Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D018801.319ON69169137210.0
ZYRO0G20680g1.319ON69269714770.0
Smik_10.1791.319ON71370813810.0
Suva_6.1371.319ON71871113371e-175
YJL061W (NUP82)1.319ON71370813351e-175
NCAS0A092101.319ON71071713011e-170
Skud_10.1581.319ON71670412641e-164
KAFR0A017201.319ON71671012141e-157
NDAI0G057501.319ON73473212051e-155
TBLA0F013101.319ON74271211231e-143
SAKL0D06930g1.319ON69070710931e-139
Kpol_1035.241.319ON71771110621e-134
KNAG0C058401.319ON74771810511e-132
KLTH0H10692g1.319ON6917148921e-109
Kwal_14.25801.319ON6877038821e-108
TPHA0O014601.319ON7217188821e-107
CAGL0J05214g1.319ON7167028219e-99
Ecym_62901.319ON6716967429e-88
AEL168C1.319ON6737036353e-72
KLLA0F01661g1.319ON6877044951e-52
KNAG0D043404.238ON2220266734.2
NDAI0J004107.516ON581124708.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D01880
         (691 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...  1437   0.0  
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   573   0.0  
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...   536   0.0  
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...   519   e-175
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...   518   e-175
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   505   e-170
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...   491   e-164
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   472   e-157
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   468   e-155
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   437   e-143
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   425   e-139
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   413   e-134
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   409   e-132
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   348   e-109
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   344   e-108
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   344   e-107
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   320   9e-99
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   290   9e-88
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   249   3e-72
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   195   1e-52
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    33   4.2  
NDAI0J00410 Chr10 (71104..72849) [1746 bp, 581 aa] {ON} Anc_7.51...    32   8.5  

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score = 1437 bits (3721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/691 (100%), Positives = 691/691 (100%)

Query: 1   MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFK 60
           MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFK
Sbjct: 1   MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFK 60

Query: 61  DVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFVSDEARIKQVLFHP 120
           DVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFVSDEARIKQVLFHP
Sbjct: 61  DVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFVSDEARIKQVLFHP 120

Query: 121 LAYQQETVVILKDDDSITIMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECITFSQDGLT 180
           LAYQQETVVILKDDDSITIMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECITFSQDGLT
Sbjct: 121 LAYQQETVVILKDDDSITIMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECITFSQDGLT 180

Query: 181 LYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIKQL 240
           LYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIKQL
Sbjct: 181 LYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIKQL 240

Query: 241 KFVSGLHKQQNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLPINDQNELL 300
           KFVSGLHKQQNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLPINDQNELL
Sbjct: 241 KFVSGLHKQQNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLPINDQNELL 300

Query: 301 IMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIVVGDHKYGQFS 360
           IMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIVVGDHKYGQFS
Sbjct: 301 IMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIVVGDHKYGQFS 360

Query: 361 VMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPKSVAWWNTTPQ 420
           VMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPKSVAWWNTTPQ
Sbjct: 361 VMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPKSVAWWNTTPQ 420

Query: 421 SVVKVSNREVKSKQVSEGVSKQDDDITGSRQEPEKYNAHYSQPIAEIMQLNQKFQLESSK 480
           SVVKVSNREVKSKQVSEGVSKQDDDITGSRQEPEKYNAHYSQPIAEIMQLNQKFQLESSK
Sbjct: 421 SVVKVSNREVKSKQVSEGVSKQDDDITGSRQEPEKYNAHYSQPIAEIMQLNQKFQLESSK 480

Query: 481 APSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTLGVTLHNRIYEQQLDLT 540
           APSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTLGVTLHNRIYEQQLDLT
Sbjct: 481 APSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTLGVTLHNRIYEQQLDLT 540

Query: 541 HQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKFKDNLGQIQNSQRFKDL 600
           HQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKFKDNLGQIQNSQRFKDL
Sbjct: 541 HQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKFKDNLGQIQNSQRFKDL 600

Query: 601 EISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRIAQVTGDQNSQARDEWH 660
           EISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRIAQVTGDQNSQARDEWH
Sbjct: 601 EISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRIAQVTGDQNSQARDEWH 660

Query: 661 ELRHMLEEDTIILQDCNNQLKSAARQVPAQP 691
           ELRHMLEEDTIILQDCNNQLKSAARQVPAQP
Sbjct: 661 ELRHMLEEDTIILQDCNNQLKSAARQVPAQP 691

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/697 (44%), Positives = 437/697 (62%), Gaps = 19/697 (2%)

Query: 1   MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFK 60
           M++ +H IF+    A   S RF  T+ DG + V+ QDS IRWCN  +  Y  M LE   +
Sbjct: 1   MSIGSHSIFK---RASGSSKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIE 57

Query: 61  DVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFVSDEAR---IKQVL 117
           DV+HVV+S +G  L LYN  E+RI+E+PW Y++VS     FQ FR+  D  +   IK+VL
Sbjct: 58  DVEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVS--YEGFQKFRYSVDSRQDPLIKKVL 115

Query: 118 FHPLAYQQETVVILKDDDSITIMNWQDFGDSKPD--VLNLSNGTYSLDSSITDVECITFS 175
           FHPLAY++  +VILK D++I +++     D +P   VLN  +G + ++  +TD+E ITFS
Sbjct: 116 FHPLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFS 175

Query: 176 QDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRN 235
           QDGLTLY LSV+EG DIYAFYPCL   ++ D   LD LM+KSL+QY+ L+V T    KRN
Sbjct: 176 QDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRN 235

Query: 236 TIKQLKFVSGLHKQ-QNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLPIN 294
           TIKQ +F+S L +  +N Q  ++IP    +VRGQGPFTIAPFP + Y  T   +  LPI 
Sbjct: 236 TIKQFQFISKLRQGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPIG 295

Query: 295 DQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIVVGDH 354
             N+LL+MS DDG I +L QDL++TM WDS  Y+YNNS  LVE I L   E  ++V+   
Sbjct: 296 ANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRL---ERGELVLKQG 352

Query: 355 KYGQFSVMT-PEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPKSVA 413
              QF V+     ++ +DTS WS ++++C+  SDL P+A+ + +SE++  E      S A
Sbjct: 353 TLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYA 412

Query: 414 WW--NTTPQSV-VKVSNREVKSKQVSEGVSKQDDDITGSRQEPEKYNAHYSQPIAEIMQL 470
            W  +T P+ V V      VKS  V++  S   D+   +   P +Y    +QP++EI+ L
Sbjct: 413 MWKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDEKKANVDIP-RYEVALNQPMSEILSL 471

Query: 471 NQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTLGVTLHN 530
           N  FQ E+ K  SK++ P +RQ  L NE++E QL++LT  SK+F+ KI   Q LG  LHN
Sbjct: 472 NASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHN 531

Query: 531 RIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKFKDNLGQ 590
           R  EQQ +LT QL+ S E++ KQ  + +   SQSS  ++   R   L+ RFN   + LG+
Sbjct: 532 RCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGR 591

Query: 591 IQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRIAQVTGD 650
           I  S +F+++ I+ +E+ WFKEIR QVL FN+ VH+QK  QDQL +L++E+  I+    D
Sbjct: 592 INESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKD 651

Query: 651 QNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQV 687
              +++ EW EL  +LE DT I+++CNNQL  A+ +V
Sbjct: 652 VGEKSKSEWTELLSILESDTKIIKECNNQLAHASSEV 688

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/708 (40%), Positives = 445/708 (62%), Gaps = 31/708 (4%)

Query: 7   PIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNV-SEPGYHSMTLER--AFKDVK 63
           PIF+ SL+A S S R+  T+ +G R V +QD+ IRW NV ++P YHS++L R     D  
Sbjct: 11  PIFQASLSA-SQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVLDDTF 69

Query: 64  HVVMSNSGEFLCLYNDDELRIIEVPWAYTEVS--SMANAFQLFRFVSDEAR------IKQ 115
           HV+ S SG+ LC +ND E+ ++EVPW Y+ V   S+ +AFQ+F +  DE        IK+
Sbjct: 70  HVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIKK 129

Query: 116 VLFHPLAYQQETVVILKDDDSIT---IMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECI 172
           VLFHP +Y    +V+LK++D+I    I+N Q+    KP +LN  N ++ LD+ + D+  +
Sbjct: 130 VLFHPKSYHDSCIVVLKENDTIIMFDILNQQE----KPIILNKPNNSFGLDARLNDITDL 185

Query: 173 TFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEV 232
            FS+DGLTLY L+ +EG DI+AFYP L   +  ++  L  ++ KSL+ Y+ L+  TD  V
Sbjct: 186 VFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDVTV 245

Query: 233 KRNTIKQLKFVSGLHKQQNSQ-RILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASL 291
           KRN IKQL+FVS LH+  +S+   ++I    R V+ QGPFTI PFP ++Y  T   IA++
Sbjct: 246 KRNIIKQLQFVSKLHENWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAKNIATI 305

Query: 292 PI-NDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIV 350
            I N QNE+  +S DDG++ +LL+DL+++M+WD   Y YN+S  L+E + +  +EI+ ++
Sbjct: 306 SIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKM-QKEIESLI 364

