Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0D018601.317ON80980939970.0
ZYRO0G20724g1.317ON81280723960.0
Kpol_1035.261.317ON83582522230.0
SAKL0D06974g1.317ON81381121530.0
KAFR0A017301.317ON82182121290.0
KLTH0H10736g1.317ON81080821060.0
Kwal_14.25871.317ON80881120900.0
TBLA0F013301.317ON82782120810.0
NCAS0A092201.317ON83180420800.0
NDAI0G057401.317ON85783320340.0
KNAG0C058301.317ON83082420270.0
Ecym_62881.317ON80681020110.0
TPHA0O014801.317ON82481019470.0
AEL166C1.317ON80680519320.0
CAGL0J05236g1.317ON84284519020.0
KLLA0F01705g1.317ON78780418950.0
YJL062W (LAS21)1.317ON83083617340.0
Smik_10.1781.317ON83183417330.0
Skud_10.1591.317ON83183317320.0
Suva_6.1381.317ON83083617240.0
KLTH0E06094g4.28ON10164075123e-53
Kwal_55.20667singletonOFF6024034906e-52
SAKL0H25542g4.28ON10134134982e-51
Kwal_YGOB_55.206644.28ON9564034973e-51
TDEL0F016904.28ON10053494931e-50
TPHA0K021804.28ON10284224912e-50
ZYRO0B01034g4.28ON10093974851e-49
KLLA0C17534g4.28ON10053914851e-49
Ecym_55594.28ON10143494841e-49
CAGL0G04015g4.28ON10194154841e-49
NDAI0H003204.28ON10343704842e-49
NCAS0C058004.28ON10113884733e-48
KNAG0J028204.28ON10173514708e-48
YLL031C (GPI13)4.28ON10173794672e-47
AGR126C4.28ON10134184654e-47
Smik_12.254.28ON10173484556e-46
Kpol_478.14.28ON10093554531e-45
KAFR0I014104.28ON10163794531e-45
Suva_10.414.28ON10173484441e-44
Skud_12.364.28ON10163484413e-44
TBLA0A085004.28ON10654124343e-43
TPHA0F003104.28ON10263654298e-43
Smik_11.641.184ON9454021736e-12
Skud_11.601.184ON9193841711e-11
SAKL0C05434g1.184ON10353541673e-11
YKL165C (MCD4)1.184ON9193841649e-11
Suva_11.581.184ON9193281593e-10
NDAI0A009801.184ON9254181532e-09
Kwal_33.138561.184ON9223251478e-09
AEL113C1.184ON9253321442e-08
NCAS0B082601.184ON9243231432e-08
TBLA0C058401.184ON9473281432e-08
TPHA0A028001.184ON9203191432e-08
ZYRO0G18458g1.184ON9213281424e-08
KAFR0G005001.184ON9223271405e-08
CAGL0M08448g1.184ON9213721371e-07
Ecym_80941.184ON9263271316e-07
TDEL0C036901.184ON9203291317e-07
KLTH0F04884g1.184ON9223231317e-07
TBLA0E014804.28ON10403971308e-07
KNAG0C010801.184ON9313271309e-07
Kpol_2001.281.184ON9193291282e-06
KLLA0B07249g1.184ON9193961262e-06
KLLA0A11374g1.444ON62182781.2
YLR047C (FRE8)5.117ON68671771.6
Kpol_1044.184.28ON1022152753.0
TBLA0F024306.108ON16398703.9
Ecym_11071.109ON60459717.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0D01860
         (809 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.3...  1544   0.0  
ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]...   927   0.0  
Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {O...   860   0.0  
SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {...   833   0.0  
KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {O...   824   0.0  
KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {...   815   0.0  
Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {O...   809   0.0  
TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {O...   806   0.0  
NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa] ...   805   0.0  
NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON} Anc_1...   788   0.0  
KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON} Anc_1...   785   0.0  
Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar t...   779   0.0  
TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {...   754   0.0  
AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON} S...   748   0.0  
CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa] ...   737   0.0  
KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {...   734   0.0  
YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}  LAS21Inte...   672   0.0  
Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062...   672   0.0  
Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {...   671   0.0  
Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON...   668   0.0  
KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa] ...   201   3e-53
Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa] {...   193   6e-52
SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON} sim...   196   2e-51
Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)...   196   3e-51
TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4....   194   1e-50
TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4...   193   2e-50
ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar...   191   1e-49
KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON} sim...   191   1e-49
Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} simila...   191   1e-49
CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highl...   191   1e-49
NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON...   191   2e-49
NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON} Anc_...   186   3e-48
KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4...   185   8e-48
YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}  ...   184   2e-47
AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON} ...   183   4e-47
Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON...   179   6e-46
Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON} co...   179   1e-45
KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4....   179   1e-45
Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON...   175   1e-44
Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON...   174   3e-44
TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]...   171   3e-43
TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON...   169   8e-43
Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {O...    71   6e-12
Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {O...    70   1e-11
SAKL0C05434g Chr3 complement(516536..519643) [3108 bp, 1035 aa] ...    69   3e-11
YKL165C Chr11 complement(137932..140691) [2760 bp, 919 aa] {ON} ...    68   9e-11
Suva_11.58 Chr11 complement(123117..125876) [2760 bp, 919 aa] {O...    66   3e-10
NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {O...    64   2e-09
Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {...    61   8e-09
AEL113C Chr5 complement(409096..411873) [2778 bp, 925 aa] {ON} S...    60   2e-08
NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON} Anc_1...    60   2e-08
TBLA0C05840 Chr3 complement(1411740..1414583) [2844 bp, 947 aa] ...    60   2e-08
TPHA0A02800 Chr1 complement(603610..606372) [2763 bp, 920 aa] {O...    60   2e-08
ZYRO0G18458g Chr7 (1522413..1525178) [2766 bp, 921 aa] {ON} high...    59   4e-08
KAFR0G00500 Chr7 complement(134741..137509) [2769 bp, 922 aa] {O...    59   5e-08
CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa] ...    57   1e-07
Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar t...    55   6e-07
TDEL0C03690 Chr3 (648638..651400) [2763 bp, 920 aa] {ON} Anc_1.1...    55   7e-07
KLTH0F04884g Chr6 complement(431251..434019) [2769 bp, 922 aa] {...    55   7e-07
TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {...    55   8e-07
KNAG0C01080 Chr3 complement(209716..212511) [2796 bp, 931 aa] {O...    55   9e-07
Kpol_2001.28 s2001 (81621..83408,83411..84382) [2760 bp, 919 aa]...    54   2e-06
KLLA0B07249g Chr2 complement(630336..633095) [2760 bp, 919 aa] {...    53   2e-06
KLLA0A11374g Chr1 complement(985471..987336) [1866 bp, 621 aa] {...    35   1.2  
YLR047C Chr12 complement(239347..241407) [2061 bp, 686 aa] {ON} ...    34   1.6  
Kpol_1044.18 s1044 complement(37667..40735) [3069 bp, 1022 aa] {...    33   3.0  
TBLA0F02430 Chr6 (594075..594566) [492 bp, 163 aa] {ON} Anc_6.10...    32   3.9  
Ecym_1107 Chr1 complement(223755..225569) [1815 bp, 604 aa] {ON}...    32   7.4  

>TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.317
           YJL062W
          Length = 809

 Score = 1544 bits (3997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 753/809 (93%), Positives = 753/809 (93%)

Query: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA 60
           MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA
Sbjct: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA 60

Query: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180
           VAE            WVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ
Sbjct: 121 VAEDDSSSNLNDQDSWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180

Query: 181 VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN 240
           VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN
Sbjct: 181 VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN 240

Query: 241 VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNAD 300
           VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNAD
Sbjct: 241 VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNAD 300

Query: 301 GEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQL 360
           GEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQL
Sbjct: 301 GEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQL 360

Query: 361 DSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXXXXXXXXXXXG 420
           DSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLA            G
Sbjct: 361 DSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLALLVITTIITVLVG 420

Query: 421 SNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVYLVDEKYTHF 480
           SNRMEFGHPFFFTM                EEEHQIWWWISTGATLASSVYLVDEKYTHF
Sbjct: 421 SNRMEFGHPFFFTMIVSLLIGLSSFGSSFVEEEHQIWWWISTGATLASSVYLVDEKYTHF 480

Query: 481 VILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGSSGDIVTFM 540
           VILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGSSGDIVTFM
Sbjct: 481 VILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGSSGDIVTFM 540

Query: 541 CSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTDVFDKSLIPLAQLXXX 600
           CSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTDVFDKSLIPLAQL   
Sbjct: 541 CSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTDVFDKSLIPLAQLFFR 600

Query: 601 XXXXXXXXXXXXXKMGGNKNSHAISTFITLLLIFQSQSPNIPLFFVFDVLKSSLNKIVSK 660
                        KMGGNKNSHAISTFITLLLIFQSQSPNIPLFFVFDVLKSSLNKIVSK
Sbjct: 601 CFAGCVAVAVVACKMGGNKNSHAISTFITLLLIFQSQSPNIPLFFVFDVLKSSLNKIVSK 660

