
Sbjct: 103 PIGLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNF 142

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTA-TP 1248
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ ++ + + ++ +   G  + + 
Sbjct: 423  YDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFNDDKVSVIEKEKIESLAGGGESDSA 482

Query: 1249 YFLVY 1253
              LVY
Sbjct: 483  LILVY 487

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 714 FIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           FI+    DA        P G+ N+GNTCY+N+ LQ  + + PLR  +L +
Sbjct: 42  FIEDLGADAQSGQLSRVPMGIVNMGNTCYMNATLQGLYGIVPLREQILAF 91

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTA-TP 1248
            Y L  V  H+G  S  GHY  +++D   +  W K+ND+ +T + + ++ +   G  + + 
Sbjct: 377  YDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFNDDKVTAIEKEKIESLAGGGESDSA 436

Query: 1249 YFLVY 1253
              L+Y
Sbjct: 437  LILIY 441

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 31/111 (27%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF------------ 1238
            Y L  V +H G+ S GHY+  IK  +++  W +++DE + +V +T+VF            
Sbjct: 431  YKLHGVLVHAGDISTGHYYAMIKPSTED-QWYRFDDEKVWKVTKTQVFDENFGLDRIPDD 489

Query: 1239 -----------NFTEGNTATPYFLVYVRQGHEHD-IEPL------KRIIDR 1271
                       N+      + Y LVY+R+  E D ++P+      K +I+R
Sbjct: 490  EVRLMSREQYQNYLLARHTSAYMLVYIREDQEADLLQPVTENDVPKHVIER 540

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLE 762
            G  N G TCYLNSLLQ YF     RR V +
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYQ 223

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 10/97 (10%)

Query: 967  DLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERL-- 1024
            D + ++F G++K  I  +    E  +++E +  L +N+ +  KD+  + ++Y   E +  
Sbjct: 297  DKLNEIFVGRMKSYIKCINVDYE-SSRVEEFWDLQMNVKN-LKDLKSSFENYIEIELMNG 354

Query: 1025 ----TMAEYG--DVKRTVAVTEFPTILQIQIQRVYYD 1055
                   +YG  D ++ V    FP +L +Q++R  YD
Sbjct: 355  ENQYAAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 391

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPY 1249
            Y L +V +H G + S GHY  +   R  +GTW  Y+DE I ++ E ++   TE N    Y
Sbjct: 761  YQLLSVVVHEGRSLSSGHYIAHC--RQPDGTWATYDDELINKISELKL--LTEPNA---Y 813

Query: 1250 FLVYVR 1255
            +LVY R
Sbjct: 814  YLVYTR 819

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 56/121 (46%), Gaps = 26/121 (21%)

Query: 1175 LENTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPE 1234
            L+ T+D + ++     Y+L  V +H G+ S GHY+  IK   ++  W +++DE +  V +
Sbjct: 433  LKKTLDSENKDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGVED-QWYRFDDERVWRVTK 491

Query: 1235 TEVF-----------------------NFTEGNTATPYFLVYVRQGHEHDIEPLKRIIDR 1271
             +VF                       N+      + Y LVY+RQ  E D+  L+ +++ 
Sbjct: 492  KQVFQENFGCDRLPDEKVRTMTRGEYQNYIIQRHTSAYMLVYIRQEQEEDL--LRPVLES 549

Query: 1272 D 1272
            D
Sbjct: 550  D 550

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLE 762
            G  N G TCYLNSLLQ YF     R+ V E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 48/95 (50%), Gaps = 10/95 (10%)

Query: 969  VKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERL---- 1024
            + ++F GK+K  I  +    E   ++E +  L +N+ +  K++ ++ D+Y   E +    
Sbjct: 311  LNEIFVGKMKSYIKCINVDYE-SARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1025 --TMAEYG--DVKRTVAVTEFPTILQIQIQRVYYD 1055
                 +YG  D ++ V    FP +L +Q++R  YD
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYD 403

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 26/105 (24%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF------------ 1238
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE +  V + +VF            
Sbjct: 448  YNLHGVLVHSGDISTGHYYTLIKPGVED-QWYRFDDERVWRVTKKQVFQENFGCDRLPDE 506

Query: 1239 -----------NFTEGNTATPYFLVYVRQGHEHDIEPLKRIIDRD 1272
                       N+      + Y LVY+RQ  E D+  L+ +++ D
Sbjct: 507  KVRTMTRDDYQNYIIQRHTSAYMLVYIRQDQEQDL--LRPVVESD 549

 Score = 36.6 bits (83), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLE 762
            G  N G TCYLNSLLQ YF     R+ V E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 49/95 (51%), Gaps = 10/95 (10%)

Query: 969  VKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERL---- 1024
            + ++F G++K  I  +    E  +++E +  L +N+ +  K++ ++ D+Y   E +    
Sbjct: 311  LNEIFVGRMKSYIKCINVDYE-SSRVEDFWDLQMNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1025 --TMAEYG--DVKRTVAVTEFPTILQIQIQRVYYD 1055
                 +YG  D ++ V    FP +L +Q++R  YD
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYD 403

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
            (REAL)
          Length = 763

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  + K    +G+W  Y+DE I ++ E +V   T      
Sbjct: 642  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKISERDVLKETNA---- 695

Query: 1248 PYFLVYVR 1255
             Y+L+Y R
Sbjct: 696  -YYLLYTR 702

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  + K    +G+W  Y+DE I ++ E +V    E N   
Sbjct: 643  VKYQLISVVVHEGRSLSSGHYIAHCK--QPDGSWSTYDDEYINKITERDVLR--ESNA-- 696

Query: 1248 PYFLVYVR 1255
             Y+LVY R
Sbjct: 697  -YYLVYTR 703

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  +   R  +G+W  Y+DE I ++ E  V        A 
Sbjct: 689  VKYELLSVVVHEGRSLSSGHYIAHC--RQPDGSWATYDDEYINKISELNVL-----KEAN 741

Query: 1248 PYFLVYVR 1255
             Y+L+Y R
Sbjct: 742  AYYLLYTR 749

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  + K    +G+W  Y+DE I ++ E ++    E N   
Sbjct: 637  VRYQLISVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKISEKQLLK--EPNA-- 690

Query: 1248 PYFLVYVR 1255
             YFLVY R
Sbjct: 691  -YFLVYTR 697

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 5/68 (7%)

Query: 1173 AKLENTIDKQFEE--FKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETIT 1230
              +  TI K+F+      + YSL +V +H G  +YGHY  + K R   G W + +DET+ 
Sbjct: 702  GAIPQTIRKKFDSTPIGPLTYSLRSVIVHYGTHNYGHYIAFRKYR---GVWWRISDETVY 758

Query: 1231 EVPETEVF 1238
             V E EV 
Sbjct: 759  IVDEAEVL 766

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 713 HFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           HFI+  T +      ++ P G  N+GNTCYLN+ LQ  + +  LR  VL +
Sbjct: 88  HFIEDLTPEQQVQQFNDIPIGFKNMGNTCYLNATLQALYRIDDLRDAVLNF 138

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEG 1243
            Y L  +  H+G  S  GHY  +I+D +    W K+ND+ ++ + + ++ +   G
Sbjct: 430  YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDKVSIIEKEKIESLAGG 483

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%)

Query: 731 PTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
           P GL N+GNTCY+NS LQ  + +  LR  VL+Y+E
Sbjct: 108 PIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKE 142

 Score = 38.9 bits (89), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPY 1249
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V E E      G   +  
Sbjct: 427  YDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFNDDKVS-VVEREKIEALAGGGESDS 485

Query: 1250 FLVYVRQG 1257
             L+ + +G
Sbjct: 486  ALILIYKG 493

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  + K    +GTW  Y+DE I ++ E  V          
Sbjct: 636  VKYQLISVVVHEGRSLSSGHYIAHCKQ--PDGTWATYDDEYINKITERNVL-----KEVN 688

Query: 1248 PYFLVYVR 1255
             Y+LVY R
Sbjct: 689  AYYLVYTR 696

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
            (REAL)
          Length = 788

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  + K    +GTW  Y+DE I ++ E +V    E N   
Sbjct: 667  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGTWATYDDEYINKISERDVLK--EPNA-- 720

Query: 1248 PYFLVYVR 1255
             Y+L+Y R
Sbjct: 721  -YYLLYTR 727

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
            {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186w UBP10
          Length = 771

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 41/76 (53%), Gaps = 11/76 (14%)

Query: 1184 EEFKK---IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239
            EE KK   + Y L +V +H G + S GHY  + K    +G+W  Y+DE I ++ E EV  
Sbjct: 652  EESKKMLPVKYELLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKITEREVLK 709

Query: 1240 FTEGNTATPYFLVYVR 1255
              E N    Y+++Y R
Sbjct: 710  --ERNA---YYVLYTR 720

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 26/105 (24%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF------------ 1238
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE +  V + +VF            
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVED-QWYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1239 -----------NFTEGNTATPYFLVYVRQGHEHDIEPLKRIIDRD 1272
                       N+      + Y LVY+RQ  E D+  L+ +++ D
Sbjct: 508  KVRTMTRDDYQNYIIQRHTSAYMLVYIRQEQEQDL--LRPVLESD 550

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLE 762
            G  N G TCYLNSLLQ YF     R+ V E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
            YNL186W
          Length = 661

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L  V +H G + S GHY V+ K    +GTW  Y+DE I ++ E +V    E N   
Sbjct: 547  VKYQLTTVVVHEGRSLSSGHYIVHCK--QPDGTWATYDDEYINKITERDVLK--EPNA-- 600

Query: 1248 PYFLVYVR 1255
             Y+L+Y R
Sbjct: 601  -YYLLYTR 607

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  + K    +G W  Y+DE I ++ + EV   T      
Sbjct: 671  VKYQLISVVVHEGRSLSSGHYVAHCK--QPDGLWATYDDEYINKISDKEVLRETNA---- 724

Query: 1248 PYFLVYVR 1255
             Y+LVY R
Sbjct: 725  -YYLVYSR 731

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 26/105 (24%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF------------ 1238
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE +  V + +VF            
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVED-QWYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1239 -----------NFTEGNTATPYFLVYVRQGHEHDIEPLKRIIDRD 1272
                       N+      + Y LVY+RQ  E D+  L+ +++ D
Sbjct: 508  KVRTMTREDYQNYIIQRHTSAYMLVYIRQEQEEDL--LRPVLESD 550

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLE 762
            G  N G TCYLNSLLQ YF     R+ V E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 48/95 (50%), Gaps = 10/95 (10%)

Query: 969  VKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERL---- 1024
            + ++F GK+K  I  +    E   ++E +  L +N+ +  K++ ++ D+Y   E +    
Sbjct: 311  LSEIFVGKMKSYIKCVNVDYE-SARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1025 --TMAEYG--DVKRTVAVTEFPTILQIQIQRVYYD 1055
                 +YG  D ++ V    FP +L +Q++R  YD
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYD 403