Query: 351 VGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPK 410
               + G+  V +   V+ ++++ W+  ++ C+ ESDL PL + K ES++      +   
Sbjct: 365 TLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATVEGMP 424

Query: 411 SVA--WWNTTPQSVVKVSNREVKSKQVSEGVSKQDDDITGSRQEPE------KYNAHYSQ 462
           ++A  +WN T  ++   SN+E+  + VS     Q  +        E      +Y   ++Q
Sbjct: 425 NLAHIYWNNTS-NLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYELRFTQ 483

Query: 463 PIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQ 522
           P++EI+ LN+ FQ        ++IP  +RQ PLKNEASE QL++ T+ SK+F+ KIA  Q
Sbjct: 484 PLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIAKAQ 543

Query: 523 TLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFN 582
           +LGV+++NRI+EQQL+LT QL+++ +++ K   +   F +Q+ + DA   R S LM RF+
Sbjct: 544 SLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLMERFS 603

Query: 583 KFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMN 642
           K  +NL +I  S +FK+  IS  E+EWFKEIR Q+L FN  VH+QK LQ  L +LK+E+ 
Sbjct: 604 KLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKRELT 663

Query: 643 RIAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQVPAQ 690
           RI   T   + +++ EW+ELR MLE D+ I+++CN +L+ A++Q+  +
Sbjct: 664 RIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTK 711

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score =  519 bits (1337), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 273/711 (38%), Positives = 437/711 (61%), Gaps = 32/711 (4%)

Query: 7   PIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNV-SEPGYHSMTLER--AFKDVK 63
           PIF+ SL+A + S R+  ++ +G R VV+QD  IRWC++ ++P YHS+   R     D  
Sbjct: 11  PIFQASLSA-NQSPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNFSRHLVLDDTF 69

Query: 64  HVVMSNSGEFLCLYNDDELRIIEVPWAYTEVS--SMANAFQLFRFVSDE------ARIKQ 115
           H + S SG+ LC Y+D E+ ++E+PW Y  +   S+ +AFQ+F +  DE      + IK+
Sbjct: 70  HAISSASGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQVFHYSVDELELGSNSPIKK 129

Query: 116 VLFHPLAYQQETVVILKDDDSIT---IMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECI 172
           VLFHP +Y    +V+LK+DD+IT   I+N Q+     P +LN  N ++ LD+ + D+   
Sbjct: 130 VLFHPKSYNDSCIVVLKNDDTITMFDILNQQE----APIILNKRNSSFGLDARVNDITDF 185

Query: 173 TFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEV 232
            FS+DGLTLY L+ +EG DI+AFYP L   +   ++ L  ++ KSL+ Y+ LN  TD +V
Sbjct: 186 AFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESLNATTDYKV 245

Query: 233 KRNTIKQLKFVSGLHKQQNSQRI-LEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASL 291
           KRN  KQL+FVS LHK  +S+   ++I +  R V+ QGPFTI PFP ++Y  T + I ++
Sbjct: 246 KRNITKQLQFVSKLHKNWDSKLAKVKIDDEYRLVKMQGPFTINPFPNELYDFTASKITTI 305

Query: 292 PI-NDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIV 350
           PI N QNE++ +S DDG++ IL QDL+++M+WD   Y YNNS  L+E I L  +E++ + 
Sbjct: 306 PIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVYNNSLILIERIKLQQKEMKSLT 365

Query: 351 VGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPK 410
               + G+  V     V  +D + W+ V++ C+ ESDL  LA+ K  S+           
Sbjct: 366 ALPDQLGKLYVTLESSVHQLDCTSWTSVLSKCIDESDLNALADVKFVSKFEDIATIHQLS 425

Query: 411 SVAWWNTTPQSVVKVSNREV---------KSKQVSEGVSKQDDDITGSRQEPEK--YNAH 459
           + A+ N   +S + + ++E          K +Q     ++ D ++   + +  K  Y   
Sbjct: 426 NFAYINWNDKSSLALISKEKLTIQNISNHKKEQSLNAPAELDTNVNSDKSDTGKRGYEIS 485

Query: 460 YSQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIA 519
           ++QPI EI+ LN+ FQ        ++IPP +RQ PLKNEA+E QL++ T+ SK+F+ KI 
Sbjct: 486 FTQPINEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIFTDISKEFLRKII 545

Query: 520 VGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMS 579
             Q+LGV+++NRI+EQQ +LT QL+++ +++ K + +     +Q+ + ++  +R + LM+
Sbjct: 546 KAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKWNSQSSRQAELMT 605

Query: 580 RFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQ 639
           RF K  +NL ++  S +FK+  IS  E+EWFKEIR Q+L FN  VH+QK +Q  L +LK+
Sbjct: 606 RFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQKSIQQDLSYLKR 665

Query: 640 EMNRIAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQVPAQ 690
           E+ RI   T + + ++++EW ELR MLE D+ I+++CN +L   ++Q+  +
Sbjct: 666 ELIRIESETINADKKSQNEWDELRKMLEVDSKIIKECNEELVHVSQQLTTK 716

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score =  518 bits (1335), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 282/708 (39%), Positives = 440/708 (62%), Gaps = 39/708 (5%)

Query: 7   PIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNV-SEPGYHSMTLER--AFKDVK 63
           PIF+ SL+A S S R+  ++ +G R V +QD+ IRW NV ++  YHS+   R     D  
Sbjct: 11  PIFQASLSA-SQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTF 69

Query: 64  HVVMSNSGEFLCLYNDDELRIIEVPWAYTEVS--SMANAFQLFRFVSDE------ARIKQ 115
           HV+ S SG+ LCL+ND+E+ ++EVPW Y+ V   S+ +AFQ+F +  DE      + IK+
Sbjct: 70  HVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKK 129

Query: 116 VLFHPLAYQQETVVILKDDDSIT---IMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECI 172
           VLFHP +Y+   +V+LK+DD+IT   I+N Q+    KP VLN  N ++ LD+ + D+  +
Sbjct: 130 VLFHPKSYRDSCIVVLKEDDTITMFDILNSQE----KPIVLNKPNNSFGLDARVNDITDL 185

Query: 173 TFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEV 232
            FS+DGLTLY L+ +EG DI+AFYP L   +  +++ L+ ++ KSL+ Y+ L+  TD  V
Sbjct: 186 EFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTDVIV 245

Query: 233 KRNTIKQLKFVSGLHKQQNSQ-RILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASL 291
           KRN IKQL+FVS LH+  NS+   ++I +  R  + QGPFTI PFP ++Y  T T IA++
Sbjct: 246 KRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATI 305

Query: 292 PI-NDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIV 350
            I N QNE++ +S DDG++ +L +DL+++M+WD   Y YNNS  L+E + L  +EI+ ++
Sbjct: 306 LIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKL-QREIKSLI 364

Query: 351 VGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPK 410
               + G+  V++   +  ++   W+  ++ C+ ESDL PLA  K ES++      +   
Sbjct: 365 TLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERIP 424

Query: 411 SVAWWNTTPQS-VVKVSNREVKSKQVSE-----------GVSKQDDDITGSRQEPEKYNA 458
           ++A+ N   QS +  +SN+ +  + +S             +S +  D  G     + +  
Sbjct: 425 NLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVG-----DGFKM 479

Query: 459 HYSQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKI 518
            ++QPI EI+ LN  FQ        ++IP  +RQ PLKNEASE QL++ T+ SK+F+ +I
Sbjct: 480 SFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRI 539

Query: 519 AVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLM 578
              QTLGV++HNRI+EQQ +LT QL+++ +++ K   +   F +Q+ + DA  +R S LM
Sbjct: 540 VKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELM 599

Query: 579 SRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLK 638
            RF+K    L QI  S +FK+ +IS  E++WFKEIR Q+L FN  VH+QK LQ  L +LK
Sbjct: 600 ERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLK 659

Query: 639 QEMNRIAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQ 686
            E+ RI   T   + ++++EW ELR MLE D+ I+++CN +L   +++
Sbjct: 660 SELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQE 707

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  505 bits (1301), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 272/717 (37%), Positives = 427/717 (59%), Gaps = 49/717 (6%)

Query: 2   TVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFKD 61
           ++ +HPIF+     Q  + RF  T+  G R VV+Q   +RWC+V+   ++SMT++    +
Sbjct: 6   SIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQPE 65

Query: 62  V---KHVVMSNSGEFLCLYNDDELRIIEVPWAY-TEVSSMANAFQLFRFVSDE----ARI 113
               +  ++SNSGEF+C+Y +  + +IE+PW Y T   SM + FQLF + + +    + I
Sbjct: 66  STAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPI 125

Query: 114 KQVLFHPLAYQQETVVILKDDDSITIMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECIT 173
           KQVLFHP AY+   +V+L D+ +I++M+      +K   LN    T+ +D+ ITD+E I 
Sbjct: 126 KQVLFHPEAYKDSCLVVLYDNGTISLMDVTQI--TKTITLNKRVATFGIDTQITDIESIC 183