Query: 661 RYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFMMCVSNF 720
           RYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFMMCVSNF
Sbjct: 661 RYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFMMCVSNF 720

Query: 721 APSIYWSTFTWNLLYKTNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFHLFIWSVFS 780
           APSIYWSTFTWNLLYKTNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFHLFIWSVFS
Sbjct: 721 APSIYWSTFTWNLLYKTNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFHLFIWSVFS 780

Query: 781 PKLCYYATWNIFMNLVIGWILEIPLALTT 809
           PKLCYYATWNIFMNLVIGWILEIPLALTT
Sbjct: 781 PKLCYYATWNIFMNLVIGWILEIPLALTT 809

>ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 812

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/807 (55%), Positives = 575/807 (71%), Gaps = 8/807 (0%)

Query: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA 60
           M ++++ LL++Q VA+ +FC GFFPQK VLK  A FI E ++Q ++KPVF+K VL+V+DA
Sbjct: 1   MLRQIITLLLAQFVAIFIFCCGFFPQKNVLKGNADFIIESSIQTQSKPVFDKFVLIVVDA 60

Query: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDF+FE+S S F F+HSL+N+G AWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFVFEESISNFKFVHSLINDGEAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180
           VAE            W++QF   GKK+RFFGDDTWLKLFP ++F EY+GTNSFFVSDFEQ
Sbjct: 121 VAEDDSSSNLKEQDSWLKQFVRQGKKMRFFGDDTWLKLFPLDFFQEYEGTNSFFVSDFEQ 180

Query: 181 VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN 240
           VD NVTRHLP QL  Q++WD LILHYLGLDHIGHKGG  S FMP K  EMD I+K IYEN
Sbjct: 181 VDLNVTRHLPHQLETQKDWDVLILHYLGLDHIGHKGGARSVFMPGKHAEMDSIVKNIYEN 240

Query: 241 VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPV--QN 298
           VD+ TL+CVMGDHGMN+VGNHGGSS GETS+AL +ISKKL+++ PP  Q  V LP+  Q 
Sbjct: 241 VDENTLVCVMGDHGMNEVGNHGGSSPGETSSALVMISKKLKQFQPPLHQRDVHLPITTQF 300

Query: 299 ADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLK 358
            DGEV+Y YLT++QQVD VPTLAALFN PIPKN+VGI+I + LQLLD K+A IK+ +N  
Sbjct: 301 QDGEVNYDYLTKVQQVDFVPTLAALFNIPIPKNNVGIIIPDFLQLLDSKMAAIKVKDNFN 360

Query: 359 QLDSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXXXXXXXXXX 418
           QL S+      +++E+ I++ ++ MKD+Q  LT+SATNY Y ++  G             
Sbjct: 361 QLASLLGRTLEVKNES-INEEFEQMKDLQEVLTKSATNYKYPILAAGFGLLTVLTAVALW 419

Query: 419 XGSNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVYLVDEKYT 478
            G + M+       T+                EEEHQIWWW+ TGA L S +YL      
Sbjct: 420 YGISIMQLSKSSLLTIVLSLLLGIATFSSSFVEEEHQIWWWVITGALLLSQLYLRKALGL 479

Query: 479 HFVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGSSGDIVT 538
           HFV  VC+R+IR WNNSGQK+  +NT+F++LK NP  QWYLN   I   GL GS GD ++
Sbjct: 480 HFVCFVCVRLIRGWNNSGQKYTYDNTIFELLKANPGVQWYLNILTIFTVGLGGSLGDRLS 539

Query: 539 FMCSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTT---DVFDKSLIPLA 595
           F+ SF L ALC  YK++WA+VNRE VP W+ E+A+KSC     + T   +VF K+L+P+A
Sbjct: 540 FILSFSLCALCGSYKISWAIVNREDVPFWMQELAFKSCLFFTKEHTNPEEVFGKALVPMA 599

Query: 596 QLXXXXXXXXXXXXXXXXKMGGNKNSHAISTFITLLLIFQSQSPNIPLFFVFDVLKSSLN 655
           Q                 K+G  K +  + + +++LL+FQS + NIPLFF+F+VL+++L+
Sbjct: 600 QFFFKYFIACLVVKISASKIGVCKAN--LFSMLSILLMFQSPTANIPLFFIFEVLRAALS 657

Query: 656 KIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFMM 715
           ++ +  Y S+ Y +S  SL+LQYFTF+ FGGTNSIA++DLSNAYNGV ENYNIY VGFMM
Sbjct: 658 RLFTDYYGSNTYFVSLSSLLLQYFTFYQFGGTNSIASIDLSNAYNGVPENYNIYLVGFMM 717