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
            (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239
            + YSL +V +H G  +YGHY  + K R   G W + +DE++T V E EV +
Sbjct: 685  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDESVTIVDEAEVLS 732

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248
            + Y L +V +H G  +YGHY  + K R   GTW + +DET+  V E EV      +T + 
Sbjct: 670  LTYELRSVIVHYGTHNYGHYIAFRKYR---GTWWRISDETVHMVDEAEVL-----STPSV 721

Query: 1249 YFLVY 1253
            + L Y
Sbjct: 722  FMLFY 726

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  + K    +G+W  Y+DE I ++ E E+    E N   
Sbjct: 753  VKYQLLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKISEREMLK--EPNA-- 806

Query: 1248 PYFLVYVR 1255
             Y+L+Y R
Sbjct: 807  -YYLLYTR 813

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 9/69 (13%)

Query: 1188 KIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            K  YSL ++ +H G   YGHY  Y   R     W + +DE++ +V E EVF      +A+
Sbjct: 425  KCVYSLKSIVVHYGSHDYGHYISY---RRFEDQWWRISDESVLKVDEDEVF------SAS 475

Query: 1248 PYFLVYVRQ 1256
              F+V+  Q
Sbjct: 476  GIFIVFYEQ 484

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 713 HFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
            F++  + D      ++ P GL N+GNTCYLN+ LQ  F    L+  +L+Y
Sbjct: 90  RFVEDLSPDQQVQQFNSTPLGLQNMGNTCYLNATLQALFRADELKDLILQY 140

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPY 1249
            Y L  V  H+G  S  GHY  +I+D S    W K+ND+ ++ + E E      G   +  
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVSPI-EKEKIEALAGGGESDS 484

Query: 1250 FLVYVRQG 1257
             L+ + +G
Sbjct: 485  ALILLYKG 492

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 714 FIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQ 764
           FI+    D      ++ P G  N+GNTCY+NS LQ  F +  L+  +L Y+
Sbjct: 91  FIEDLAPDQQMQKLNDLPIGFQNMGNTCYMNSTLQALFRVDVLKDMILNYK 141

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTA-TP 1248
            Y L  +  H+G  S  GHY  +I+D +    W K+ND+ ++E  + ++     G  + + 
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVSEYEKDKIEQLAGGGESDSA 495

Query: 1249 YFLVYVRQG 1257
              L+Y   G
Sbjct: 496  LILIYKGMG 504

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 699 LTKIGIERNSKLILHFIDTGTIDASCLPADN-WPTGLNNIGNTCYLNSLLQYYFSLA 754
           L ++ +E+N       +D+   +   LPA   +  GLNN+GN+CY+NS+LQ  F+ A
Sbjct: 279 LVELQVEQNMNWDFQMVDSKGNELKHLPASKEYGCGLNNLGNSCYMNSVLQVLFNGA 335

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            YSL +V +H G  +YGHY  + K R   G W + +DET+  V ETEV 
Sbjct: 577  YSLRSVIVHYGTHNYGHYIAFRKYR---GYWWRISDETVYIVDETEVL 621

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 37/86 (43%), Gaps = 3/86 (3%)

Query: 691 YLLKLKAALTKIGIERNSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYY 750
           ++LKL    TK     N+       +    D   +    +  GL N GNTC++NS+LQ  
Sbjct: 17  FILKLSYPFTKRMYNNNNFFSRKMYNNAINDKKFIKRGGYIAGLVNDGNTCFMNSVLQ-- 74

Query: 751 FSLAPLRRYVLEYQETMEHFRHHTGN 776
            SLA  +         +E+   + G+
Sbjct: 75  -SLASSKELAAFLDNVIENGSENNGD 99

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
            Anc_2.307 YDL122W
          Length = 482

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 1183 FEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
             E+  KI Y L AV IH G  +YGHY  Y   R     W + +DE++ EV E EV 
Sbjct: 414  LEDPDKIIYDLKAVIIHYGTHNYGHYISY---RKFMNQWWRISDESVIEVDEMEVL 466

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRY---VLEYQETMEHFRH 772
           GL N GN+C++NS+LQ   SL  L ++   +LE   T E  +H
Sbjct: 28  GLINNGNSCFMNSVLQALASLPSLLKFLELILETPATQEEPKH 70

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
            (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  +   R  +G+W  Y+DE I ++ E  V    E N   
Sbjct: 605  VKYQLISVVVHEGRSLSSGHYIAHC--RQPDGSWAIYDDEYINKISERNVLK--EPNA-- 658

Query: 1248 PYFLVYVR 1255
             Y+L+Y R
Sbjct: 659  -YYLIYTR 665

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
            YDL122W
          Length = 764

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E EV +
Sbjct: 622  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVGIVTEAEVLS 669

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 712 LHFIDTGTIDASCLPADNWPT---GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           L F    T ++  LP  +  T   GL N GNTCY NS+LQ  F+L+ LR  +L Y
Sbjct: 110 LFFPGLVTRESEHLPCGDGSTKVFGLENFGNTCYCNSVLQCLFNLSELRTNILMY 164

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 5/66 (7%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTAT 1247
            Y L  + IH G    +GHY V I      G W  Y+DET+  + E  VF F   E +  T
Sbjct: 637  YELNGIVIHMGGGPQHGHY-VAICKHDMFG-WLLYDDETVESIDEETVFKFVGDEKDMTT 694

Query: 1248 PYFLVY 1253
             Y L +
Sbjct: 695  AYVLFF 700

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 1178 TIDKQFEEFKKIGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETE 1236
            T+   F+      Y L +  IH G+   YGHY    K  ++   W  ++DET+  V E  
Sbjct: 546  TVSSTFDSKLSKRYELASAVIHLGDGPQYGHYISLCK--TETFGWLLFDDETVEAVDEQT 603

Query: 1237 VFNFTEGNTATPYFLVY 1253
            V +FT  N+ T Y L Y
Sbjct: 604  VLSFTGENSDTAYVLFY 620

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 13/60 (21%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVL---------EYQETMEHFRHHTGNELRRIGG 783
           G  N GNTCY NS+LQ +F+ +  R  +L         E   T+E F    G   R I G
Sbjct: 128 GYENFGNTCYCNSILQCFFNHSVFRTSMLSFPSSNSDGERARTLETF----GRSKRNING 183

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 3/73 (4%)

Query: 699 LTKIGIERNSKLILHFIDTGTIDASCLP-ADNWPT--GLNNIGNTCYLNSLLQYYFSLAP 755
           L + G  R+    L F      D   LP  D  P   GL N GNTCY NS+LQ  ++L  
Sbjct: 63  LQQTGEGRDGVQELLFARPAGKDRRLLPFGDGTPKVFGLENYGNTCYCNSVLQCLYNLKE 122

Query: 756 LRRYVLEYQETME 768
           LR  VL+Y    E
Sbjct: 123 LRVNVLKYPTRAE 135

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 4/76 (5%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNF-TEGNTATP 1248
            Y L  + IH G    +GHY    K       W  Y+DET+  V E  V  F  + N  T 
Sbjct: 592  YELNGIVIHMGGGPQHGHYVAICKHELFG--WLLYDDETVESVGEDAVLRFIGDVNDMTT 649

Query: 1249 YFLVYVRQGHEHDIEP 1264
             ++++ +   E D  P
Sbjct: 650  AYVLFYKSKREDDDTP 665

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
            (REAL)
          Length = 776

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  + K    +G W  Y+DE I ++ E +V    E N   
Sbjct: 655  VKYQLLSVVVHEGRSLSSGHYIAHCK--QPDGNWATYDDEYINKISERDVLK--EPNA-- 708

Query: 1248 PYFLVYVR 1255
             Y+L+Y R
Sbjct: 709  -YYLLYTR 715

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  + K    +G+W  Y+DE I ++ E ++          
Sbjct: 393  VKYQLISVVVHEGRSLSSGHYIAHCKQ--PDGSWSTYDDEYINKISEKQML-----KEPG 445

Query: 1248 PYFLVYVR 1255
             Y+LVY R
Sbjct: 446  AYYLVYTR 453

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 731 PTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETME 768
           P G  N+GNTCYLN+ LQ  + +  LR  +L Y  + E
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQE 145

 Score = 38.9 bits (89), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTA-TP 1248
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V + ++ +   G  + + 
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1249 YFLVY 1253
              L+Y
Sbjct: 490  LILMY 494

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E EV 
Sbjct: 680  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEVL 726

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 720 IDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRY----VLEYQETMEHFRHH 773
           +D   L    +  GL N GNTC++NS+LQ   S   L  +    V++  E ME   H+
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSKELMEFLDNNVIKTYEEMEQNEHN 146

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
            (REAL)
          Length = 787

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E EV 
Sbjct: 681  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEVL 727

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E EV 
Sbjct: 683  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEVL 729

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122W UBP1 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions irrespective of their size
            capable of cleaving polyubiquitin chains
          Length = 791

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239
            YSL +V +H G  +YGHY  + K R   G W + +DET+  V E EV +
Sbjct: 708  YSLRSVIVHYGTHNYGHYIAFRKHR---GFWWRISDETVYIVDEAEVLS 753

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
            UBP1Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; cleaves at the C terminus of
            ubiquitin fusions irrespective of their size; capable of
            cleaving polyubiquitin chains
          Length = 809

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E EV 
Sbjct: 679  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEVL 725

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E EV +
Sbjct: 642  LTYSLRSVIVHYGTHNYGHYIAFRKFR---GCWWRISDETVYIVDEAEVLS 689

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 706 RNSKLILHFID-TGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYV 760
           +N+ +   +I   G ID   L    +  GL N GNTC++NS+LQ   S   L  ++
Sbjct: 64  KNNNMFRRWIPRAGNIDDKILKKGGFVGGLVNDGNTCFMNSVLQSLASSKELNAFL 119

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 77/170 (45%), Gaps = 22/170 (12%)

Query: 936  QQDVTECIGNVLFQLES--ASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTK 993
            QQD  E +   L QL      D  + +++N    +   +F G++K +I+      + +T 
Sbjct: 241  QQDAHEFLQYFLNQLHQDYKRDSSHNEQENNCPCVAHSIFQGELKSSIVCPECQNDSKTI 300

Query: 994  IERYLSLLVNIGDHPKDIYDALDSYFSDERLTMAEYG--------DVKRTVAVTEFPTIL 1045
            I+ ++ L ++I D   D+Y  LDS+   E+L    Y         D  +   + + P +L
Sbjct: 301  IDPFMDLSLDIKD-KTDLYQCLDSFHKKEKLHDFNYHCSRCNTSLDPIKQFTINKLPPML 359