Query: 174 FSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVK 233
           FS+DG TLY LS+S+G DIYAFYPCL  +++  ++ +  L+++S++ Y+ L + TD +VK
Sbjct: 184 FSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDVK 243

Query: 234 RNTIKQLKFVSGLH------KQQNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTG 287
           RN I+Q++FV+ L+      ++ +++  +EI +  R +RGQGPFTI P+P+++YS+T   
Sbjct: 244 RNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSATALE 303

Query: 288 IASLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQ 347
           I++LPIN  NEL+ M  DDG+IA+L +DL +TM+WD   Y +NNSF+LVEL+ L   +++
Sbjct: 304 ISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDTDVK 363

Query: 348 QIVVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKD 407
           +IV     YGQF +     +F + T  WS ++A  +  S+L  L E    S++ F E   
Sbjct: 364 RIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFE--- 420

Query: 408 SPKSVAWWNTTPQSVVKVSNREVKSKQVSEGVSKQD----------DDITGSRQ------ 451
                     T   + K S  + + + V   ++K+D            I G+ +      
Sbjct: 421 ----------TTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNN 470

Query: 452 ---EPEKYNAHYSQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLT 508
              + ++Y   + QP+ E+M LN+ FQ + S   SK+I P ERQ  L NE +E+QL+LL+
Sbjct: 471 EELKHQEYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNEVQLELLS 530

Query: 509 EASKDFVSKIAVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSD 568
           + SK+ +SKI  GQ L + LH+R+ EQQ +LT QLK    +M KQ  +      QS R D
Sbjct: 531 DVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWD 590

Query: 569 AVHARHSTLMSRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQK 628
              +R S L+ R       + +I NS + K+  I+ +E+EWFKEIR QVL FN  VHNQ+
Sbjct: 591 DQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQR 650

Query: 629 RLQDQLIHLKQEMNRIAQVTGDQNSQARD-EWHELRHMLEEDTIILQDCNNQLKSAA 684
             Q++L HLK+++ RI++ T     +  D EW ELR +L+ D  I+Q+CN +L S  
Sbjct: 651 DAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLSTT 707

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score =  491 bits (1264), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 275/704 (39%), Positives = 427/704 (60%), Gaps = 29/704 (4%)

Query: 7   PIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCN-VSEPGYHSMTLER--AFKDVK 63
           PIF+ SL+A S S  +  ++ +G R V +QD+ IRWCN ++E  Y S+   R     D  
Sbjct: 11  PIFQASLSA-SQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTF 69

Query: 64  HVVMSNSGEFLCLYNDDELRIIEVPWAYTEV--SSMANAFQLFRF----VSDEAR--IKQ 115
            V+ S SG+ L  +N  E+ ++EVPW Y  +  +S+ +AFQLF +    V + +R  IK+
Sbjct: 70  RVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKK 129

Query: 116 VLFHPLAYQQETVVILKDDDSIT---IMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECI 172
           VLFHP +Y    +V+LK+DD+IT   I+N Q     KP VLN  + ++ LD+ + D+  +
Sbjct: 130 VLFHPKSYHDSCIVVLKEDDTITMFDILNQQ----HKPIVLNKRSNSFGLDARVNDITDL 185

Query: 173 TFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEV 232
            FS+DGLTLY L+ +EG D++AFYP L P +   ++ L  ++ KSL+ Y+ L+  TD  V
Sbjct: 186 AFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITV 245

Query: 233 KRNTIKQLKFVSGLHKQQNSQR-ILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASL 291
           KRN IKQL+ VS LH+  +SQ   +EI E  R V+ QGPFTI PFP ++Y  T   I ++
Sbjct: 246 KRNIIKQLQLVSKLHENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAANITTI 305

Query: 292 PI-NDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIV 350
           PI N QNE++ +  DDG++ +L QDL+++M+WD   Y +NNS  L+E I +   +I+ + 
Sbjct: 306 PIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETDIKSLK 365

Query: 351 VGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPK 410
               + G+  V +   V  +D++ WS +++ C+ ESDL  L + K ES++      + P 
Sbjct: 366 TLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVTIEHPS 425

Query: 411 SVAW--WNTTPQSVVKVSNREVKSKQVSEG----VSKQDDDITGSRQEPEK-YNAHYSQP 463
           ++A+  WN T   V+    + +  + +S       +K D +    R +  K Y   ++QP
Sbjct: 426 NLAYISWNDTSNLVLTARGK-LTFQNISNDKELQTTKFDANNKSDRIDAGKHYEMSFTQP 484

Query: 464 IAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQT 523
           I EI+ LN+ FQ        K+IPP  RQ PLKNEASE QL++ T  SK+F+ KI   Q+
Sbjct: 485 INEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKIIKAQS 544

Query: 524 LGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNK 583
           LG +++NRI EQQ +LT QL+A+ +++ K   +     +Q+ + DA  +R   LM RF K
Sbjct: 545 LGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLMERFKK 604

Query: 584 FKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNR 643
             +NL QI  S++ ++  I++ E++WFKEIR Q+L FN  V +QK LQ  L ++K+E+ R
Sbjct: 605 LTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMKKELTR 664

Query: 644 IAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQV 687
           I   T   + + ++EW ELR MLEED+ I+++CN +L   ++Q+
Sbjct: 665 IEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQL 708

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  472 bits (1214), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 268/710 (37%), Positives = 419/710 (59%), Gaps = 32/710 (4%)

Query: 3   VETHPIFRPSLTAQSGS-DRFFLTTSDGGRAVVVQDSCI------RWCNVSEPGYHSMTL 55
           +E  PIF+ SL++   + +R F         ++ QDS I      RW +V+   YHS+ L
Sbjct: 16  LENRPIFKTSLSSSLLNSERSF------SLPILAQDSSIYKKNQLRWGSVASSQYHSLPL 69

Query: 56  ERAFKD--VKHVVMSNSGEFLCLYNDDELRIIEVPWAY-TEVSSMANAFQ-LFRFVSDEA 111
              F D   ++V++SNSG+FLCLY+   L +IE+PW Y   V+S+ ++FQ +FR V+  +
Sbjct: 70  -LFFDDSAYENVIISNSGQFLCLYDKKSLSLIEIPWGYDGAVTSIKSSFQRVFRDVNKSS 128

Query: 112 RIKQVLFHPLAYQQETVVILKDDDSITIMNWQDFGDSKPDVLNLSNGTYSLDSSITDVEC 171
            IK++LFHP A     VVIL ++D I +    D   S+   LN +     +++ +TD+E 
Sbjct: 129 DIKKILFHPKAADDGCVVILFENDVICLF---DLRKSEKLFLNKTANKLGIETRVTDIED 185

Query: 172 ITFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSE 231
           + FSQDGLTLY+LSV++G DIYAFYPCL P++   K  L+ L  KS I YD L+     E
Sbjct: 186 MEFSQDGLTLYMLSVTDGGDIYAFYPCLPPKLSLKKSVLEDLFNKSRILYDSLDSTVSIE 245

Query: 232 VKRNTIKQLKFVSGLH---KQQNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGI 288
           V++N +KQ+KF++ L      +     LEI    RQV+ QGPFT+AP+P+++Y +T   I
Sbjct: 246 VRKNVLKQIKFIASLRDSSSDETKNSCLEISNDFRQVKAQGPFTVAPYPEKLYEATAKEI 305

Query: 289 ASLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQ 348
            +L I + NEL  ++ D+G + +LL+DL+++M+W++  Y YNNSF L+E + +G + I+ 
Sbjct: 306 YTLDIGNNNELFAITFDNGTVTLLLKDLELSMSWNADNYVYNNSFVLIESVEMGPESIKL 365

Query: 349 IVVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDS 408
           +         F       V  IDT+ WS  ++ C+T SDL  L +   +S+++  ++K++
Sbjct: 366 LKSSSLTGQMFISQNHSSVRKIDTTAWSFKVSKCITNSDLTSLIDVDFKSKISDLDIKEN 425

Query: 409 PKSVAWWNTTPQ-SVVKVSNREVKSKQVSEGVSK---QDDDITGSR--QEP--EKYNAHY 460
                 W+   +  ++ VSN  V S+ + E  S    + D+++ S+  ++P  +KY   +
Sbjct: 426 VDCYGVWSLRGERGILFVSNSSVISRTLPESDSSFVIKLDEMSRSKNIEDPVTKKYEVSF 485

Query: 461 SQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAV 520
           +QPI+EIM LN  FQ        K+I P ERQ  L N+++E QL  LTE S D VS I  
Sbjct: 486 TQPISEIMNLNDSFQRICRHPFKKIISPEERQTVLSNDSNETQLATLTEISNDLVSNIVE 545

Query: 521 GQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSR 580
           GQ+LG+ L NR+YEQQ +LT QLK S +L+EKQ  + + +  +  R +    +   L+ R
Sbjct: 546 GQSLGLVLRNRLYEQQYELTKQLKESIQLIEKQSLLKSSYDDKMVRWNKNLKKQDELIQR 605

Query: 581 FNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQE 640
           FN    NL +I  S+      IS++EVEWFKE+R Q+L FN  VH  + +Q+Q+  L++ 
Sbjct: 606 FNALNGNLAKIHESKEISKTPISEKEVEWFKEVRNQILKFNDFVHVHRNMQEQINFLRKG 665