Query: 716 CVSNFAPSIYWSTFTWNLLYKTNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFHLFI 775
            VSNFAP+IYWS +   +    ++KW  + + K+ FL+FNC+ G  L+ AC   RFHLFI
Sbjct: 718 FVSNFAPTIYWSLYKSTIPRPESRKWILYAEQKIPFLIFNCVVGVFLLIACYVFRFHLFI 777

Query: 776 WSVFSPKLCYYATWNIFMNLVIGWILE 802
           WSVFSPKLCY+ +WNIFMN++I   LE
Sbjct: 778 WSVFSPKLCYFVSWNIFMNIIIECGLE 804

>Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {ON}
           complement(61260..63767) [2508 nt, 836 aa]
          Length = 835

 Score =  860 bits (2223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/825 (53%), Positives = 564/825 (68%), Gaps = 23/825 (2%)

Query: 4   RLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRS 63
           +L A+LI QL++V +FC GFFP K VL+ +A F      Q  AKP FNKLVLVVIDALRS
Sbjct: 5   QLTAILIIQLISVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRS 64

Query: 64  DFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAE 123
           DFLF++  S+F+++H L N G AWGFTA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAE
Sbjct: 65  DFLFDQDISQFNYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAE 124

Query: 124 XXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVDH 183
                       W  QF  HGKK+RFFGDDTWLKLFP E F EY+GTNSFFVSDFEQVDH
Sbjct: 125 DDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDH 184

Query: 184 NVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-- 241
           NVTRHL KQ+  + +WDALILHYLGLDHIGHKGGP S+FM  K  EMD I+K ++E V  
Sbjct: 185 NVTRHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ 244

Query: 242 DDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQ--NA 299
           D+ TLICVMGDHGMN+VGNHGGSS GETSA L LISKKL+ +  P++Q GV+LP++  N 
Sbjct: 245 DENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNV 304

Query: 300 DGEVD--YQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENL 357
             E D  Y++LT+IQQVDIVPTL+ALFN P PKN+VG+++   L+LLDPKL +IKL EN 
Sbjct: 305 APEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENF 364

Query: 358 KQLDSISNGHEVIQ-------DEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXX 410
           +QL  +SN  ++ Q       +   I  +   MKDIQ +LT SATNYN  L+ +GL    
Sbjct: 365 RQLMIVSNNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPLLYLGLGLIF 424

Query: 411 XXXXXXXX-XGSNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASS 469
                       + +E        +                EEEHQIWWWI TG    S+
Sbjct: 425 ILTLTISFWFYFSVLEVDFKNVLIVIISLLIGLSSFASSFVEEEHQIWWWIITGLITVSA 484

Query: 470 VYLVDEKYTHFVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTE-QWYLNFFAIVICG 528
           + L D+K  H V+ VC+RIIR WNNSGQK+  + T+  +L     + QWYLN   I+   
Sbjct: 485 INLPDQKIAHLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIM 544

Query: 529 LKGSSGDIVTFMCSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTT---- 584
           LK S+ ++++FM S+ L ++C++YKV W ++N++ VP  +Y+ A   C  +  D +    
Sbjct: 545 LKDSTDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDI 604

Query: 585 DVFDKSLIPLAQLXXXXXXXXXXXXXXXXKMGGNKNS-HAISTFITLLLIFQSQSPNIPL 643
            V +++LIP+A+                 K+   KN    I   +T LLIFQS S  I L
Sbjct: 605 SVVEENLIPIARFFFYSVLAIVIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGL 664

Query: 644 FFVFDVLKSSLNKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVS 703
           F V+D+L+SSL+ ++  +Y+S+  + S +SL+LQYFTFF FGGTNSIAT DL+NAYNGVS
Sbjct: 665 FMVYDILQSSLSSLLVNQYSSNVMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVS 724

Query: 704 ENYNIYAVGFMMCVSNFAPSIYWSTFTWNLLY---KTNKKWHNFFQSKLTFLMFNCISGC 760
           E+YNIY VGF+MCVSNFAP+IYW+ F W ++Y   K N KW+ F ++KL  + FNCI+GC
Sbjct: 725 EDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGC 784

Query: 761 CLMFACVALRFHLFIWSVFSPKLCYYATWNIFMNLVIGWILEIPL 805
            L+ +C  LR+HLFIWSVFSPKLCYYATWNIFMNL++GW+LEI +
Sbjct: 785 FLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAV 829

>SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 813

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/811 (51%), Positives = 547/811 (67%), Gaps = 14/811 (1%)