Query: 1046 QIQIQRVYYDRERFMPFKSIE-------PLPFNEVLYMDRYSDSQDPKMV 1088
             +Q++R     E F+   +++       PL  N   Y DR ++ + P ++
Sbjct: 360  VLQLKRF----EHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDII 405

 Score = 36.2 bits (82), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 33/74 (44%), Gaps = 9/74 (12%)

Query: 1184 EEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEG 1243
            +E   I Y L  +  H G  + GHY V +K    +G W K+ND  I+ + E E       
Sbjct: 399  QETPDIIYELTGILSHIGSINEGHYVVVLK--INDGRWFKFNDSMISVIKEDEALK---- 452

Query: 1244 NTATPYFLVY-VRQ 1256
                 Y L Y VRQ
Sbjct: 453  --QQAYLLFYTVRQ 464

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 15/72 (20%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP-Y 1249
            Y+L +V +H G  +YGHY  + K R   G W + +DET+  V E EV        +TP  
Sbjct: 678  YALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVL-------STPGV 727

Query: 1250 FLVYVRQGHEHD 1261
            F+++    +EHD
Sbjct: 728  FMLF----YEHD 735

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL--EYQETMEH 769
           TGL N+GNTCY+NS+LQ  F+    R   L  +Y++ M+H
Sbjct: 753 TGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEKYMDH 792

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239
            YSL +V +H G  +YGHY  +   R   G W + +DET+  V ETEV +
Sbjct: 654  YSLRSVVVHYGTHNYGHYIAF---RRYRGYWWRISDETVYIVDETEVLS 699

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  + K    +G+W  Y+DE I ++ E ++          
Sbjct: 625  VKYQLISVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKITEKQML-----KEPG 677

Query: 1248 PYFLVYVR 1255
             Y+L+Y R
Sbjct: 678  AYYLIYTR 685

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 22/41 (53%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHH 773
           G  N GNTCY NS+LQ  + L   R  VLEY E  E    H
Sbjct: 162 GYENFGNTCYCNSVLQCLYHLPEFRLRVLEYPEKPEEQERH 202

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 731 PTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           P G  N+GNTCYLN+ LQ  + +  LR  +L Y
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLREMILNY 140

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 1191 YSLFAVFIHRGEAS-YGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTA 1246
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V + ++ +   G  +
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGES 486

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            Y+L +V +H G  +YGHY  Y K R   G W + +DE++  V E EV 
Sbjct: 689  YALRSVIVHYGTHNYGHYIAYRKFR---GVWWRISDESVYVVDEAEVL 733

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 702

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPY 1249
            Y L  V +H G + S GHY V+ K     G W  Y+DE I  + E +V    E N    Y
Sbjct: 587  YQLITVVVHEGRSLSSGHYIVHCK--QPEGHWATYDDEYINNINEKDVLR--EPNA---Y 639

Query: 1250 FLVYVR 1255
            +LVY R
Sbjct: 640  YLVYTR 645

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
            UBP10Ubiquitin-specific protease that deubiquitinates
            ubiquitin-protein moieties; may regulate silencing by
            acting on Sir4p; involved in posttranscriptionally
            regulating Gap1p and possibly other transporters;
            primarily located in the nucleus
          Length = 792

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  + K    +G+W  Y+DE I  + E +V    E N   
Sbjct: 672  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINIISERDV--LKEPNA-- 725

Query: 1248 PYFLVYVR 1255
             Y+L+Y R
Sbjct: 726  -YYLLYTR 732

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYF 1250
            Y L  +  HRG  + GHY  Y K  + +G W ++ND  + +VP  ++           Y 
Sbjct: 423  YELTGIVTHRGTVNEGHYITYTK--TADGVWYQFNDSVVMKVPLEQMLK------EQAYL 474

Query: 1251 LVY-VRQ 1256
            L+Y +RQ
Sbjct: 475  LIYTIRQ 481

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 15/74 (20%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248
            + Y+L +V +H G  +YGHY  + K R   G W + +DET+  V E EV        +TP
Sbjct: 677  LTYALRSVIVHYGTHNYGHYIAFRKFR---GLWWRISDETVYVVDEAEVL-------STP 726

Query: 1249 -YFLVYVRQGHEHD 1261
              F+++    +EHD
Sbjct: 727  GIFMLF----YEHD 736

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 756

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + + GHY  + K    +G+W  Y+DE I ++ E ++          
Sbjct: 646  VKYQLISVVVHEGRSLTSGHYIAHCK--QPDGSWSTYDDEYINKISERQML-----KEPG 698

Query: 1248 PYFLVYVR 1255
             Y+LVY R
Sbjct: 699  AYYLVYTR 706

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE + +V + +VF    G  A P
Sbjct: 439  YNLHGVLVHAGDISTGHYYTLIKPGLED-QWYRFDDERVWKVTKNQVFEENYGLDALP 495

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLE 762
            G  N G TCYLNSLLQ YF     RR V +
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQ 233

 Score = 36.2 bits (82), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 72/153 (47%), Gaps = 23/153 (15%)

Query: 918  RVAKISSDQLE-------NALEMGRQQDVTECIGNVLFQLESASDPINLDEDNEQNDLVK 970
            +V+K   D LE       ++ E   Q DV E    ++ +LE+     +++       ++ 
Sbjct: 257  QVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTSVE------GMLN 310

Query: 971  QLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLT----- 1025
            ++F GK+K  I  +    E  +++E +  L +N+ +  K + ++ D+Y   E L      
Sbjct: 311  EIFVGKMKSYIKCIDVDYE-SSRVEDFWDLQLNVKNM-KGLKESFDNYIEIELLNGENQY 368

Query: 1026 -MAEYG--DVKRTVAVTEFPTILQIQIQRVYYD 1055
               +YG  D ++ V    FP +L +Q++R  YD
Sbjct: 369  QAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 401

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 1190 GYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTA 1246
             Y L  V IH G +  +GHY    K+  K G W  ++DET+  V E+ V  FT    N A
Sbjct: 691  AYELTGVVIHMGSSPQHGHYVSLCKN-DKFG-WLLFDDETVESVSESTVLEFTGDPNNQA 748

Query: 1247 TPYFLVY 1253
            T Y L Y
Sbjct: 749  TAYVLFY 755

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGN-ELRRI 781
           G  N GNTCY NS+LQ  ++L   R  +LEY    +H  H+  N E RRI
Sbjct: 173 GYENFGNTCYCNSVLQCLYNLYEFRLNMLEYS---DHLPHNYANIENRRI 219

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP-- 1248
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE + +V + +VF    G    P  
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKPDLQD-QWYRFDDEKVWKVTKKQVFEENFGMNKLPEE 502

Query: 1249 ---------------------YFLVYVRQGHEHDI 1262
                                 Y LVY+R+  E ++
Sbjct: 503  EIRGMTREQYQNYLITRHTSAYMLVYIREDKEPEV 537

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYV 760
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 235

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            I Y L  +  HRG  + GHY  + K     G W K+ND  +T + + EV 
Sbjct: 409  IIYELIGIVSHRGTVNEGHYIAFCK--ISGGQWFKFNDSVVTSIAQGEVL 456

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 46/92 (50%), Gaps = 9/92 (9%)

Query: 968  LVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLTMA 1027
            +V  +F G ++ +I+        +T I+ ++ L ++I D  K +Y+ LDS+   E+L   
Sbjct: 274  IVHSVFEGSLESSIVCPGCQKNSKTTIDPFMDLSLDIKD-KKKLYECLDSFHKKEQLKDF 332

Query: 1028 EYG--------DVKRTVAVTEFPTILQIQIQR 1051
             Y         D  + + +   P++L +Q++R
Sbjct: 333  NYHCGECNSTQDAIKQLGIHRLPSVLVLQLKR 364

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 41/95 (43%), Gaps = 24/95 (25%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP-- 1248
            Y L  V +H G+ S GHY+  I+  + +G+W +++D+ + +  + +VF    G    P  
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQPDA-HGSWYRFDDDRVIKATDKQVFEENFGKAKLPDD 489

Query: 1249 ---------------------YFLVYVRQGHEHDI 1262
                                 Y LVY+R+  E  I
Sbjct: 490  EIQGFTKDEYQNYLLARQTSAYMLVYIRKDMEESI 524

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 59/126 (46%), Gaps = 11/126 (8%)

Query: 969  VKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERL---- 1024
            + +LF GK+K  I  +    E  +++E +  + +N+ D  K++ ++ + Y   E +    
Sbjct: 303  INELFVGKMKSCIKCINVDYE-SSRVEDFWDIQLNVKDM-KNLQESFEQYIEVELMNGEN 360

Query: 1025 --TMAEYG--DVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYS 1080
                 ++G  D ++ V    FP +L +Q++R  YD       K  +   F E + +  Y 
Sbjct: 361  QYAAQDHGLQDAQK-VVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYL 419

Query: 1081 DSQDPK 1086
            DS  PK
Sbjct: 420  DSAAPK 425

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 44/105 (41%), Gaps = 26/105 (24%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP-- 1248
            Y L  V +H G+ S GHY+  IK  S    W +++D+ +  V + +VF    G+   P  
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKP-SIEDQWYRFDDDKVWRVTKNQVFEENFGHVRLPDE 501

Query: 1249 ---------------------YFLVYVRQGHEHDIEPLKRIIDRD 1272
                                 Y LVYVR+  E  I  L+ + D D
Sbjct: 502  KLRTFTREQYQNYLISRQTSAYMLVYVRKDMEDKI--LQEVEDSD 544

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLE 762
            G  N G TCYLNSLLQ YF     R+ V +
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLVYQ 236

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTAT 1247
            Y L  V IH G    +GHY    K+  K G W  Y+DET+  V E  V  FT   G+  T
Sbjct: 604  YELSGVVIHMGSGPQHGHYVCICKNE-KFG-WLLYDDETVESVSEETVLKFTGHSGDQTT 661

Query: 1248 PYFLVY 1253
             Y L Y
Sbjct: 662  AYVLFY 667

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETM 767
           G  N GNTCY NS+LQ  +++   R  VL Y E +
Sbjct: 137 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRYPERI 171

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
            YFR010W (REAL)
          Length = 500

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 14/87 (16%)

Query: 1172 IAKLENTIDKQFEEFKK-------------IGYSLFAVFIHRGEAS-YGHYWVYIKDRSK 1217
            +A  E+  D+  EE+KK               Y+L  V  H+G  S  GHY  +I+D   
Sbjct: 399  VALSESEQDQWLEEYKKHFPENLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELD 458

Query: 1218 NGTWRKYNDETITEVPETEVFNFTEGN 1244
               W K+ND+ +T V + ++ +   G 
Sbjct: 459  ENKWYKFNDDKVTAVEKEKIESLAGGG 485