Query: 641 MNRIAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQVPAQ 690
           ++RI    G ++S    EW E + +LE DT I+++CN +L  A  Q+ A+
Sbjct: 666 LSRIESKVGQRSSHLTSEWAEFKKILETDTNIIKECNEELTKAHTQLDAE 715

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  468 bits (1205), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 264/732 (36%), Positives = 418/732 (57%), Gaps = 54/732 (7%)

Query: 3   VETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFKDV 62
           + +HPIF  S+     S RFF T+  G R V++Q   ++WCNV +  YHSM ++  F + 
Sbjct: 8   IASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFNNK 67

Query: 63  KHVV---MSNSGEFLCLYNDDELRIIEVPWAYTEV-SSMANAFQLFRF--------VSDE 110
           + ++   +S SG+FLC+Y    + I+E+PW Y ++   + + FQ F +        +S  
Sbjct: 68  RKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDISSSTSALSSP 127

Query: 111 ARIKQVLFHPLAYQQETVVILKDDDSITIMNWQDFGDSKPDVLNLSNGTYSLDSSITDVE 170
           + IKQVLFHP +Y +  +VIL +D  I +++      ++   +N   GT  +++ + D+E
Sbjct: 128 SDIKQVLFHPKSYHETCLVILYEDSIIQLIDTT--ASTETITINQPTGTLGVETRVIDIE 185

Query: 171 CITFSQD-GLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTD 229
            I F +  GL LY LS+S+G DIYA YPCL  R+   K+ +D L+ KS++ YD L     
Sbjct: 186 SICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKENMS 245

Query: 230 SEVKRNTIKQLKFVSGL------------------HKQQNSQRILEIPEAQRQVRGQGPF 271
           ++VKRN IKQL+F + L                  H Q++ + IL++    R V  QGPF
Sbjct: 246 NDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQGPF 305

Query: 272 TIAPFPKQIYSSTGTGIASLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNN 331
           TI+PFP ++YS+T      + IN+ NELLIM+ DDG++A+L +DL++TM+WD A Y ++N
Sbjct: 306 TISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIANYIHDN 365

Query: 332 SFALVELITLGSQEIQQIVVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPL 391
           SFALVELI L   +I ++++    +G+F +++ + +  + T+ WS  +A  + +S+L  L
Sbjct: 366 SFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDSNLNIL 425

Query: 392 AETKLESEVTFTELKDSPKSVAWWNTTP------QSVVKVSNREVKSKQVSEGVSKQDDD 445
           +E   ESE+T+ ++        + N TP      +S++ VS+  V  + +++  S   ++
Sbjct: 426 SEIGFESEITWFDVMG-----KFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSM--NN 478

Query: 446 ITGS-------RQEPEKYNAHYSQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNE 498
           I GS            +Y   + QPI E+M LN+ FQ +     SK+I P +RQ  L NE
Sbjct: 479 IKGSSTSNSNEETAESEYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNE 538

Query: 499 ASEIQLDLLTEASKDFVSKIAVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILT 558
           ++EIQL++LT+ SK+ ++KI  GQTLG  LHNR+ EQQL+LT QLK +  + EKQ  I  
Sbjct: 539 SNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKN 598

Query: 559 HFHSQSSRSDAVHARHSTLMSRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVL 618
                  R +    R   L  R     + L  I +S       I+  E+EWFKEIR QV 
Sbjct: 599 KNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVH 658

Query: 619 TFNRDVHNQKRLQDQLIHLKQEMNRIAQ-VTGDQNSQARDEWHELRHMLEEDTIILQDCN 677
            FN  VH Q+   ++L  LK+E++RI+  VT   + +++ EW ELR +LE+D+ I+++CN
Sbjct: 659 KFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECN 718

Query: 678 NQLKSAARQVPA 689
            +L      +  
Sbjct: 719 IELTKTTESMAG 730

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  437 bits (1123), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 259/712 (36%), Positives = 393/712 (55%), Gaps = 36/712 (5%)

Query: 5   THPIFRP---SLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFKD 61
           +HPIF+    S + Q  S RFF TT+   R VVVQD  IRWC      YHS T+     D
Sbjct: 17  SHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRNFD 76

Query: 62  VKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEV--SSMANAFQLFR--FVSDEARIKQVL 117
           +K  ++SNSG F+C Y+D ++ I+E+PW+++    +S ++  Q +R  F      +KQVL
Sbjct: 77  IKDSLISNSGSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQKYRYSFKKYSLTVKQVL 136

Query: 118 FHPLAYQQETVVILKDDDSITIMNWQDFGD--SKPDVLNLSNGTYSLDSSITDVECITFS 175
           FHPLA  +  +V+L  DD+I  +++    D  S   +LN  + +  L S I+D++ +TFS
Sbjct: 137 FHPLATLESCLVVLLSDDTIVFIDFSKSFDLLSSDYILNKKSKSIGLSSQISDIQSLTFS 196

Query: 176 QDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRN 235
           QDGLTLY LS S   D+YAFYPCL P  QF  + L+ L+ KS++QY+ L     + +K N
Sbjct: 197 QDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALKIN 256

Query: 236 TIKQLKFVSGLHKQQNSQRILE-----------IPEAQRQVRGQGPFTIAPFPKQIYSST 284
            IKQLKF S L+K+   +R LE           +P   R +R QGPFTI+PFP  +Y S+
Sbjct: 257 IIKQLKFTSDLYKK--GKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLYYSS 314

Query: 285 GTGIASLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQ 344
            T I S+PI+  NELL++S  DG++  L QDL++TM+WD   +N NNS  L+ELI    Q
Sbjct: 315 PTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKEQ 374

Query: 345 EIQQIVVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVT-FT 403
            I+++    H+YG F ++     F + TS WS  +A C+  SD+R L+   ++S +  F 
Sbjct: 375 NIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPFD 434

Query: 404 ELKDSPKSVAWWNTTPQSVVKVSNREVKSKQVSEGVSKQDDDITG--SRQEPEKYNAHYS 461
                  S  WW +   S +   N+    +   +      DD T   + +  +KY     
Sbjct: 435 NAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKLLLSDDTTHLLTSELAQKYIPPLE 494

Query: 462 QPI-----------AEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEA 510
             I           +++  +N  F+ ES+K  +  IP +ER   L N+ +E QL+ LT+ 
Sbjct: 495 DKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLETLTKI 554

Query: 511 SKDFVSKIAVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAV 570
           SK    KI++GQ+LG  ++N+I +QQ  +  QL+ +  L+EK++ + T ++ Q+ +  A 
Sbjct: 555 SKVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQRLLEKEKILNTKYNEQADKLRAF 614

Query: 571 HARHSTLMSRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRL 630
             R   LMSR     + L +        ++ ISK+E+E+FKEIRKQVL FN  VH QK  
Sbjct: 615 TERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVHKQKDQ 674

Query: 631 QDQLIHLKQEMNRIAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKS 682
            D L+ +K+E+ RI       +     +W  LR ML +D   ++ C   +K+
Sbjct: 675 HDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESIKN 726

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  425 bits (1093), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 255/707 (36%), Positives = 404/707 (57%), Gaps = 41/707 (5%)

Query: 1   MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFK 60
           M+ E HPIF+     +    +  LTT DG R VV+Q   IR C+     Y    +E    
Sbjct: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQ--IIECGIN 58

Query: 61  DVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRF-VSDEARIKQVLFH 119
            V    ++NSG  LC YN+ EL++I +P  +  VSS     +   + ++ ++ IKQV +H
Sbjct: 59  TVAGAALNNSGTLLCAYNETELQVIVLPSPF--VSSHGGILKPHTYNITVKSPIKQVQWH 116

Query: 120 PLAYQQETVVILKDDDSITIMNWQDFGDSKPD-VLNLSNGTYSLDSSITDVECITFSQDG 178
           P        V+L  DD+I +    +    +P  VLN       + S ITD+E + FS+DG
Sbjct: 117 PRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDG 176

Query: 179 LTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIK 238
           L LY+L+ SEG D+YA YP L   +   +Q L+   YKS I Y+ L+      VKRN IK
Sbjct: 177 LALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIK 236

Query: 239 QLKFVSGLHKQ---------QNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIA 289
           QL+FVS LHKQ         +N   +  I E+ R  + QGPFTI PF +++YS+T T I 
Sbjct: 237 QLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQIT 296

Query: 290 SLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQI 349
           ++PI++ NEL+++  D+G I    QDLD++M W+    + NNS  ++E + + S +I  I
Sbjct: 297 TMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNSLVVLESLDILSGQI--I 354

Query: 350 VVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVT-----FTE 404
            +  HK   F+V+ P+  F +D+S+W+  ++ C+  S+L  L++  ++S +T     FT+
Sbjct: 355 CLTPHK---FAVLGPKS-FVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGAFTQ 410