Query: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA 60
           M KR + LL+ Q+VA+  F  GFFPQK VL+ +A F+  P  Q+ + PVF KLVLVVIDA
Sbjct: 1   MGKRSVILLLLQIVAIFTFSIGFFPQKSVLQGDASFLYLPQQQSRSDPVFRKLVLVVIDA 60

Query: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDFLF++SNSKF+F+H LLN+G+AWG+TAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFLFQESNSKFNFVHQLLNDGAAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180
           VAE            W+RQF ++ K+++FFGDDTWLKLFP E+F EY+GTNSFFVSDFEQ
Sbjct: 121 VAEDDLSSSLNDQDSWLRQFHNNNKRIKFFGDDTWLKLFPLEFFQEYEGTNSFFVSDFEQ 180

Query: 181 VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN 240
           VD NVTRHLP Q +++ EWD LILHYLGLDHIGHKGG +S+FMP KQEEMD ++KQIYE+
Sbjct: 181 VDLNVTRHLPHQFSHKDEWDVLILHYLGLDHIGHKGGSSSRFMPGKQEEMDNVIKQIYES 240

Query: 241 VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNAD 300
           +D +TL+CVMGDHGMND+GNHGGSS GETSAAL  IS KL+++ PP  Q    LP++  +
Sbjct: 241 MDRDTLLCVMGDHGMNDLGNHGGSSNGETSAALTFISPKLKQFQPPVTQRNAHLPLK--E 298

Query: 301 GEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQL 360
              +Y+YL  +QQ+D+VPTLA+LFN PIPKNS+GI+I + LQL   +LA+IK+ +N  QL
Sbjct: 299 HSENYKYLDEVQQIDLVPTLASLFNLPIPKNSLGIIITDFLQLFPGELAEIKITDNFHQL 358

Query: 361 DSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXXXXXXXXXXXG 420
            +I    E   D  +I    + MK IQS L ++ TNYNY L+ +G               
Sbjct: 359 MNIIG--ETPSDTKDIQNSVEKMKRIQSTLAKATTNYNYQLISIGYIILLLVTVATTGFT 416

Query: 421 SNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVYLVDEKYTHF 480
            + ++  +     +                EEE Q+WWWISTG  L S++ +  E   H 
Sbjct: 417 LSLVKLNYDSALLLGVSFTLGISTFGSSFVEEEQQLWWWISTGILLLSAILVPQEIINHL 476

Query: 481 VILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGSSGDI--VT 538
           ++  CLR+IR WNNSGQK   + T++++LK + +  W LN   I +     + G+   ++
Sbjct: 477 LVFTCLRLIRGWNNSGQKFIYDCTLYELLKVHTSWNWALNALTIFVTSFTCTLGERGPLS 536

Query: 539 FMCSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDT--TDVFDKSLIPLAQ 596
           F+ SF+L  LCLVYK TW++VN E +  WL  V  KSC +++ DT   D++  SL+P+A+
Sbjct: 537 FVSSFLLATLCLVYKGTWSVVNGEQISQWLKAVIRKSCILLLDDTDNRDMYTDSLVPMAR 596

Query: 597 LXXXXXXXXXXXXXXXXKMGGNKNSH--AISTFITLLLIFQSQSPNIPLFFVFDVLKSSL 654
           L                K+   K  +   I + ++++LI Q+ S NIP F VF +L+  L
Sbjct: 597 LFFQITLTLILFRIALNKLMDRKTKYFKDIHSIVSMILILQTSSANIPQFLVFWILQDRL 656

Query: 655 NKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFM 714
             +++    SD  ++  +SLILQ  TFF FGGTNSIATV+L+NAYNG+S +YNI+ VG +
Sbjct: 657 KYLLTAYTPSDC-LVMVISLILQNLTFFQFGGTNSIATVNLTNAYNGISGDYNIHVVGLL 715

Query: 715 MCVSNFAPSIYWSTFTWNLLYKTNK---KWHNFFQSKLTFLMFNCISGCCLMFACVALRF 771
           MC+ NFAPSIYWS  T   L++  K   KW  FF ++L  LMF  I GC +M +CV LR+
Sbjct: 716 MCIGNFAPSIYWSMATLPTLFENKKNTDKWEIFFATRLPALMFYSIIGCFIMGSCVILRY 775

Query: 772 HLFIWSVFSPKLCYYATWNIFMNLVIGWILE 802
           HLFIWSVFSPKLCYY TWN+FMN ++ W  E
Sbjct: 776 HLFIWSVFSPKLCYYVTWNVFMNFMVSWCAE 806

>KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {ON}
           Anc_1.317 YJL062W
          Length = 821

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/821 (50%), Positives = 538/821 (65%), Gaps = 21/821 (2%)

Query: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA 60
           M+  L  +L++QL++V LF  GFFPQK V+   A F     LQ E K  F KLVL+VIDA
Sbjct: 1   MRGILGFVLVAQLLSVLLFAIGFFPQKNVMNGNATFSINKKLQEETKQPFKKLVLIVIDA 60

Query: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDFLF++S+S F F+HS LN G AWG+TAYSNPPTVTLPRLKGITTGSTPNFLDA+LN
Sbjct: 61  LRSDFLFDESSSNFHFVHSKLNSGEAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDALLN 120

Query: 121 VAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180
           VAE            W++QF S G ++RFFGDDTWLKLFP E+F++Y+GTNSFFVSDFEQ
Sbjct: 121 VAEDDSSSNVKDQDSWLKQFHSKGYRMRFFGDDTWLKLFPLEFFNDYEGTNSFFVSDFEQ 180

Query: 181 VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN 240
           VD NVTRH+P+QL   ++WD LILHYLGLDHIGHKGG NS+FMPAK  EMD+I+ ++Y+N
Sbjct: 181 VDLNVTRHIPRQLEKTEDWDVLILHYLGLDHIGHKGGANSKFMPAKHREMDQIVGKLYDN 240

Query: 241 VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNAD 300
           +D++TL+ VMGDHGMND GNHGGSSAGETSA L   SKKL ++  P  Q+  +LP+ +  
Sbjct: 241 LDEDTLLIVMGDHGMNDAGNHGGSSAGETSAGLVFFSKKLSKFKIPIRQLNARLPITSNS 300

Query: 301 GEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQL 360
              DYQYLT++QQ+D+VPTLAAL+N PIPKNSVG++I + LQLLDP +   KLLEN KQL
Sbjct: 301 S--DYQYLTQVQQMDLVPTLAALYNVPIPKNSVGVIIPDFLQLLDPNIIDTKLLENYKQL 358

Query: 361 DSISNGHEVIQDEANIDQLYDL---------MKDIQSDLTRSATNYNYDLMGMGLAXXXX 411
             +S       DE     ++DL         MK +Q  L  + T Y+Y ++ +G      
Sbjct: 359 LELSKVE--YDDELFNLNVFDLEKRSECQRIMKTLQEKLIAATTEYDYTMLAIGCFMSLV 416

Query: 412 XXXXXXXXGSNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVY 471
                      +M     FF ++                EEEHQIWWW+ TG    S+  
Sbjct: 417 LTLVMAIFSFFQMASNKYFFASVLLASILGFSCFGSSFVEEEHQIWWWVITGCLFISAAK 476

Query: 472 LVDEKYTHFVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKG 531
            +   + H VIL+CLR+IR WNN+GQK      +  IL+ N T QW LN     +  L G
Sbjct: 477 TM-HYFEHSVILLCLRLIRGWNNTGQKTVYPYVISKILEENSTLQWNLNALTFFVISLNG 535

Query: 532 SSGDIVTFMCSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTDVFDKSL 591
           +   +  F+ S  L  LCL YK TWA+VN+E VP ++  +     S         +  +L
Sbjct: 536 NQNSMWGFISSSTLGILCLAYKATWAVVNKEIVPWYIQNIMDNCASFFQDGNKKDYSSTL 595

Query: 592 IPLAQLXXXXXXXXXXXXXXXXKMGGNKNSHA---ISTFITLLLIFQSQSPNIPLFFVFD 648
           IP+A                  K   +  S +   IS ++T+L++F S S NIP F +F+
Sbjct: 596 IPMASFFLHSVAAIIFFTLLWGKFNKHHPSFSLKCISKYVTILMMFLSSSVNIPQFLIFE 655

Query: 649 VLKSSLNKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNI 708
           +++S ++KI+ K YNS+ Y+ S +SL LQ F FF FGGTNSIAT+D+SNAY+G+SENYNI
Sbjct: 656 IMRSFISKILKKHYNSNIYLTSLISLCLQNFAFFQFGGTNSIATIDISNAYHGISENYNI 715

Query: 709 YAVGFMMCVSNFAPSIYWSTFTWNLLY---KTN-KKWHNFFQSKLTFLMFNCISGCCLMF 764
           Y +G +M +SNFAPSIYW+ F+W+++Y   +TN  KW +F +SK+   +FNCI G CLM 
Sbjct: 716 YVIGVLMVLSNFAPSIYWAMFSWDIIYDIKETNFNKWASFTKSKIPTSLFNCIVGLCLML 775