 Score = 40.0 bits (92), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 731 PTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           P G  N+GNTCYLN+ LQ  + +  +R  +L Y
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDVRDMILNY 140

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 731 PTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           P G  N+GNTCYLN+ LQ  + +  LR  +L Y
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLRDMILNY 140

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 14/89 (15%)

Query: 1172 IAKLENTIDKQFEEFKK-------------IGYSLFAVFIHRGEAS-YGHYWVYIKDRSK 1217
            +A  E+  D+  EE+KK               Y+L  V  H+G  S  GHY  +I+D   
Sbjct: 398  VALNESEKDQWLEEYKKHFPPNLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELD 457

Query: 1218 NGTWRKYNDETITEVPETEVFNFTEGNTA 1246
               W K+ND+ ++ V + ++ +   G  +
Sbjct: 458  ENKWYKFNDDKVSVVEKEKIESLAGGGES 486

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTAT 1247
            Y L  V IH G +  +GHY    K+  K G W  ++DET+  V E  V  FT    N AT
Sbjct: 588  YELTGVVIHMGGSPQHGHYVSLCKN-DKFG-WLLFDDETVESVTEKTVLEFTGDSSNQAT 645

Query: 1248 PYFLVYVRQGHEHDIEPL 1265
             Y L Y ++  E D +P+
Sbjct: 646  AYVLFY-KELDEKDTKPV 662

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           G  N GNTCY NS+LQ  ++L  LR  +LEY
Sbjct: 138 GYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 718 GTIDASCLP---ADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
            TI +  +P     N   G  N GNTCY NS+LQ  ++L+ LR  +L++ E
Sbjct: 124 ATIASESMPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLSSLRENILQFPE 174

 Score = 36.6 bits (83), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTAT 1247
            Y L  + +H G    +GHY V +    K G W  ++DET+  V E  V  FT    N AT
Sbjct: 605  YQLAGIVVHMGGGPQHGHY-VSLCKHEKFG-WLLFDDETVEAVKEETVLEFTGESPNMAT 662

Query: 1248 PYFLVY 1253
             Y L Y
Sbjct: 663  AYVLFY 668

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRY 759
            GLNN+GNTCY+NS LQ    + P+R Y
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDY 425

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP-- 1248
            Y+L  V +H G+ S GHY+  IK    +  W +++D+ + +V +T+ F+   G+   P  
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKPNVTD-QWFRFDDDKVWKVTKTQAFDENFGHDNLPDE 497

Query: 1249 ---------------------YFLVYVRQGHEHDI 1262
                                 Y LVY+R+  E  +
Sbjct: 498  KLRTFTREQYQNYLIARQTSAYMLVYIREDMEEKV 532

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 17/28 (60%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYV 760
           G  N G TCYLNSLLQ YF     R+ V
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMV 230

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 10/92 (10%)

Query: 972  LFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERL------T 1025
            LF GK+K  I  +    E   ++E +  + +N+ +  KD+ ++ ++Y   E +       
Sbjct: 311  LFVGKMKSYIRCVNVDYE-SFRVEDFWDIQLNVKNL-KDVKESFENYVEVEMMDGENQYA 368

Query: 1026 MAEYG--DVKRTVAVTEFPTILQIQIQRVYYD 1055
              +YG  D K+ V    FP +L +Q++R  YD
Sbjct: 369  AQDYGLQDAKKGVVFESFPPVLHLQLKRFEYD 400

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 46/105 (43%), Gaps = 26/105 (24%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF------------ 1238
            Y+L  V +H G+ S GHY+  IK   ++  W +++D+ +  V + +VF            
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIKPGLEDA-WYRFDDDKVWRVTKKQVFEQNFGFDKLSEY 485

Query: 1239 -----------NFTEGNTATPYFLVYVRQGHEHDIEPLKRIIDRD 1272
                       N+      + Y LVY+R+  E  I  L+ + D D
Sbjct: 486  DLRSLTKEQYQNYLIARQTSAYMLVYIREDMESTI--LQEVTDAD 528

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLE 762
            GL N G TCYLNSLLQ Y+     R+ V +
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLVYQ 220

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           G  N GNTCY NS+LQ  ++L  LR ++LEY
Sbjct: 144 GYENFGNTCYCNSVLQVLYNLPELRVHLLEY 174

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL122W
            (UBP1)
          Length = 775

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239
            YSL +V +H G  +YGHY  + K R   G W + +DET   V E EV +
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAFRKFR---GVWWRISDETAYIVDEAEVLS 719

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248
            + Y L +V +H G  +YGHY  + K R   G W + +DET+  V E EV      +T+  
Sbjct: 656  LTYVLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVEEAEVL-----STSGV 707

Query: 1249 YFLVY 1253
            + L Y
Sbjct: 708  FMLFY 712

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 718 GTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYV 760
           G +D   L    +  GL N GNTC++NS++Q   S A L +++
Sbjct: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
            YDL122W
          Length = 782

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 11/82 (13%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248
            + YSL +V +H G  +YGHY  +   R   G W + +DE++  V E EV      +T   
Sbjct: 672  LTYSLRSVIVHYGTHNYGHYIAF---RRYRGCWWRISDESVYIVEEAEVL-----STPGV 723

Query: 1249 YFLVYVRQGHEHDIEPLKRIID 1270
            + L Y    +++D+E  K   D
Sbjct: 724  FMLFY---EYDYDVETKKMFDD 742

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 671 ETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLILHFIDTGTIDASCL-PADN 729
           E++L  F    H + A E          LT++ +E+N        D+   +   L P  N
Sbjct: 265 ESILTKFSFDLHNKLATEK--------TLTELQVEQNLNWDFKMTDSAGHELIKLEPNGN 316

Query: 730 WPTGLNNIGNTCYLNSLLQYYFS 752
           +  GL N+GN+CYLNS+LQ  F+
Sbjct: 317 FGCGLINLGNSCYLNSILQALFA 339

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
            Anc_2.69 YNL186W
          Length = 746

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 8/68 (11%)

Query: 1189 IGYSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTAT 1247
            + Y L +V +H G + S GHY  + K    +GTW  Y+DE    + E  V          
Sbjct: 614  VMYQLISVVVHEGRSLSSGHYIAHCK--QPDGTWATYDDEYTNIISERNVL-----KEPN 666

Query: 1248 PYFLVYVR 1255
             Y+LVY R
Sbjct: 667  AYYLVYTR 674

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 1190 GYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248
             Y+L  V +H G+ S GHY+  IK  + +  W +++DE +  V + +VF+   G    P
Sbjct: 495  NYNLHGVLVHTGDISTGHYYAMIKP-TTDDKWYRFDDEKVWRVTKKQVFDENFGLNRLP 552

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
           G  N GNTCY NS+LQ  F+L   R  +L++ E
Sbjct: 115 GYENFGNTCYCNSILQCLFNLTEFRNSILQFPE 147

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNF 1240
            Y L  V +H G    +GHY    K  + N  W  ++DET+  + E +V NF
Sbjct: 595  YELTGVVLHMGGGPQHGHYVSVCK--TDNFGWLFFDDETVETLDEPQVLNF 643

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 699 LTKIGIERNSKLILHFIDTGTIDASCLPADN-WPTGLNNIGNTCYLNSLLQ 748
           L ++ IE+N       +D+   +   LPA N +  GL N+GN+CYLNS++Q
Sbjct: 289 LVQLQIEQNENWQFKMVDSSGKELKKLPASNEYGCGLINLGNSCYLNSVMQ 339

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 4/43 (9%)

Query: 1191 YSLFAVFIHRGEASY-GHYWVYIKDRSKNGTWRK--YNDETIT 1230
            Y+L AV  H+G + + GHY V+I+ +   G W+   YNDE + 
Sbjct: 721  YALTAVICHKGNSVHSGHYVVFIR-KMVEGEWKWVLYNDEKLV 762

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 8/71 (11%)

Query: 1184 EEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEG 1243
            E    I Y L  V  H+G    GHY    K  +++G W K+ND  +T V E +V      
Sbjct: 382  EYIPNIAYDLLNVVSHQGTVDQGHYTTVSK--TEDGQWFKFNDSVVTSVTEEQVLE---- 435

Query: 1244 NTATPYFLVYV 1254
                 Y L Y+
Sbjct: 436  --QQAYLLFYI 444

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 20/29 (68%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           GLNN+GNTCY+NS LQ    +  LR Y L
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFL 371

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 40.4 bits (93), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 11/89 (12%)

Query: 673 VLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLILHFIDTGTIDASCLPADNWPT 732
           + ++F+ +    T+  SD ++++K       +E N     H++    +     PA    T
Sbjct: 313 IPDMFENRLDMITSNPSDLVIEVKP------VEGNH----HWVSNHFVYNKLEPASG-TT 361

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           GL N+GNTCY+NS LQ    L  LR Y L
Sbjct: 362 GLVNLGNTCYMNSALQCLVHLPQLRDYFL 390

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 40/83 (48%), Gaps = 12/83 (14%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITE-VPETEVFNFTEGNTATPY 1249
            Y L+AV  H G    GHY  Y+K+   N  W  ++D  +TE VPE  V         + Y
Sbjct: 1051 YDLYAVDNHYGGLGGGHYTAYVKNFMDN-KWYYFDDSRVTETVPENSV-------AGSAY 1102

Query: 1250 FLVYVRQ---GHEHDIEPLKRII 1269
             L Y+R+   G+E     L+ II
Sbjct: 1103 LLFYIRRTKDGNELGGSKLQEII 1125

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 40.0 bits (92), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 46/105 (43%), Gaps = 26/105 (24%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP-- 1248
            Y+L  V +H GE S GHY+  IK    +  W +++D+ +  V + + F+   G+   P  
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKPDVGD-QWFRFDDDKVWRVTKEQAFDENFGHEPLPDD 497

Query: 1249 ---------------------YFLVYVRQGHEHDIEPLKRIIDRD 1272
                                 Y LVY+R+  E ++  L+ + D D
Sbjct: 498  KLRSLTREQYQNYLIARQTSAYMLVYIREDMEKNV--LEDVSDTD 540

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 49/95 (51%), Gaps = 10/95 (10%)

Query: 969  VKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDE------ 1022
            + +LF GK+K  I  +    E  +++E +  + +N+ +  K + ++ D+Y   E      
Sbjct: 308  LNELFVGKMKSYIRCINVDYE-SSRVEDFWDIQLNVKN-LKGVQESFDNYVEVEIMDGEN 365

Query: 1023 RLTMAEYG--DVKRTVAVTEFPTILQIQIQRVYYD 1055
            +    +YG  D K+ V    FP++L +Q++R  YD
Sbjct: 366  QYAAQDYGLQDAKKGVVFESFPSVLHLQLKRFEYD 400