Query: 405 LKDSPKSVAWWNTTPQSVVKVSNREVKSKQVSEGVSKQDDDITGSRQEPE--KYNAHYSQ 462
                 +  W +   + ++ +S++ VKS  + E  +K  D ++ + Q     KY   +SQ
Sbjct: 411 ------AGLWESNGEKQLIFMSDKSVKSITLPEP-NKTKDAVSKTVQPVTEVKYEPVFSQ 463

Query: 463 PIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQ 522
           PI EI+ LN+KFQ E S+A   VIPP     PL+N+++E QL LLT+ SK+  SKI  GQ
Sbjct: 464 PIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQ 523

Query: 523 TLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFN 582
           TLG+ +HNR++EQ+ +LT QL+ S E++ K + +   +  Q+SR + V  +   + SRF 
Sbjct: 524 TLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFE 583

Query: 583 KFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMN 642
           K +  L +I +S + KDL IS+ E+EWFKEI+ QV  FN+ V  Q+ +++QL  ++ E+ 
Sbjct: 584 KLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSEL- 642

Query: 643 RIAQVTGDQNSQARD--EWHELRHMLEEDTIILQDCNNQLKSAARQV 687
              +  G++     D  +W EL+ +L  D+ I+++CN  L  AA+++
Sbjct: 643 ---KTAGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKEL 686

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  413 bits (1062), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 239/711 (33%), Positives = 404/711 (56%), Gaps = 27/711 (3%)

Query: 1   MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPG-YHSMTLERAF 59
           M+ E +PIF+    ++  + RFF + ++G R ++ QDS IRW   S+   Y SM L  + 
Sbjct: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSD 60

Query: 60  KDVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEV----SSMANAFQ--LFRFVSDEARI 113
            DV   ++S+ G++LCLYN  ++R+IE+PW  T V    +SMA++ Q  ++ F  D+  +
Sbjct: 61  MDVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSV 120

Query: 114 KQVLFHPLAYQQETVVILKDDDSITIMNWQD-FGDSKPDV---LNLSN-GTYSLDSSITD 168
           KQVLFHPL+     +V+L     I  ++ ++ F  S   +   LNL++     +D+ + +
Sbjct: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180

Query: 169 VECITFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGT 228
           ++ + F+ D L+LY L+     D+Y FYPCL P     K  +D L+ KS++ Y+ L +  
Sbjct: 181 IQYVVFADDCLSLYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237

Query: 229 DSEVKRNTIKQLKFVSGLHKQ----QNS----QRILEIPEAQRQVRGQGPFTIAPFPKQI 280
           D  V++N IKQL+  S L K+    +N+    +  +EI    RQ + QG F+I+P+P+ +
Sbjct: 238 DDIVRKNVIKQLQLASSLRKKIEEFENANGEVEVNVEIDLEFRQTKAQGYFSISPYPESL 297

Query: 281 YSSTGTGIASLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELIT 340
           Y+ TG  I+ LPI + NEL ++S D+G + ++ +D + TM+WD   Y++NNSF LVE+I 
Sbjct: 298 YTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIK 357

Query: 341 LGSQEIQQIVVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEV 400
              +E+  +VV   + G+F V   +    +DT+KWS V++ C+ ++DLRPL   +++S +
Sbjct: 358 FKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTI 417

Query: 401 TFTELKDSPKSVAWWNT-TPQSVVKVSNREVKSKQV-SEGVSKQDDDITGSRQEPEKYNA 458
           T         S   WN+   +S++ V    V   Q+  + V  + +       E E +  
Sbjct: 418 THINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELENFTL 477

Query: 459 -HYSQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSK 517
             ++ P  E+   N KFQ   S   SKVIP   +Q P  + A E QL +L + S+D  SK
Sbjct: 478 DKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDVGSK 537

Query: 518 IAVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTL 577
           I  GQ+LG+ L++R+ EQQ  L+ QL  + +++ + + +   + +Q S+ D    +   L
Sbjct: 538 IVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLKKQEHL 597

Query: 578 MSRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHL 637
                K + NL  IQ SQ+ K L +S++E++ FKE+R Q+L FN  VH QK  +  +  L
Sbjct: 598 EKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQNIQFL 657

Query: 638 KQEMNRIAQVTGDQNSQAR-DEWHELRHMLEEDTIILQDCNNQLKSAARQV 687
           K+E+ +I  ++  ++S+   +EW ELR +L +D  I+++CN QL   ++++
Sbjct: 658 KKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKEL 708

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  409 bits (1051), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 249/718 (34%), Positives = 387/718 (53%), Gaps = 39/718 (5%)

Query: 6   HPIFRPSLTAQSG-SDRFFLTTSDGGRAVVVQ--DSCIRWCNVSEPGYHSMTLERA-FKD 61
            PI +P+    S  S R+  TT  G + V +   +  +RW +VSE  Y+SM L+ + F D
Sbjct: 23  RPILQPTAGLPSDLSSRYVFTTDKGTKYVYLDKTNGLLRWGSVSEDEYNSMPLKISNFAD 82

Query: 62  VK-HVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQL-FRFVSDEARIKQVLFH 119
              +V++S+SGEFLC+Y+ D + +IEVPW Y     M+  FQ  F+ +  ++ IK+VLFH
Sbjct: 83  KSVNVILSDSGEFLCVYSKDCVTVIEVPWRYRNPEEMSYVFQTSFKEIRKDSFIKKVLFH 142

Query: 120 PLAYQQETVVILKDDDSITIMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECITFSQDGL 179
           P A ++  +VIL +DD+I +    D  D+    LN+ +G   ++  IT +  I FSQDGL
Sbjct: 143 PRAIKKTCMVILFEDDTIYLF---DVEDNNKIALNVPSGNIGIEDRITSIADIEFSQDGL 199

Query: 180 TLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIKQ 239
           TLYVLS  +  D+YA YPCL P +   ++ L  LM +S++ YD L   T S VK+  IKQ
Sbjct: 200 TLYVLSAEDCGDVYAIYPCLPPILAMSQKELKSLMNRSVLLYDSLTETTPSAVKKGVIKQ 259

Query: 240 LKFVSGL----HKQQNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLPIND 295
           ++F+S L    H ++    +LEI    R  + QGPFTIAPFP+++YS+T T I  L I  
Sbjct: 260 VEFISQLQNISHGKEEISNVLEIDTIYRLAKPQGPFTIAPFPEKLYSATATEICPLNIGG 319

Query: 296 QNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLG------------- 342
            NE+L ++ D+G    L +DL+++M WD     YNNS  L+E   L              
Sbjct: 320 GNEILCIAYDNGTALFLFKDLELSMAWDVGGIYYNNSLVLMEEFDLQTESAVSILKSFKM 379

Query: 343 --------SQEIQQIVVGDH--KYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLA 392
                   S  +Q I V     + G   V     +  +DT  WS V++ C+   D+  L 
Sbjct: 380 DGLILFKVSDSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTKAWSSVVSDCIDRHDINALI 439

Query: 393 ETKLESEVTFTEL--KDSPKSVAWWNTTPQSVVKVSNREVKSKQVSEGVSKQDDDITGSR 450
               +S+     +   D     AW +   + V  ++N+ V  K++ + VS + +  T S 
Sbjct: 440 TVSFKSKGHTWAIAGSDITSCGAWNHGGTEGVTWITNKSVTCKELKKQVSWKPEQSTSSE 499

Query: 451 QEPEKY-NAHYSQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTE 509
           ++ + +    +S PI+E+  LN  +Q         +I P +RQKPL N ++E QL ++T 
Sbjct: 500 KKKQAFPKPEFSVPISELNALNINYQDTCRIGFHDIISPLDRQKPLLNPSNEKQLQVMTS 559

Query: 510 ASKDFVSKIAVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDA 569
            S   ++ +  GQ LG+TL+NR+ EQQL+LT QL+ S +++ KQ  I      Q S  + 
Sbjct: 560 LSNYLLATVGKGQGLGMTLYNRLLEQQLELTKQLQCSNKILMKQPAIAKKLEEQKSVWNE 619

Query: 570 VHARHSTLMSRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKR 629
             A+ + L  RF+  +  L  I  +++  DL I+ EE  WFKE++K+ LTFN  V+ Q+ 
Sbjct: 620 KLAKQNKLKERFSSLQQKLAAIDKTKKSTDLVITDEESVWFKEVKKEALTFNDLVYKQES 679

Query: 630 LQDQLIHLKQEMNRIAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQV 687
           +QD L  LK+E++     +      A  EWH L+ ML+ D+++L+      K A+ QV
Sbjct: 680 VQDDLRFLKRELSTFVSDSQRLPGTANTEWHSLQEMLKHDSLLLRADKKDKKDASSQV 737

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  348 bits (892), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 232/714 (32%), Positives = 375/714 (52%), Gaps = 52/714 (7%)

Query: 1   MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFK 60
           M  E HPIF+     +S S+R  L T D  R ++++ + ++WC +  P Y  M L  A  
Sbjct: 1   MLPEAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMEL-NAIS 59

Query: 61  DVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFVSDEARIKQVLFHP 120
           +    V+++SG  LCL N DE++++ + W  T   S       +R +   A +KQVL+HP
Sbjct: 60  NYTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPES-------YR-IKVPAGVKQVLWHP 111