Query: 765 ACVALRFHLFIWSVFSPKLCYYATWNIFMNLVIGWILEIPL 805
           ACV  R+HLF+WSVFSPKLCY+  WN+FMN + GW+LE+ L
Sbjct: 776 ACVMFRYHLFVWSVFSPKLCYFVGWNLFMNAIFGWVLEVLL 816

>KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 810

 Score =  815 bits (2106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/808 (51%), Positives = 525/808 (64%), Gaps = 11/808 (1%)

Query: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA 60
           M KRLL LL+ ++VA+  F AGFFPQK VL+ +AQF  +P       P F K+VLV++DA
Sbjct: 1   MNKRLLVLLVLEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDA 60

Query: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDF+F+K  S+F FLH LLN+G AWG+TAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180
           VAE            W+RQF  H KK++FFGDDTWLKLFP E+FDE DGTNSFFVSDFE+
Sbjct: 121 VAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEE 180

Query: 181 VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN 240
           VD NVTRHLP+QL +Q  WD LILHYLGLDHIGHKGG  S FMP K  EMD +++QIY  
Sbjct: 181 VDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNA 240

Query: 241 VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNAD 300
           V ++TLICVMGDHGMND+GNHGGSSAGETSAAL  ISK L +Y  P  Q G  +PV ++ 
Sbjct: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSS 300

Query: 301 GEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQL 360
            E  Y YLT++ Q+D VPT+A LFN P+PKNS+G+LI + L+LL P  AK K+++N +QL
Sbjct: 301 PE--YNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQL 358

Query: 361 DSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXXXXXXXXXXXG 420
            SIS G    +   + D + + M+++QSDL ++ATNYNY L+G+G               
Sbjct: 359 LSISGGST--KKLGDPDAIIEEMREVQSDLAKTATNYNYLLLGIGFLTLLVVSSVALFFS 416

Query: 421 SNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVYLVDEKYTHF 480
                     F  +                EEEHQIWWW S      S +    E   H 
Sbjct: 417 WTSFPSTFGLFLLLGTSLLLSLSTFGSSFIEEEHQIWWWTSIALVGLSYISAPRELGDHL 476

Query: 481 VILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGSSGDIVTFM 540
            +L  LR+IR WNNSGQK   E T++++LK++   +W L    I +   +G +     F 
Sbjct: 477 TVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAFQ 536

Query: 541 CSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTDVFD--KSLIPLAQL- 597
            SF+++ LCLVYK TW++VN E VP WL  +  +S SIM G + D  D   +L+P+A+L 
Sbjct: 537 YSFLMSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLF 596

Query: 598 -XXXXXXXXXXXXXXXXKMGGNKNSHAISTFITLLLIFQSQSPNIPLFFVFDVLKSSLNK 656
                            K  G +    I   I+ LLI Q+ S NIP F  F +L   LN 
Sbjct: 597 FQVTAAVIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNS 656

Query: 657 IVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFMMC 716
           + S+R  S   +++ V+L+LQ+ +FF FG TNSIATV L+NAYNGVSENYNIY VG +MC
Sbjct: 657 LWSRRQWSFPVLMT-VNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMC 715

Query: 717 VSNFAPSIYWSTFTWNLLY--KTNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFHLF 774
           VSNFAPSIYWS     +LY   T  KW  FF S+L   ++ C+ GC L+ +CV LR+HLF
Sbjct: 716 VSNFAPSIYWSLSCLKILYSKSTQSKWETFFTSRLPSFLYYCLFGCFLLGSCVILRYHLF 775

Query: 775 IWSVFSPKLCYYATWNIFMNLVIGWILE 802
           IWSVFSPKLCYY +WN+FMN +I W  E
Sbjct: 776 IWSVFSPKLCYYVSWNLFMNAIIAWFFE 803

>Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {ON}
           YJL062W (LAS21) - putative membrane protein, a member of
           the major facilitator super family [contig 224] FULL
          Length = 808

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/811 (50%), Positives = 537/811 (66%), Gaps = 12/811 (1%)

Query: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA 60
           M K+LL L+++QLVA+  F AGFFPQK VLK +A+F  +P  Q +  P FNKLVL+VIDA
Sbjct: 1   MSKKLLILVVAQLVAILTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDA 60

Query: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDF+F+K  S F F+H LLN G AWG+TAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFVFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180
           VAE            W+RQF  + K+++FFGDDTWLKLFP+E+FDE DGTNSFFVSDFE+
Sbjct: 121 VAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEE 180