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 18/28 (64%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYV 760
           GL N G TCYLNSLLQ YF     R+ V
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV 230

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 40.0 bits (92), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 48/105 (45%), Gaps = 12/105 (11%)

Query: 1152 EQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHRGEA-SYGHYWV 1210
            E+ K +I   ++ L  L  D++   NT       +KK  Y L  V IH G    +GHY  
Sbjct: 569  EEQKSNIKLFNKILYPLTLDVSSTFNT-----SVYKK--YELSGVVIHMGSGPQHGHYVC 621

Query: 1211 YIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTATPYFLVY 1253
                R++   W  Y+DET+  + E  V  FT   G+  T Y L Y
Sbjct: 622  IC--RNEKFGWLLYDDETVESIKEETVLQFTGHPGDQTTAYVLFY 664

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
           G  N GNTCY NS+LQ  +++   R  VL Y E
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRYPE 167

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            I Y L  +  H G  + GHY  + K   +NG W K+ND  +T++ E +V 
Sbjct: 399  ILYELIGIISHTGSVNEGHYVAFCK--IENGEWFKFNDSMVTKILEKDVL 446

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 40.0 bits (92), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTAT 1247
            Y L  V IH G    +GHY V I    K G W  Y+DET+  + E  V  FT   G+  T
Sbjct: 599  YELSGVVIHMGSGPQHGHY-VCICKNEKFG-WLLYDDETVESIREETVLQFTGHPGDQTT 656

Query: 1248 PYFLVY 1253
             Y L Y
Sbjct: 657  AYVLFY 662

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
           G  N GNTCY NS+LQ  +++   R  +L+Y E
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNILQYPE 167

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
            Anc_3.270 YBR058C
          Length = 765

 Score = 39.7 bits (91), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 1191 YSLFAVFIHRGEASY-GHYWVYIKDRSKNGTWRKYNDETITEV 1232
            Y L+ +  H+G ++  GHY  YI  R ++G W  YNDE I  V
Sbjct: 707  YKLYGIVCHKGNSTQSGHYVAYI--RQRDGQWTLYNDEKIVCV 747

 Score = 35.8 bits (81), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 699 LTKIGIERNSKLILHFID-TGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYF 751
           LT++ +E+N        D +G       P+     GL N+GN+CYLNS+LQ  F
Sbjct: 286 LTELQVEQNMNWDFQMTDESGHELVKLNPSKEVGCGLINMGNSCYLNSVLQCLF 339

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 39.7 bits (91), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           TGL N+GNTCY+NS LQ    +  LR Y L
Sbjct: 302 TGLTNLGNTCYMNSALQCLVHIPELRDYFL 331

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 13/82 (15%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEV-PETEVFNFTEGNTATPY 1249
            Y L AV  H G    GHY  Y+K    N  W  ++D  +TE  PE+ +         + Y
Sbjct: 959  YDLIAVDNHFGGLGGGHYTAYVK---TNDKWFYFDDSRVTETKPESSI-------AGSAY 1008

Query: 1250 FLVYVRQGHEHDI--EPLKRII 1269
             L Y+R+     I  E L+ II
Sbjct: 1009 LLFYLRRTESGKIGSERLQSII 1030

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 39.7 bits (91), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRH 772
           G  N GNTCY NS+LQ  ++L+ +R  +L++ E      H
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVRENILQFPEKPNESTH 181

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 5/66 (7%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTAT 1247
            Y L  + +H G    +GHY    K       W  ++DET+  V E  V  FT    N AT
Sbjct: 604  YELSGIVVHMGGGPQHGHYVSLCKHEIFG--WLLFDDETVEAVKEEAVLEFTGESPNMAT 661

Query: 1248 PYFLVY 1253
             Y L Y
Sbjct: 662  AYVLFY 667

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 39.3 bits (90), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTAT 1247
            Y L  V IH G    +GHY    K+  K G W  Y+DET+  + E  V  FT   G+  T
Sbjct: 593  YELSGVVIHMGSGPQHGHYVCICKNE-KFG-WLLYDDETVESIREETVLKFTGHPGDQTT 650

Query: 1248 PYFLVY 1253
             Y L Y
Sbjct: 651  AYVLFY 656

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
           G  N GNTCY NS+LQ  ++++  R  VL Y E
Sbjct: 127 GYENFGNTCYCNSVLQCLYNISEFRCNVLRYPE 159

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 39.7 bits (91), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 30/107 (28%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF------------ 1238
            Y+L  V +H G+ S GHY+  IK    +  W +++D+ + +V + +VF            
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIKP-GLDDKWYRFDDDKVWQVTKKQVFEQNFGFDRLPEY 494

Query: 1239 -----------NFTEGNTATPYFLVYVRQGHEHDIEP--LKRIIDRD 1272
                       N+      + Y LVY+++    D+EP  L+ + D D
Sbjct: 495  ELRSLSKEQYQNYLIARQTSAYMLVYIKE----DMEPTILQEVEDSD 537

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 18/29 (62%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYV 760
            GL N G TCYLNSLLQ Y+     R+ V
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFTKYFRKLV 227

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 39.3 bits (90), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGNELR 779
           G  N GNTCY NS+LQ  ++L+ LR  +L++ +           E+R
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPKKSRESDQPRKKEMR 187

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTATP 1248
            Y L  + +H G      ++V +    K G W  ++DET+  V E  V  FT    N AT 
Sbjct: 602  YELAGIVVHMGGGPQHGHYVSLCKHEKFG-WLLFDDETVEAVKEETVLEFTGESPNMATA 660

Query: 1249 YFLVY 1253
            Y L Y
Sbjct: 661  YVLFY 665

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
           Anc_7.390
          Length = 717

 Score = 39.3 bits (90), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 66/163 (40%), Gaps = 22/163 (13%)

Query: 607 INDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGP-GTLLYSEALSMLQLN 665
           IND     +D D A+    + + S+  L  L +   D++    P GT   ++A S  Q+ 
Sbjct: 15  INDKA--TVDVDVAITVTNIDEESIGPLETLDRLDDDWEYTLNPKGTEFPTDASSTFQVK 72

Query: 666 ENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLILHFIDTGTIDASCL 725
           E  G  T               +++Y    K       +  +  L    +   TI+   L
Sbjct: 73  EVLGTNT---------------DAEYSAISKNPFITNEVGEDEVLNFPILFANTINEQ-L 116

Query: 726 P---ADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
           P     N   G  N GNTCY NS+LQ  ++L   R  +L+Y E
Sbjct: 117 PFGDGSNKVFGYENFGNTCYCNSVLQCLYNLPEFRLNILQYPE 159

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTA 1246
            I Y L  + IH G+     ++V +    K G W  Y+DET+  V E  V  F   E   +
Sbjct: 563  IKYELSGIVIHVGDGPQMGHYVALCKTEKYG-WLFYDDETVESVSEETVLKFIGDEKTQS 621

Query: 1247 TPYFLVYVRQG 1257
            T Y L Y + G
Sbjct: 622  TAYVLFYKKLG 632

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 38.9 bits (89), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 52/99 (52%), Gaps = 10/99 (10%)

Query: 962  DNEQND-LVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFS 1020
            +N+Q + +V  +F G ++ +I+        +T I+ +L L ++I D  K +Y+ LDS+  
Sbjct: 267  NNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKD-KKKLYECLDSFHK 325

Query: 1021 DERLTMAEYG--------DVKRTVAVTEFPTILQIQIQR 1051
             E+L    Y         D  + + + + P++L +Q++R
Sbjct: 326  KEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKR 364

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            I Y L  +  H+G  + GHY  + K     G W K+ND  ++ + + EV 
Sbjct: 409  IIYELIGIVSHKGTVNEGHYIAFCKISG--GQWFKFNDSMVSSISQEEVL 456

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 38.9 bits (89), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
           G  N GNTCY NS+LQ  ++L  LR  +LE+ E
Sbjct: 144 GYENFGNTCYCNSVLQVIYNLPELRVNLLEFPE 176

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 38.9 bits (89), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 698 ALTKIGIERNSKLILHFIDTGTIDASCLPA-DNWPTGLNNIGNTCYLNSLLQYYFS 752
            L ++ +E+N       +D+   +   L A D++  GL N+GN+CYLNS+LQ +++
Sbjct: 291 TLVELQVEQNMNWNFQMVDSEGKELKSLKAGDDFGVGLINLGNSCYLNSILQCFYN 346

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 38.9 bits (89), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE + +V + +VF
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKPDLED-QWYRFDDEKVWKVTKKQVF 484

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYV 760
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 229

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 1190 GYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239
             Y L  V +H G+ S GHY+  IK   ++  W +++DE + +V + +VF+
Sbjct: 440  NYKLHGVLVHTGDISTGHYYAMIKPTLED-QWYRFDDEKVWKVDKKQVFD 488

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYV 760
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 232

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           TGL N+GNTCY+NS+LQ  F  +  R   L
Sbjct: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            Y L ++  H+G  + GHY V +K    +G W K+ND  ++ + E E  
Sbjct: 433  YELTSIISHKGTVNEGHYIVVVK--VNDGQWFKFNDSMVSAITEEEAL 478

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           TGL N+GNTCY+NS LQ    +  LR Y L
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

 Score = 33.1 bits (74), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITE-VPETEVFNFTEGNTATPY 1249
            Y L+AV  H G    GHY  Y+K+ + N  W  ++D  +TE  PE  +         + Y
Sbjct: 1052 YDLYAVDNHYGGLGGGHYTAYVKNFADN-KWYYFDDSRVTETAPENSI-------AGSAY 1103

Query: 1250 FLVYVRQ 1256
             L Y+R+
Sbjct: 1104 LLFYIRR 1110

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           TGL N+GNTCY+NS LQ    +  LR Y L
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

 Score = 36.2 bits (82), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 9/72 (12%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITE-VPETEVFNFTEGNTATPY 1249
            Y L+AV  H G    GHY  Y+K+ + N  W  ++D  +TE VPE  +         + Y
Sbjct: 1048 YDLYAVDNHYGGLGGGHYTAYVKNFA-NNKWYYFDDSRVTETVPENSI-------AGSAY 1099

Query: 1250 FLVYVRQGHEHD 1261
             L Y+R+  + D
Sbjct: 1100 LLFYIRRPKDGD 1111

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757
           TGL N+GNTCY+NS+LQ  F+    R
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATTKFR 633

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           TGL N+GNTCY+NS LQ    +  LR Y L
Sbjct: 293 TGLYNLGNTCYMNSALQCLVHIPELRDYFL 322

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           TGL N+GNTCY+NS LQ    +  LR Y L
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 12/85 (14%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITE-VPETEVFNFTEGNTATPY 1249
            Y L+AV  H G    GHY  Y+K+ + +  W  ++D  +TE VPE  +       + + Y
Sbjct: 1054 YDLYAVDNHYGGLGGGHYTAYVKNFA-DSKWYYFDDSRVTETVPENSI-------SGSAY 1105