Query: 121 LAYQQETVVILKDDDSITIMNW--QDFGDSKPDVLNLSNGTYSLDSSITDVECITFSQDG 178
                  + +L   D I +     +DF  +   VLN S     + SS+ D+E + FS DG
Sbjct: 112 RGRLDSCLTVLNKRDEILLYELLSEDFS-APTTVLNASTNELGMGSSVKDIESVCFSADG 170

Query: 179 LTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIK 238
           LTLY++SVSEGAD+++ YPC+   +   ++ L     K+L+QY  L+ G   E+K    +
Sbjct: 171 LTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATR 230

Query: 239 QLKFVSGLHKQ--------QNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIAS 290
           QL F+S L+ Q         N  +   I +A R  R QGPFTI+PFP+++Y +T   I +
Sbjct: 231 QLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKA 290

Query: 291 LPINDQN-ELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQI 349
           + + D+  ELL+++ DD  I     DL   M+W+ +  +  NS     LI++GS ++   
Sbjct: 291 IALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNS-----LISVGSLKLPGS 345

Query: 350 VVGDHKYGQ-FSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDS 408
           +     YG  F +++ E    ++ S+ +  +   L + D   L+E  L  E+T  E K +
Sbjct: 346 I--SLIYGSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEIT--EKKGT 401

Query: 409 PKSVAWW-NTTPQSVVKVSNREVKSKQVSE---GVSKQDDDITGS---RQEPEKYNAHYS 461
            +S   W  +  Q +V +S +E+ S  +S      S   + I  S   RQ P      YS
Sbjct: 402 FQSAGLWPESGMQKIVLLSEKEITSIDISSMQTPASSTTEKIEKSETNRQRP------YS 455

Query: 462 QPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVG 521
           QP++E+  LNQK Q       S VIP   RQK L N  +E QL LLT+ SK+ +S++ + 
Sbjct: 456 QPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLA 515

Query: 522 QTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRF 581
           QTLG++LH R+  QQ +L   L+   EL  K++ +  H  SQ  R +A+  ++ ++  RF
Sbjct: 516 QTLGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRF 575

Query: 582 NKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEM 641
                N+ QI  S + +   I+K E+EWFKE+R QV+ FNR VH Q+ L + L  LK  +
Sbjct: 576 ESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDLAEALSSLKLSL 635

Query: 642 NRIAQVTGDQNSQARDE--------WHELRHMLEEDTIILQDCNNQLKSAARQV 687
             +   + +  S+++          W EL+ ML +D+ I+++C  +L+   +++
Sbjct: 636 EYVRVDSAEAASRSKKSAESAGGVPWDELQAMLAKDSRIIKECQAELQCTTQEL 689

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  344 bits (882), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 228/703 (32%), Positives = 354/703 (50%), Gaps = 34/703 (4%)

Query: 1   MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFK 60
           M  E+HPIF     +   S RF        +  V+Q + +RWC+     Y  +  E    
Sbjct: 1   MIPESHPIFDTKTNSSGKSRRFVFNIGIASKYGVLQGNTLRWCSAGGHEYQYLEFEPRI- 59

Query: 61  DVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFVSDEARIKQVLFHP 120
           D   VV++ SG  LCLYN  +++I+ V W  ++  ++         +S  A IKQ L+HP
Sbjct: 60  DYTSVVINESGSLLCLYNSKQVQILAVSWDESKSDTI--------LISPPAGIKQALWHP 111

Query: 121 LAYQQETVVILKDDDSITIMNWQDFGDSKPD-VLNLSNGTYSLDSSITDVECITFSQDGL 179
                  + +L   D I +        ++P  +LN       + S + D+  ++FS DGL
Sbjct: 112 RGRLGSCLAVLTTQDEICLYELLTEDYTEPTTILNTCTKELGMGSVVKDITSMSFSSDGL 171

Query: 180 TLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIKQ 239
           TLY+LS SEGADIY+ YPCL   M+     L  +  K+L+QY  LN     +++R   KQ
Sbjct: 172 TLYLLSTSEGADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSPDLRRKVTKQ 231

Query: 240 LKFVSGLHKQQNSQ----RILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLPIND 295
           L+FVS L K+ + +     ++ I +A R  R QGPFTI PFP  +Y +TG  +  + +  
Sbjct: 232 LQFVSKLQKKNDYKDTESHVVTISKAHRSPRAQGPFTINPFPDNLYLATGRQVEVIKLQG 291

Query: 296 -QNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIVVGDH 354
              ELL++S DDG I     D +  M+W+   +  NNS     LI LGS  I   +   +
Sbjct: 292 CAAELLLISFDDGTILECFPDREPVMSWEDEGFCENNS-----LIVLGSVNIGGEIALVN 346

Query: 355 KYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPKSVAW 414
            Y  F V++   V  +   K + V+ S L + D+    E  L  EV   E      S   
Sbjct: 347 GY-TFVVLSSAKVTFVSLRKLAQVIESSLNDCDISYFDEADLSEEVV--EKNGRFCSAII 403

Query: 415 WNTTPQSVVKVSNREVKSK---QVSEGVSKQDDDITGSRQEPEKYNAHYSQPIAEIMQLN 471
             ++ +S V + +    S      S    K    +  ++ + E+Y   Y QP+ E++ LN
Sbjct: 404 CASSEKSCVALLSETTTSHIDIPFSLDAPKMRTALGTAKTDVEQYRP-YGQPLNEVLALN 462

Query: 472 QKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTLGVTLHNR 531
           +K Q    K     + P  RQ  L NE++E QL LLT  SK+ +++IA  QTL ++L+ R
Sbjct: 463 EKVQALLKKPLQTGVSPSLRQAKLNNESNEDQLSLLTSISKEVMTRIASAQTLALSLYLR 522

Query: 532 IYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKFKDNLGQI 591
           +  QQ +LT  L+   ++ E Q  +L     QSSR +A  A++ ++ SR  +    L Q+
Sbjct: 523 LSCQQGELTQHLETVSKVEELQSKVLRRLKDQSSRWEAAQAKNKSISSRLEQISSKLKQV 582

Query: 592 QNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRI-----AQ 646
            +S +F+   IS  E+EWFKEIR QV+ FNR VH Q+ L + L +LK E+  +       
Sbjct: 583 SSSGKFQSQPISNHELEWFKEIRDQVIRFNRLVHEQQSLGNTLSNLKCELEYVHVESKEG 642

Query: 647 VTGDQNSQARDE--WHELRHMLEEDTIILQDCNNQLKSAARQV 687
            +G  ++  +DE  W ELR +L +D  I+ +C + L+  A+Q+
Sbjct: 643 KSGSSSADNKDEVPWDELRALLAKDLRIIGECQDSLQGVAKQL 685

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  344 bits (882), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 225/718 (31%), Positives = 379/718 (52%), Gaps = 45/718 (6%)

Query: 6   HPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRW--CNVSEPGYHSMTLERAFKDVK 63
           H IF      +  S R  +T  +G + ++ Q++ +R+   N ++  + S+TLE+      
Sbjct: 7   HTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMIGDV 66

Query: 64  HVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFV--------SDEARIKQ 115
            ++    G +LCL+N+ E+R+IE+PW   +     ++FQL   V        S    I++
Sbjct: 67  SIIADQIGNYLCLFNEFEIRVIELPWKLWDAKE-DSSFQLDNMVQIRSYDLKSFGTTIQK 125

Query: 116 VLFHPLAYQQETVVILKDDDSIT------IMNWQDFGDSKPDVLNLSNGTYSLDSSITDV 169
           +LFHPL      +V+L  + +I       I+  ++   +     + + G   L S I D+
Sbjct: 126 ILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFH-TKGVMGLSSCIDDI 184

Query: 170 ECITFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTD 229
             I+FS D L+LY L+     DIY FYP L P +   K  +D+L  KS+I ++ L   + 
Sbjct: 185 IDISFSSDKLSLYALT---ETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSS 241

Query: 230 SEVKRNTIKQLKFVSGLH----------KQQNSQRI--LEIPEAQRQVRGQGPFTIAPFP 277
             V+RN IKQL+ +S L           K  +  +I  ++I    R V  QG F+IAPFP
Sbjct: 242 EAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFP 301

Query: 278 KQIYSSTGTGIASLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVE 337
           +++Y  +   ++ + I   NEL +++ DDG + IL +DL+ +M+WDS  Y +NNSF L+E
Sbjct: 302 EELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLE 361

Query: 338 LITLGSQEIQQIVVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLE 397
            +     E + I+    K G F++   + V  IDTS WS +++ C+ ++D+R LA   +E
Sbjct: 362 KLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIE 421

Query: 398 SEVTFTELKDSPKSVAWWNT-TPQSVVKVSNREVKSKQVSEGVSKQDDDI----TGSRQE 452
           S        + P S   WN    + ++ ++  ++ S  + E  ++  + +        ++
Sbjct: 422 SHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPVPAINDIKK 481

Query: 453 PEKYN-AHYSQPIAEIMQLNQKFQLESSKAP-SKVIPPRERQKPLKNEASEIQLDLLTEA 510
            EK    +YSQPI EI    Q+++ +S K P SKVIP   RQKP  N+ +E QL  +TE 
Sbjct: 482 IEKLQLKNYSQPIKEINIAVQRYK-DSCKVPYSKVIPANIRQKPFANDENEDQLAYITEI 540