Query: 1250 FLVYVRQ---GHEHDIEPLKRIIDR 1271
             L Y+R+   G+E     L+ II +
Sbjct: 1106 LLFYIRRAKDGNELGSHELQEIIRK 1130

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 732  TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
            TGL N+ NTCY+NS+LQ  FS +  R   L
Sbjct: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 39/89 (43%), Gaps = 11/89 (12%)

Query: 1169 YHDIAKLENTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDET 1228
            Y D++K   T DK   E   I Y L  +  H+G  + GHY    K     G W K+ND  
Sbjct: 374  YLDMSKYCQT-DK-VGETPAIVYELIGLISHQGSVNQGHYTSICK--IPGGQWFKFNDSM 429

Query: 1229 ITEVPETEVFNFTEGNTATPYFLVY-VRQ 1256
            +T V E +V           Y L Y VRQ
Sbjct: 430  VTAVAEIDVLK------EQAYLLFYTVRQ 452

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 8/66 (12%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248
            I + L  +  HRG  + GHY  + K  +  G W K+ND  ++ + E E+           
Sbjct: 403  IIFELIGIIAHRGTVNEGHYIAFTKVTT--GHWFKFNDSMVSSITEEELLQ------EQA 454

Query: 1249 YFLVYV 1254
            Y L YV
Sbjct: 455  YLLFYV 460

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 20/37 (54%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETME 768
            G  N G TCYLNSLLQ YF     RR V E    M+
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYEIPTDMD 239

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239
            Y+L  V +H G+ S GHY+  I+    +  W +++D+ +  V + + F+
Sbjct: 441  YNLHGVLVHAGDISTGHYYTMIRPGVSD-EWYRFDDDKVWRVTKKQAFD 488

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           G  N GNTCY NS+LQ  ++L   R  VL+Y
Sbjct: 147 GYENFGNTCYCNSVLQCLYNLTEFRLNVLQY 177

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 59/140 (42%), Gaps = 18/140 (12%)

Query: 948  FQLESASDPINLDEDNEQND-LVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGD 1006
            F +   SD I  D  N Q+D  + + F G +   I  L+    + ++ E +L   + + +
Sbjct: 521  FLINQLSDYIQTDCANPQDDNFINESFQGILTNRIKCLS-CDNVTSRDEPFLDFPIEVQE 579

Query: 1007 HPK--DIYDALDSYFSDERL---------TMAEYGDVKRTVAVTEFPTILQIQIQRVYYD 1055
            H +  DI   L SY   E L               + +RTV + + P  L + ++R  Y 
Sbjct: 580  HKEFTDISTILKSYHQKEMLGGHNKFYCSQCCTLQEAQRTVGLKKLPNTLALHLKRFKYS 639

Query: 1056 RERFMPFKSIEPLPFNEVLY 1075
             E F   K      FN+++Y
Sbjct: 640  EEHFTNIKL-----FNKIVY 654

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            I Y L  +  H+G  + GHY  + K     G W K+ND  ++ + + EV 
Sbjct: 411  IIYELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 458

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (68%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           GL+N+GNTCY+NS LQ    +  LR Y L
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFL 352

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248
            Y L  V +H G+ S GHY+  IK       W +++DE + +V   +VF+   G    P
Sbjct: 448  YKLHGVLVHTGDISTGHYYTMIK-PDLGDQWYRFDDERVWKVDRKQVFDENFGLDKLP 504

 Score = 36.6 bits (83), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLE 762
            G  N G TCYLNSLLQ YF     R+ V E
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 239

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           TGL N+GNTCY+NS+LQ  F+    R   L
Sbjct: 556 TGLRNMGNTCYINSMLQCLFATRKFRDLFL 585

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            I Y L  +  H+G  + GHY  + K     G W K+ND  ++ + + EV 
Sbjct: 409  IIYELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 456

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYV--LEYQETMEHFRHHTG 775
           TGL N+GNTCY+NS++Q  F+    R     ++Y+E ++      G
Sbjct: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPG 736

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239
            Y L  V +H G+ S GHY+  IK  +K+  W +++D+ +    + ++F+
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKPSTKD-EWYRFDDDRVWRATKKQIFD 487

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLE 762
            G  N G TCYLNSLLQ Y+     RR V +
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLVYQ 233

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 20/26 (76%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757
           TGL N+GNTCY++S+LQ  F+   LR
Sbjct: 625 TGLRNLGNTCYISSMLQCLFATTTLR 650

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           +GL N+GNTCY+NS+LQ  F+    R   L
Sbjct: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFL 475

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 699 LTKIGIERNSKLILHFIDT-GTIDASCLPADNWPTGLNNIGNTCYLNSLLQ 748
           L ++ +E+N       +D+ G      LP  ++  GL N+GN+CYLNS+LQ
Sbjct: 289 LVQLQVEQNENWQFRMVDSSGKEFKRLLPNKDYGCGLINLGNSCYLNSVLQ 339

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 14/101 (13%)

Query: 1144 GLNNDFLIEQLKQSIADIDQELTSLYHDI---AKL---ENTIDKQFEEFKKIGYS----- 1192
            GLN +   + L  +  D+++ +  +++++    +L   E    +Q  + K +GYS     
Sbjct: 662  GLNPNLCRKALILNNGDVNRSVEWIFNNMDDDGRLPDPEGPTGRQQRKQKDLGYSTSRPY 721

Query: 1193 -LFAVFIHRGEASY-GHYWVYIKDR-SKNGTWRKYNDETIT 1230
             L AV  H+G +++ GHY V+I+   +    W  YNDE + 
Sbjct: 722  ALTAVVCHKGNSAHSGHYVVFIRKLVAGEWKWVLYNDEKLV 762

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 28/105 (26%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL--EYQETMEHFRHHTGNELRRIGGXXXXXX 789
           TGL N+GNTCY+NS LQ    +   R Y L   Y++ +     +T N L   G       
Sbjct: 321 TGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKEL-----NTDNPLGYQG------- 368

Query: 790 XXXXXXQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNFEV 834
                      + + F  +I    RC+   K + + A+AP++F+ 
Sbjct: 369 ----------HVAEAFSELI----RCLFGDKLVQFSAYAPNHFKA 399

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 15/50 (30%)

Query: 727 ADNWP---------------TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
            D+WP               TGL+N+GN+CY+NS LQ    +  L+ Y L
Sbjct: 314 GDHWPSNHFYYNKLLPPRGTTGLSNLGNSCYMNSALQCLVHIPELKDYFL 363

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGNE 777
           G+ N+GNTCY+NS+LQ  F     R   L   +  E F+  T +E
Sbjct: 214 GIRNMGNTCYMNSMLQCLFGSTQFRDLFL--TDKFEMFKAETNSE 256

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 1184 EEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            E    I Y L  V  H G  + GHY   +K  S N  W K+ND  +T + E EV 
Sbjct: 373  ENNSSIIYELNGVISHIGTVNEGHYIATLKLDSNN--WFKFNDSMVTSISEEEVL 425

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 9/92 (9%)

Query: 968  LVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLTMA 1027
            L+  +F GK+K +I+        +T  + Y+ L ++I D    +Y  LDS+   E L   
Sbjct: 251  LIHSIFQGKLKSSIVCPECHDNSKTVTDPYIDLSLDIKD-KATLYQCLDSFHKKETLHDY 309

Query: 1028 EYG--------DVKRTVAVTEFPTILQIQIQR 1051
             Y         D  + + + + P +L +Q++R
Sbjct: 310  NYHCPNCDTMQDPIKQLTIDKLPPVLVLQLKR 341

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248
            Y L  V +H G+ S GHY+  IK   ++  W +++DE + +V + + F+   G    P
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLED-QWYRFDDERVWKVSKKQAFDENFGFDRLP 496

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEH 769
            G  N G TCYLNSLLQ YF     RR V +   + E+
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTSQEN 240

 Score = 33.1 bits (74), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 10/95 (10%)

Query: 969  VKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERL---- 1024
            + ++F GK+K  I  +    E   + E +  + +N+ +  K + D+ ++Y   E +    
Sbjct: 309  LNEIFVGKMKSFIKCINVDYE-SARTEDFWDIQMNVKNL-KGLKDSFENYIEVELMDGEN 366

Query: 1025 --TMAEYG--DVKRTVAVTEFPTILQIQIQRVYYD 1055
                 +YG  D K+ V    FP +L +Q++R  YD
Sbjct: 367  QYAAQDYGLQDAKKGVVFESFPAVLHLQLKRFEYD 401

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL--EYQETMEHFRHHTGNEL 778
           TGL N+GNTCY+NS++Q  F+    R   +  +Y+  ++  R   GN L
Sbjct: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR---GNRL 647

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           G  N GNTCY NS+LQ  ++L   R  +L+Y
Sbjct: 116 GYENFGNTCYCNSVLQCLYNLTEFRTEILKY 146

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           G  N GNTCY NS+LQ  +++  LR  +L++
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNILQF 547

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757
           TGL N+GNTCY+NS+LQ  F+    R
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATRRFR 633

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757
           TGL N+GNTCY+NS++Q  F+    R
Sbjct: 609 TGLRNLGNTCYINSMIQCLFAAKTFR 634

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 771

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239
            Y L +V +H G  +YGHY  + + R   G W + +DE++  V E EV +
Sbjct: 681  YVLRSVIVHYGTHNYGHYIAFRRFR---GCWWRISDESVYIVDEQEVLS 726

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 37.4 bits (85), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
            GL+N+GN+CY+NS LQ    +  LR Y L
Sbjct: 298 VGLSNLGNSCYMNSALQCLVHIPELRDYFL 327

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 5/52 (9%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLE-----YQETMEHFRHHTGNEL 778
           TGL N+GNTCY+NS++Q  F+    R   +      Y E +   R H   +L
Sbjct: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKL 649

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTAT 1247
            Y L  V +H G + ++GHY V I    K G W  Y+DETI  +PE  V +      N  T
Sbjct: 583  YELTGVVLHVGASPTHGHY-VSICKHEKYG-WLMYDDETIESIPEEAVTSHVGEPNNPIT 640

Query: 1248 PYFLVY 1253
             Y L Y
Sbjct: 641  AYVLFY 646

 Score = 35.4 bits (80), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
           G  N G+TCY NS+LQ  ++L   R+ +L++ +
Sbjct: 122 GYENFGHTCYCNSVLQCIYNLPEFRKSILQFPQ 154

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           G  N GNTCY NS+LQ  +++  LR  V++Y
Sbjct: 113 GYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 37.0 bits (84), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757
           TGL N+GNTCY+NS+LQ  F+    R
Sbjct: 678 TGLRNLGNTCYINSMLQCLFATRLFR 703

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           TGL N+ NTCY+NS+LQ  FS    R   L
Sbjct: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 36.6 bits (83), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFR 771
           G  N GNTCY NS+LQ  +++   R  +L++ E   + R
Sbjct: 132 GFENFGNTCYCNSVLQCLYNMTEFRIQMLQHPERNSNTR 170

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 36.6 bits (83), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757
           TGL N+GNTCY+NS++Q  F+    R
Sbjct: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           GL+N+GNTCY+NS LQ    +  L  Y L
Sbjct: 340 GLSNLGNTCYMNSALQCLLHIPELNEYFL 368

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 36.2 bits (82), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           GL N GNTCY NS+LQ  +++   R  +L
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENIL 160

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
           G  N GNTCY NS+LQ  ++ + LR  ++ Y E
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILYPE 160

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 5/66 (7%)

Query: 1191 YSLFAVFIHRGEA-SYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFT--EGNTAT 1247
            Y L  + IH G    +GHY    K  ++   W  Y+DET+  V E +V        + AT
Sbjct: 596  YELSGIIIHLGAGPQHGHYVAMCK--TEKFGWLLYDDETVEAVLEKDVLRHVGDSNDLAT 653

Query: 1248 PYFLVY 1253
             Y L Y
Sbjct: 654  AYILFY 659

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 36.2 bits (82), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 699 LTKIGIERNSKLILHFIDTGTIDASCL-PADNWPTGLNNIGNTCYLNSLLQ 748
           L ++ +E+N       +D+   +   L P+ ++  GL N+GN+CYLNS++Q
Sbjct: 289 LIQLQVEQNENWQFRMVDSSGKEFEKLSPSKDYGCGLINLGNSCYLNSVMQ 339

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           TGL NIG TCY+NS+LQ  F+    R   L
Sbjct: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQE 765
           G  N GNTCY NS+LQ  ++L   R  +L++ E
Sbjct: 125 GYENFGNTCYCNSVLQCLYNLTEFRLLLLQHLE 157

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 35.8 bits (81), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 25/64 (39%), Gaps = 8/64 (12%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYF 1250
            Y L AV  H G  + GHY    K     G W ++ND  I  + E E            Y 
Sbjct: 394  YELVAVISHEGSVNQGHYTSMCK--IPGGQWFRFNDSMIVSISEEEALR------QQAYL 445

Query: 1251 LVYV 1254
            L YV
Sbjct: 446  LFYV 449

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 36.2 bits (82), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757
           TGL N+GNTCY+N +LQ  F+   L+
Sbjct: 648 TGLRNLGNTCYINCMLQSLFATNELK 673

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 35.8 bits (81), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           G  N GNTCY NS+LQ  ++L   R  +L Y
Sbjct: 151 GYENFGNTCYCNSVLQCLYNLPEFRNDMLRY 181

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 36.2 bits (82), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           GL+N+GNTCY+NS LQ    +   + Y L
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFL 375

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 35.8 bits (81), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757
           TGL N+G+TCY+NS+LQ  F+    R
Sbjct: 613 TGLRNLGSTCYINSMLQCLFATRKFR 638

>TPHA0A05280 Chr1 complement(1190702..1197967) [7266 bp, 2421 aa] {ON}
            Anc_5.73 YHR165C
          Length = 2421

 Score = 36.2 bits (82), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 4/101 (3%)

Query: 318  NSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYFEFEPPNLTNYIEDRKVRRLRESF 377
            N+  V + S+ NPN L +  GFE+ +  +E T ES    E   + + IED+  R++ +++
Sbjct: 1254 NTSFVSVYSKYNPNLLFTMCGFEVRIIPNERTNESTSTDE--GVWDLIEDKSKRKIAKAY 1311

Query: 378  IRKCIELIFLGKTAIE--LLGKDAKTTSKVYRTFNAIQIAF 416
            ++   E I + ++ I   LL   + T +KV   +N   I+ 
Sbjct: 1312 LKVSQEEIEIFESRIRSILLTSGSTTFTKVASKWNTNLISL 1352

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 698 ALTKIGIERNSKLILHFIDTGTIDASCLPAD-NWPTGLNNIGNTCYLNSLLQ 748
            L ++ +E+N       +D+   +   L A  N+  GL N+GN+CYLNS++Q
Sbjct: 288 TLVQLQVEQNENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQ 339

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           GL+N+GNTCY+NS LQ    +  LR Y  
Sbjct: 290 GLSNLGNTCYMNSGLQCLVHIPKLRDYFF 318

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 35.8 bits (81), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 693 LKLKAALTKIGIERNSKLILHFIDTGTIDASCL-PADNWPTGLNNIGNTCYLNSLLQYYF 751
           L  +  L ++ +E+N        D+   D   L P      GL N+GN+CYLNS+LQ  F
Sbjct: 283 LASEKTLVELQVEQNMNWDFQMTDSAGKDLLKLKPDQEHGCGLINLGNSCYLNSVLQCLF 342

Query: 752 S 752
           +
Sbjct: 343 N 343

>TBLA0F01150 Chr6 (287045..290413) [3369 bp, 1122 aa] {ON} Anc_3.115
            YOL087C
          Length = 1122

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 10/76 (13%)

Query: 1020 SDERLTMAEYGDVKRTVAVTEFPTILQIQIQ---RVYYDRERFMPFKSIEPLPFNEVLYM 1076
            S+ +LT+ EY +    V  T F TIL  Q++   ++Y + ERF+PF        +++L++
Sbjct: 871  SNIQLTV-EYIESAIPVNQTIFKTILPKQVKENYQLYRNLERFLPFW------LSKILFI 923

Query: 1077 DRYSDSQDPKMVEKKK 1092
            D    ++DP +V KKK
Sbjct: 924  DDTIKNKDPLLVPKKK 939

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           TGL N  NTCY+NS++Q  F   P R   L
Sbjct: 292 TGLQNPCNTCYINSIIQCLFGSTPFRDLFL 321

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 729 NWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           N   GL N+GNTCY+NS LQ    +   + Y L
Sbjct: 346 NGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFL 378

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           GL N+GNTCY+NS LQ    +   R Y L
Sbjct: 331 GLTNLGNTCYMNSALQCITHIPIFRDYFL 359

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           GL+N+GNTCY+NS LQ    +  +R Y +
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFV 350

 Score = 33.1 bits (74), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEV-PETEVFNFTEGNTATPY 1249
            Y L AV  H G    GHY  Y+K+ + +  W  ++D  +++  PE  +         + Y
Sbjct: 983  YDLIAVDNHYGGMGGGHYTAYVKNLT-DQNWYYFDDSRVSKTSPEKSI-------AGSAY 1034

Query: 1250 FLVYVRQGHEHDIEP--LKRIID 1270
             L Y+R+G  ++I+   LK IID
Sbjct: 1035 LLFYLRRGSLNNIDSKRLKDIID 1057

>KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly
           similar to uniprot|P38237 YBR058C Saccharomyces
           cerevisiae UBP14 Ubiquitin-specific protease that
           specifically disassembles unanchored ubiquitin chains
          Length = 762

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLE 762
           GL N+GN+CYLNS+LQ   +   L R+ LE
Sbjct: 310 GLQNLGNSCYLNSVLQVLLN-GDLSRWSLE 338

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239
            Y L  V  H+G  + GHY    K   +   W K+ND  ++ V + E  N
Sbjct: 403  YELIGVVAHKGTVNEGHYVATTKVAGRQ--WFKFNDSMVSSVTQEEALN 449

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
            (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 6/66 (9%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYF 1250
            Y+L+AV  H G    GHY  Y+    KNG W  Y D+T     ++E     E  T + Y 
Sbjct: 361  YNLYAVACHFGTLYGGHYTAYVNKEDKNG-W-CYFDDTCWRKAKSE----DECITTSAYV 414

Query: 1251 LVYVRQ 1256
            L Y R+
Sbjct: 415  LFYHRK 420

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 699 LTKIGIERNSKLILHFIDTGT-IDASCLPADNWPTGLNNIGNTCYLNSLLQYYFS 752
           L ++ +E+N        D+G         +  +  GL N+GN+CYLNS++Q  F+
Sbjct: 284 LVELQVEQNMNWDFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFN 338

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
            YDR069C
          Length = 986

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 6/65 (9%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYF 1250
            Y L+ V  H G    GHY  Y+    KNG W  ++D +   +      N  E  T++ Y 
Sbjct: 922  YKLYGVACHFGSLYGGHYTAYVDKGIKNG-WYYFDDTSCRPIK-----NSMEPITSSAYV 975

Query: 1251 LVYVR 1255
            L Y R
Sbjct: 976  LFYKR 980

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757
           TGL N+G TCY+NS+LQ  F+    R
Sbjct: 599 TGLRNLGATCYINSMLQCLFATNMFR 624

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 9/43 (20%)

Query: 720 IDASCLPADNWP-----TGLNNIGNTCYLNSLLQYYFSLAPLR 757
           IDA+    DN P      GL N GNTCY+NS++Q  F    LR
Sbjct: 225 IDAT----DNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLR 263

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL--EYQETMEHFRHHTGNEL 778
           TGL N  NTCY+NS++Q  FS    R   L  +Y+  +E+ ++  G +L
Sbjct: 296 TGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLENEKYPKGLQL 344

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           GL N+GNTCY+NS LQ    L     Y L
Sbjct: 415 GLVNLGNTCYMNSALQCLIHLPKFNEYFL 443

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 12/110 (10%)

Query: 1151 IEQLKQSIADIDQELTSLYHDIAK--LENTIDKQFEEFKKIGYSLFAVFIHRG-EASYGH 1207
            IE++++ I   DQELT     I K  L +   K +   K   Y L  V  H G   S GH
Sbjct: 687  IEKIRKWIR-YDQELT-----IPKEALSSVNAKFYLSGKDTTYRLTGVVYHHGLSPSGGH 740

Query: 1208 YWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTE--GNTATPYFLVYVR 1255
            Y   +  ++++  W + +D  +TE+ + +VF   +   ++ T Y L+Y R
Sbjct: 741  YTADVLHQTQD-KWYRIDDNNVTEIRQEDVFKRGDEASDSKTAYILIYQR 789

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 693 LKLKAALTKIGIERNSKLILHFIDTGTIDASCLPA-DNWPTGLNNIGNTCYLNSLLQYYF 751
           L  +  L ++ +E+N        D+   D   L A D    GL N+GN+CY+NS+LQ  F
Sbjct: 282 LASEKTLVELQVEQNLNWDFKMTDSKGNDLIKLDANDQNGCGLINLGNSCYMNSVLQLLF 341