Query: 511 SKDFVSKIAVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAV 570
           S++  SKI  GQT+ + +H R+ EQQ     QL  + + +   +TI   +  QS++   +
Sbjct: 541 SQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHI 600

Query: 571 HARHSTLMSRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRL 630
             R++ L  R +K  + + +I+ SQ++K++ I+  E + FKEI+KQVL FN  V+ Q+  
Sbjct: 601 TERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQ 660

Query: 631 QDQLIHLKQEMNRIAQVTGDQNSQA----RDEWHELRHMLEEDTIILQDCNNQLKSAA 684
           Q+ +  L+ E+N I +     +        DEW+EL  +L  D  I++DCN +L SA+
Sbjct: 661 QEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSAS 718

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  320 bits (821), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 208/702 (29%), Positives = 361/702 (51%), Gaps = 37/702 (5%)

Query: 17  SGSDRFFLTTSDGGRAVVVQDSC-IRWCNVSEPGYHSMTLERAFK-DVKHVVMSNSGEFL 74
           + + RF  ++SDG + V + D   +RWC+ +   Y S+  +  F+  V+  V S + +++
Sbjct: 16  NAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTADYV 75

Query: 75  CLYNDDELRIIEVPWAYT-EVSSMANAFQLFRFVSDEAR-IKQVLFHPLAYQQETVVILK 132
           C+YN DEL ++EVPW Y+ E + + +   ++    DE   IKQVLFHP +Y   T+++L 
Sbjct: 76  CIYNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVLFHPKSYLDSTILVLT 135

Query: 133 DDDSITIMNWQDFGDSKPDV-LNLSNGTYSLDSSITDVECITFSQDGLTLYVLSVSEGAD 191
           +DDSI ++N  D    K  + LN  N    L   I D++ I FSQDGL+L +LS  EG D
Sbjct: 136 NDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLILSAEEGCD 195

Query: 192 IYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIKQLKFVSGLHKQQ- 250
           I+  YPCL  R       +D L  KSL+ Y+ +NV T  + KRN +KQL F+  +  Q+ 
Sbjct: 196 IFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKIRGQKT 255

Query: 251 ---NSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLPINDQNELLIMSLDDG 307
              N ++ L + +A    + QGPF++ P+P ++Y    T I  + I     LL ++  +G
Sbjct: 256 AFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMATDINIIQITQNISLLAIAFSNG 315

Query: 308 NIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIVVGDHKYGQFSVM-TPEG 366
            + + L DL+  M+WD +R+  +NS AL+E I L   +  + +     YG+F V    + 
Sbjct: 316 TVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGKFVVTDNVKS 375

Query: 367 VFSIDTSKWSGVMASCLTESDLRPLAETKLESEV-TFTELKDSPKSVAWW-NTTPQSVVK 424
            F ++T  WS ++A  + +SD++ LA  K++S +    +L  + KS+ +W N        
Sbjct: 376 NFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENISCNYI 435

Query: 425 VSNREVKSKQVSEGVSKQDD----DITGSRQE-----PE----KYNAHYSQPIAEIMQLN 471
           +S+++++   + +G+S        D + S+ E     PE     Y   +++P+ EI    
Sbjct: 436 ISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFARPLTEIQHYE 495

Query: 472 QKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTLGVTLHNR 531
           Q +           IP   R  PLKN ++E QL+ LT+ S+ ++  I++ QTLG     R
Sbjct: 496 QIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKR 555

Query: 532 I------YEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKFK 585
           +      + +Q++ T+Q+    +  E+ + +      Q+++ D V  +   LM R +   
Sbjct: 556 MIDSIEEFSRQIETTYQINKFWDNFEQIREV------QNTKIDKVKEKQQKLMERLSSLY 609

Query: 586 DNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRIA 645
           D +   +      +  IS  E EWF EI++ V+ FN  V        +L  +K++  +IA
Sbjct: 610 DKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIA 669

Query: 646 QVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQV 687
               D +S+   EW++L+ +L  D  I+ +   +  +A   +
Sbjct: 670 NQKPDISSENGKEWNDLQQLLRTDLKIISEFEKKCDTAVNGI 711

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  290 bits (742), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 199/696 (28%), Positives = 355/696 (51%), Gaps = 40/696 (5%)

Query: 1   MTVETHPIFR-PSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAF 59
           MT + HPIF+ P    ++ S        +  + V   D  +R+  V+E  + S  L+   
Sbjct: 1   MTGDPHPIFQVPPF--RTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLD--I 56

Query: 60  KDVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFVSDEARIKQVLFH 119
           K  +H +++NSG  +  Y  +++          E+  M       R    E  IKQVL+H
Sbjct: 57  KHSEHSILNNSGTLIAFYGSNDV----------ELFDMDGKKSCLRV---ELGIKQVLWH 103

Query: 120 PLAYQQETVVILKDDDSITIMNWQDFGDSKPDV-LNLSNGTYSLDSSITDVECITFSQDG 178
           PLAY    +V+L  +++I +          P V LN       + S ++++  + FS DG
Sbjct: 104 PLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDG 163

Query: 179 LTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIK 238
           LTLY+LS+ EG D+YA +P L  R++  +   +   YK+   Y+ ++  T +E K   I+
Sbjct: 164 LTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIE 223

Query: 239 QLKFVSGLHKQ--QNSQRI-LEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLPIND 295
              FVS ++K   ++S+   + IPE +R V  +GPF+I  FP+++Y++T T + +LP+ND
Sbjct: 224 HFDFVSKIYKMIDKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVND 283

Query: 296 QNE-LLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQ--EIQQIVVG 352
           +   +LI+S DDG I  L  D+++ M+W S   N   SF L+E    G +   I+  V  
Sbjct: 284 EGAYVLILSFDDGTILSLFPDIELLMSW-SRSLNNACSFVLIEKFRAGGEIFAIESGVAI 342

Query: 353 DHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPKSV 412
             K     V  P          +   +  C+ E D+ P+ + KL S++T   L  S  +V
Sbjct: 343 LEKNNAHIVRFP----------YLKALGECIKEGDIAPMVDVKLTSDIT--PLAGSYHTV 390

Query: 413 AWWN-TTPQSVVKVSNREVKSKQVSEGVSKQDDDITGSRQEPEKYNAHYSQPIAEIMQLN 471
             WN  + + ++ + N  ++S     G+S     +  +  +  KY   +   + E+++ N
Sbjct: 391 VTWNEPSTKGILFIGNSVIRSIPDDVGLSSFKPRVDPAISQNGKYTVCFPSTMEELLKTN 450

Query: 472 QKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTLGVTLHNR 531
           +  Q  + + P  ++P  ++  PL +E +E QL  LT+ S + + +I + Q+LG  ++NR
Sbjct: 451 KALQ-HTLRQPLPLVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSLGYLMYNR 509

Query: 532 IYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKFKDNLGQI 591
              QQ +L  QL+   +L ++  T+  +  S + R D+V  +   L SR  K + +L ++
Sbjct: 510 AATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKV 569

Query: 592 QNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRIAQVTGDQ 651
             S +F +L +S +E  WF+E++  VL FN  V    +L ++L  LK+E+  I    G+ 
Sbjct: 570 NESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSKLCEELNFLKKELELIESNHGNI 629

Query: 652 NSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQV 687
            ++    + +L+ +L  D+ ++ DCN+QL +AA+ +
Sbjct: 630 PNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDL 665

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  249 bits (635), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 193/703 (27%), Positives = 326/703 (46%), Gaps = 52/703 (7%)

Query: 1   MTVETHPIFRPSLTAQSGSDRFFLTT-SDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAF 59
           MT E HPIF     A   S R    T  DG + V   +  +R    +E  Y S   E   
Sbjct: 1   MTGELHPIFNAD--ALGASHRLHAHTHGDGTKIVGYYNKHLRLGRFTEQTYKSWHAEVDA 58

Query: 60  KDVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFVSDEARIKQVLFH 119
           K     +++ SG  L  Y D    IIEV      V        L    +    IKQVL+H
Sbjct: 59  KASS--ILNGSGSLLAFYGD---HIIEV------VDREGKKITL----TVNGGIKQVLWH 103

Query: 120 PLAYQQETVVILKDDDSITIMNWQDFGDSKPD-VLNLSNGTYSLDSSITDVECITFSQDG 178
           PLAY    +V+L   ++I I    +    KP  VLN       + S + D+  I F+ DG
Sbjct: 104 PLAYLDSCLVVLTGQETIEIYELNEPRYEKPTLVLNEPTSQLGISSRVIDITNIAFAPDG 163

Query: 179 LTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIK 238
           L+LY+ S SEG D++   P L  R++ D+    R   K+   Y  L   T  + K  TI+
Sbjct: 164 LSLYLFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDTPDDAKVATIE 223