Query: 752 S 752
           +
Sbjct: 342 N 342

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 698 ALTKIGIERNSKLILHFIDTGTIDASCL-PADNWPTGLNNIGNTCYLNSLLQYYFS 752
           +L ++ +E+N+      +D+   +   L  +  +  GL N+GN+CY+N++LQ  F+
Sbjct: 274 SLVELQVEQNASWDFQMVDSQGHELHHLRSSKRYGCGLLNLGNSCYMNAVLQVLFN 329

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
            Anc_8.188 YDR069C
          Length = 671

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 7/68 (10%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248
            + Y L AV  H G    GHY  Y    S+NG W  ++D     V   E        + + 
Sbjct: 610  VPYKLVAVACHTGTLFSGHYTAYCFKNSENG-WYHFDDTQCKPVSNGECI------SQSA 662

Query: 1249 YFLVYVRQ 1256
            Y L Y +Q
Sbjct: 663  YLLFYQKQ 670

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 25/65 (38%), Gaps = 8/65 (12%)

Query: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248
            I Y L  V  H G  + GHY    K    N  W K+ND  IT V    V           
Sbjct: 401  IIYELIGVICHTGTVNEGHYICSCK--LANNQWVKFNDSMITIVDNETVL------KEQA 452

Query: 1249 YFLVY 1253
            Y L+Y
Sbjct: 453  YLLIY 457

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 25/64 (39%), Gaps = 8/64 (12%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYF 1250
            Y L AV    G  + GHY    K     G W ++ND  I  + E +V           Y 
Sbjct: 393  YELVAVISQEGSVNQGHYTCMCK--VPGGQWFRFNDTMIVSITEEDVLR------QQAYL 444

Query: 1251 LVYV 1254
            L YV
Sbjct: 445  LFYV 448

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVLEY 763
           G  N GNTCY NS+LQ  F L   R  +L++
Sbjct: 123 GYENFGNTCYCNSILQCLFFLDDFRIDILKH 153

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 1183 FEEFKKI-GYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEV 1232
            F E K++ G+S++ +F++ G  + G +W+ IKDRS      K+  + IT +
Sbjct: 1342 FAECKRLLGHSMYRLFVNVGSLTSG-WWLNIKDRSLQAKIEKFVSQFITPI 1391

>ZYRO0C11572g Chr3 complement(899998..907218) [7221 bp, 2406 aa] {ON}
            highly similar to uniprot|P33334 Saccharomyces cerevisiae
            YHR165C PRP8 Component of the U4/U6-U5 snRNP complex
            involved in the second catalytic step of splicing
          Length = 2406

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 6/107 (5%)

Query: 314  LKTINSDN--VVLNSRINPNWLTSKYGFELHVEKDESTGESYFEFEPPNLTNYIEDRKVR 371
            L  I  DN  V + S+ NPN L S  GFE+ +   + T E     E   + + I++R  +
Sbjct: 1230 LTKIKWDNSFVSIYSKNNPNLLFSMCGFEVRILPKQRTNEVISTGE--GVWDLIDERTKQ 1287

Query: 372  RLRESFIRKCIELI--FLGKTAIELLGKDAKTTSKVYRTFNAIQIAF 416
            R  ++F++   E I  F  K    L+G  + T SKV   +N   ++ 
Sbjct: 1288 RTAKAFLKVSQEEIERFDSKIRGILMGSGSTTFSKVASKWNTALLSL 1334

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query: 1191 YSLFAVFIHRG-EASYGHYWVYI--KDRSKNGTWRKYNDETITEVPETEVFNFTE--GNT 1245
            Y L  V  H G  +S GHY   +  +D  K   W + +D T+TE+ + EV    E   ++
Sbjct: 767  YKLTGVVYHHGLSSSGGHYTADVLHQDEEK---WYRIDDTTVTEINKEEVVTGGEEGSHS 823

Query: 1246 ATPYFLVYVR 1255
             T Y L+Y R
Sbjct: 824  RTAYILIYQR 833

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 698 ALTKIGIERNSKLILHFIDT-GTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFS 752
           +L ++ +E+N       +D+ G       P+     G  N+GN+CYLNS+LQ  F+
Sbjct: 298 SLIELQVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFN 353

>KLTH0H02992g Chr8 complement(268190..271054) [2865 bp, 954 aa] {ON}
            similar to uniprot|Q12751 Saccharomyces cerevisiae
            YMR185W Protein required for cell viability
          Length = 954

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 66/169 (39%), Gaps = 30/169 (17%)

Query: 1103 RLKIRQKELLSVNELGLSRKAAY-METINYLKSDLIKSQELKGLNNDFLIEQLKQSIADI 1161
            R +I  +  +S + L       Y + T   LK + I S  LKG              AD+
Sbjct: 136  RFEIHSRHTVSFDTLARVSDVLYGVLTFAPLKENTIGSLLLKG-----------TGFADL 184

Query: 1162 DQELTSLYHDIAKLENTIDKQFEEFKKI--GYSLFAVFIHRGEASYGHYWVYIKDRSKNG 1219
               L  LYH++    N +   FE  + +   Y LF+V           Y + +   SK  
Sbjct: 185  ITALIVLYHEVQSSRNKVSSMFERIENLQETYQLFSV-----------YTLLVHTTSK-A 232

Query: 1220 TWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEHDIEPLKRI 1268
             +R++    ++ +P         G  +   F+V VR+  E D+   KR+
Sbjct: 233  EYRQFVLTKLSTLP----IRRQNGVISLVDFVVGVREDEEIDVTKFKRV 277

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
            YBR058C
          Length = 780

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 1191 YSLFAVFIHRGEASY-GHYWVYI-KDRSKNGTWRKYNDETIT 1230
            Y L AV  H+G +++ GHY  +I K   +   W  YNDE I 
Sbjct: 717  YKLVAVVCHKGNSAHSGHYVAFIRKSVEQEEKWVLYNDEKIV 758

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 693 LKLKAALTKIGIERNSKLILHFIDTGTIDASCLPADN-WPTGLNNIGNTCYLNSLLQ 748
           L  + +L ++ +E+N        D    +   L A+  +  GL N+GN+CY+NS+LQ
Sbjct: 282 LASEKSLVELQVEQNMNWDFQMTDAQGKELKHLSANKEYGCGLINLGNSCYINSVLQ 338

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 733 GLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761
           GL N+G+TC++NS+LQ    +  LR Y L
Sbjct: 352 GLANLGSTCHINSVLQCLTHITELRDYFL 380

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 2/44 (4%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPE 1234
            Y L  +  H G  + GHY    K     G W K+ND  +T + E
Sbjct: 406  YELIGIICHTGTVNEGHYTAICK--IPEGQWIKFNDSMVTIISE 447

>NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49
          Length = 581

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 55/126 (43%), Gaps = 30/126 (23%)

Query: 287 IPTQADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYG--FELHVE 344
           +P +AD      K+F G LN + +E+ LK               N+  SKYG   EL + 
Sbjct: 185 VPVKADISKDNCKMFIGGLNWETTEDGLK---------------NYF-SKYGNVVELKIM 228

Query: 345 KDESTGES----YFEFEPPNL------TNYIEDRKVRRLRESFIRKCIELIFLGKTAIEL 394
           KD +TG S    +  FE P+       T +I D KV   + S  R+  E    GK  +  
Sbjct: 229 KDGATGRSRGFGFLTFENPSSVDEVVKTQHILDGKVIDPKRSIPRE--EQDKTGKIFVGG 286

Query: 395 LGKDAK 400
           +G D +
Sbjct: 287 IGTDVR 292

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
            similarities with uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 7/92 (7%)

Query: 1170 HDIAKLENTIDKQFEEFKK---IGYSLFAVFIHRG-EASYGHYWVYIKDRSKNGTWRKYN 1225
            H++A  + TI      F K     Y L  V  H G   S GHY   +   + N  W + +
Sbjct: 690  HELAIPDATISSVHSSFYKEAGTNYKLIGVVYHHGVSPSGGHYTCDVYQETLN-KWYRID 748

Query: 1226 DETITEVPETEVF-NFTEGN-TATPYFLVYVR 1255
            D  + E+ + EV     EGN + T Y L+Y +
Sbjct: 749  DTNVQEIEKDEVLKGGEEGNDSRTAYILIYQK 780

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 698 ALTKIGIERNSKLILHFIDT-GTIDASCLPADNWPTGLNNIGNTCYLNSLLQ 748
           +L ++ IE+N       +D  G       P+     GL N+GN+CYLNS++Q
Sbjct: 307 SLIELQIEQNMNWDFKMVDAQGRSLLRLSPSKGLGCGLINLGNSCYLNSVMQ 358

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
            Anc_8.188 YDR069C
          Length = 978

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 6/71 (8%)

Query: 1185 EFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGN 1244
            + K   Y L+ V  H G    GHY  Y+     NG W  ++D T   +      N  E  
Sbjct: 909  QIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGNG-WYYFDDTTYRPLK-----NDKEPI 962

Query: 1245 TATPYFLVYVR 1255
            +++ Y L Y R
Sbjct: 963  SSSAYVLFYTR 973

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 2/55 (3%)

Query: 1184 EEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            E    I Y L  V  H G  + GHY   ++  S  G W K+ND  I+ V   +V 
Sbjct: 389  EPTTSIVYRLSGVVSHSGTVNEGHYTAVLQLNS--GEWFKFNDSMISVVSAEDVL 441

>NCAS0B02730 Chr2 complement(459931..464904) [4974 bp, 1657 aa] {ON}
            Anc_8.442 YDR227W
          Length = 1657

 Score = 33.1 bits (74), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 19/92 (20%)

Query: 803  DLFQAMIYSKERCVTPRKELAYLAFAPSNFEV----EFEPTTVNAQHEVSKIAESTNNDI 858
            D+FQ++  S +R      + + ++F P+  E      F P   NA+ EV  I++S +N+I
Sbjct: 961  DVFQSIYSSHQRH---HLKGSVISFTPTEKEKMKFESFTPLGQNAKMEVIYISDSDDNNI 1017

Query: 859  LMYGPTNRSDNDQTGPIELD--SDSGNEDIDV 888
            L          D  GP ++D  SD+G +DI++
Sbjct: 1018 L----------DDAGPADIDEISDTGFDDIEI 1039

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 32.3 bits (72), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 1191 YSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVF 1238
            Y L A+  H G    GHY      R     W K+ND  +T + E ++ 
Sbjct: 409  YKLSAIISHHGTVHQGHYTTIC--RINGDIWAKFNDSMVTVISEEDML 454

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 137,981,664
Number of extensions: 6442787
Number of successful extensions: 25952
Number of sequences better than 10.0: 406
Number of HSP's gapped: 26894
Number of HSP's successfully gapped: 534
Length of query: 1272
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1151
Effective length of database: 39,606,813
Effective search space: 45587441763
Effective search space used: 45587441763
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)