Query: 239 QLKFVSGLHK---QQNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLPIND 295
            L+FV+ L +   +  S   L IPE +R+   QGP+ I  FP+++YS+ GT +  +P+ +
Sbjct: 224 YLEFVTQLLQAIEKNGSDGELVIPEHRRRTISQGPYNIHGFPEKLYSAVGTKLTVVPLGE 283

Query: 296 -QNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIVVGDH 354
            +  LL++S DD    +L    +V M+W     N      + E    G+           
Sbjct: 284 SEAHLLLLSFDDSTNILLFPSTEVLMSWTKDLKNAYTLMLVEEFTATGTA---------- 333

Query: 355 KYGQFSVMTPEGVFSIDTSK-----WSGVMASCLTESDLRPLAETKLESEVTFTELKDSP 409
               F+      V  ID+++     +   +  C+ + +L  L +    S +   ++    
Sbjct: 334 ----FATCDGVAVLGIDSAQRVEIPYLQALEDCIRDCNLAALQDINFTSSIC--KIPGKF 387

Query: 410 KSVAWWNTTP-QSVVKVSNREVKSKQVSEGVSKQDDDITGSRQEPEK---YNAHYSQPIA 465
            SVA +N    + ++ V +   K    +E    + D  T    +P K   Y   +   + 
Sbjct: 388 HSVARFNAPGNKGIILVGDHHAKIVPSTEAA--KSDTETELDSQPGKEPTYTVCFPNSLE 445

Query: 466 EIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTLG 525
           EI+  N++ Q    + P  ++PP  +  PL ++ +E  L  LT  SK+ + +I + Q+ G
Sbjct: 446 EILNTNKELQRRKHQ-PLPLVPPALKNIPLNSDLNEQHLATLTNISKEVMDRIILSQSAG 504

Query: 526 VTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKFK 585
           + +HNR+  QQ +L  Q++   ++  +   +     + SSR  +V  R   L  R    +
Sbjct: 505 LLMHNRLSLQQYELHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRLKQRLCMLQ 564

Query: 586 DNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRIA 645
             L +I +S +F DL +SK+E +WF+E++ Q ++FN  V    +L+D+L  LK E+  + 
Sbjct: 565 STLNRINSSHKFSDLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELAFLKNELESLP 624

Query: 646 Q-VTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQV 687
           +    D+  +   ++  L+ +L+ D+ I+ +C + L +AAR++
Sbjct: 625 EHRQHDRQEEEPFDFRRLQELLKLDSKIITECTDNLSAAAREL 667

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  195 bits (495), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 181/704 (25%), Positives = 320/704 (45%), Gaps = 82/704 (11%)

Query: 19  SDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFKDVKHVVMSNSGEFLCLYN 78
           SDR  L  ++     + QD+ +R  +  E  Y S  +E  F   + +V+S SG  +  + 
Sbjct: 21  SDR--LVCNNSNTIYLWQDNILRVQSDHETQYRSYNVELPFVP-EQMVISPSGGLVAFHA 77

Query: 79  DDELRIIEVPWAYTEVSSMANAFQLFRFVSDEARIKQVLFHPLAYQQETVVILKDDDSIT 138
           + EL ++EV     E S +   F      +    IK++L+HPLA    + VIL DD +I 
Sbjct: 78  NSELYVMEV----NEQSRLRKHF------NTSLGIKKLLWHPLATYGLSFVILHDDSTIR 127

Query: 139 IMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECITFSQDGLTLYVLSVSEGADIYAFYPC 198
           I + +D       V N  + ++ L   +  V  I F   GLTLY+LS     DIYA +PC
Sbjct: 128 IYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNYCDIYAIHPC 187

Query: 199 LAPRMQF-----------DKQG--LDRLMYKSLIQYDVLN------VGTDSEV------- 232
           L                  K G   D +++KSL  Y+ L+       G+D +V       
Sbjct: 188 LPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDVESDYLTL 247

Query: 233 KRNTIKQLKFVSGLHKQQNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLP 292
           K + +KQ++F     K           +A R    QGPF I  FP  + +   TG+  +P
Sbjct: 248 KHDLLKQIQFFDNYKKNDGIDTF--TSKAIRNSVPQGPFIIKKFPTALNAKEVTGLTIIP 305

Query: 293 INDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIVVG 352
           + ++  LL +   DG   +L  D ++ M+W S R N   +F  + +IT+ + + Q  ++ 
Sbjct: 306 VGERLGLLNLQFIDGTNVVLFSDSEIVMSW-SLRSN--TTFNNLSVITMFNAKGQCQLLN 362

Query: 353 DHKYGQFSVMTPEGVFSIDTSK------WSGVMASCLTESDLRPLAETKLESEV-----T 401
             +        P+ VF+ D+S       W   +A C+   D   + + K E+++     T
Sbjct: 363 SSE--------PKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSIIDDVKFENKIRTVSGT 414

Query: 402 FTELKDSPKSVAWWNTTPQSVVKVSNREVKSKQVSEGVSKQDDDITGSRQEPEKYNAHYS 461
           F  +  +      +N     V++ +++    K ++             R +  KY    S
Sbjct: 415 FLGVLSTLSGDILYNGNSFKVIESNDKSTTQKPIN-------------RTDEVKYTYKPS 461

Query: 462 QPIA--EIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIA 519
            P +  E+  L  K++ E++   S  IP      PLKN ++E QL++++E  K+ + ++ 
Sbjct: 462 LPTSGKELDMLLTKYKTEANGFISG-IPDSLAPLPLKNNSNERQLEVVSELYKETMKRVK 520

Query: 520 VGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMS 579
           +GQ +   + N+  E+  +L  QL+ + E+   +  +  +      R      +  TL  
Sbjct: 521 LGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEK 580

Query: 580 RFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQ 639
           R +K K+    I+N+++ +   IS+ E+ WFK I+ QVL FN  VH   +L+++L  L  
Sbjct: 581 RLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDT 640

Query: 640 EMNRIAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSA 683
           ++    +  GD +  +  E+  L+ ML  D  ++  C N+L ++
Sbjct: 641 QLRSTTK--GD-DFFSELEFSSLQQMLLNDKKVINSCMNELSAS 681

>KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {ON}
            Anc_4.238 YDL058W
          Length = 2220

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 123/266 (46%), Gaps = 37/266 (13%)

Query: 407  DSPKSVAWWNTTPQSV------VKVSNREVKSKQVSEGVSKQDDDITGSRQEPEKYNAHY 460
            D  K++   NT+   +      +K +N+E++     E VS+ +  +T   ++ EK +   
Sbjct: 1169 DREKNIQKLNTSINELNSEIVELKETNQELE-----ECVSRHEKTVTELNEKIEKSDPII 1223

Query: 461  SQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAV 520
            S   AEI  L QK      K  S+ +  +E Q+ +     E +++      +DF   I  
Sbjct: 1224 SSYEAEIKDLKQKISSSEDKITSQELKYKELQEKVT--LLEKEIETFKTKREDFEKTILQ 1281

Query: 521  GQTLGVTLH--NRIYEQQLDLTHQL--KASGELMEKQ---QTILTHFHSQSSRSDAVHAR 573
             + LGV+L+  N+   ++L   H+L  K   EL +K+   + +       S+  ++   +
Sbjct: 1282 SKELGVSLNEKNKSLSEELVSVHKLQEKCQAELSKKKSKVEGLRGSIEKLSTEKESSEKK 1341

Query: 574  HSTLMSRFNKFKDNLGQIQNSQRF--KDLEISKEEVEWFKEIRKQVLTFNRDVHN----Q 627
               L+ +  +   N+  + + ++   K+L IS ++++            N++V +    Q
Sbjct: 1342 VEQLLKQIEEKDSNIISLTDEKQALNKNLLISNQKIQ----------KLNKNVADSTSEQ 1391

Query: 628  KRLQDQLIHLKQEMNRIAQVTGDQNS 653
             RLQ++L  LK+ +N + + T +QN+
Sbjct: 1392 VRLQEELSQLKETIN-VNEKTYEQNT 1416

>NDAI0J00410 Chr10 (71104..72849) [1746 bp, 581 aa] {ON} Anc_7.516
           YLR453C
          Length = 581

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 17/124 (13%)

Query: 300 LIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIVVGDHKYGQF 359
           ++ SL D  +AILL    V+     + +NYN          L   E + ++   +     
Sbjct: 426 MVQSLSDLELAILLSAARVSSKKKPSLFNYN----------LCYSEYEAMIKSMNARIPT 475

Query: 360 SVMTPEGVFSIDTSKWSGVMASCL---TESDLR----PLAETKLESEVTFTELKDSPKSV 412
              TP G  S+++S    ++ + +    + D+R     LA  KL +E   T LK+S  SV
Sbjct: 476 VASTPGGAASVNSSPTKRIVDNTIKQWNKQDVRNVWESLANMKLLTEAGATGLKESATSV 535

Query: 413 AWWN 416
           A  N
Sbjct: 536 ANAN 539

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,414,878
Number of extensions: 3200521
Number of successful extensions: 12370
Number of sequences better than 10.0: 198
Number of HSP's gapped: 12836
Number of HSP's successfully gapped: 211
Length of query: 691
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 574
Effective length of database: 40,065,477
Effective search space: 22997583798
Effective search space used: 22997583798
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)