Query: 181 VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN 240
           VD NVTRHLPKQL  Q  WD LILH+LGLDHIGHKGG  S FM  KQ EMDE+++Q+Y +
Sbjct: 181 VDFNVTRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNS 240

Query: 241 VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNAD 300
           V ++TLICVMGDHGMND+GNHGGSSAGETSA L  IS+ L  Y  P  Q     P++  +
Sbjct: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKN 300

Query: 301 GEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQL 360
              DY Y++++ Q+D+VP++++LFNFPIPKNS+G+++ + L+LL PK A++KL++N  QL
Sbjct: 301 D--DYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQL 358

Query: 361 DSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXXXXXXXXXXXG 420
            +IS   +++ + ++ D +Y  M+DIQ DL ++AT YNY ++G G +             
Sbjct: 359 TTISG--DLMANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLFITAIATFLLL 416

Query: 421 SNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVYLVDEKYTHF 480
              +         +                EEEHQ+WWW++   T AS      E   H 
Sbjct: 417 KPTIS-KPALVLLIGVSLLLSLSTFGSSFVEEEHQLWWWLAIALTGASYTQAPSEIKEHL 475

Query: 481 VILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGSSGDIVTFM 540
           +IL+CLR+IR WNNSGQK+  E+T+ +ILK+    QW L    I +   +  +  +V+F 
Sbjct: 476 IILLCLRLIRGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQ 535

Query: 541 CSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTDVFD--KSLIPLAQLX 598
           CSF+++ LCL+YK TW++VN E VP WL  V  KS SIM G+     D  +SL+P+A+L 
Sbjct: 536 CSFLVSTLCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLF 595

Query: 599 XXXXXXXXXXXXXXXKMGGNKNS--HAISTFITLLLIFQSQSPNIPLFFVFDVLKSSLNK 656
                          K   ++    H I  + T  LI Q+   NIP F V+ +L   L  
Sbjct: 596 FKTILAVTLLEIVLHKWNPDRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLES 655

Query: 657 IVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFMMC 716
           +  +R  S + ++ A  ++LQ   FF FG TNSIATV+L+NAYNG+SENYNIY VGF+MC
Sbjct: 656 VWRRREWSPSILMLA-GIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMC 714

Query: 717 VSNFAPSIYWSTFTWNLLYK--TNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFHLF 774
           VSNFAPSIYWS     +LY      KW  F  S++   +F CI GC L+ +CV LR+HLF
Sbjct: 715 VSNFAPSIYWSLNCLKILYSFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLF 774

Query: 775 IWSVFSPKLCYYATWNIFMNLVIGWILEIPL 805
           IWSVFSPKLCYY +WNIFMN VIGW++E  L
Sbjct: 775 IWSVFSPKLCYYVSWNIFMNAVIGWLVEATL 805

>TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {ON}
           Anc_1.317 YJL062W
          Length = 827

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/821 (50%), Positives = 542/821 (66%), Gaps = 16/821 (1%)

Query: 3   KRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALR 62
           K LL  L  QL AV +FC GFFPQK VL   + F  E +LQ EA PVF+KL+LVVIDALR
Sbjct: 4   KSLLICLSLQLAAVFIFCIGFFPQKSVLNGSSTFQIEKSLQQEAPPVFSKLILVVIDALR 63

Query: 63  SDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVA 122
           SDF+F+ + S F F HSLLN G+AWGFTAYSNPPTVTLPRLKG+TTGSTPNFLDAILNVA
Sbjct: 64  SDFIFDSNISNFPFTHSLLNNGNAWGFTAYSNPPTVTLPRLKGLTTGSTPNFLDAILNVA 123

Query: 123 EXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVD 182
           E             + QF+ + KK+RFFGDDTWLKLFP +YF+E++GTNSFFVSDF QVD
Sbjct: 124 EDDNSSNLKDQDSLLNQFYLNNKKIRFFGDDTWLKLFPLDYFEEHEGTNSFFVSDFTQVD 183

Query: 183 HNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENVD 242
           +NVTRH+PKQL  + +WD LILHYLGLDHIGHKGGP S+FMP K EEMD I++Q+YEN+D
Sbjct: 184 NNVTRHIPKQLQEKNDWDVLILHYLGLDHIGHKGGPRSKFMPTKHEEMDGIIRQLYENLD 243

Query: 243 DETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPV-QNADG 301
           ++ L+C++GDHGMN++GNHGGSS GETSAA+   S KL  +  P++Q  ++LP+ + ++ 
Sbjct: 244 NDGLLCILGDHGMNELGNHGGSSNGETSAAMVFASPKLSNFELPSKQKEIKLPITKPSED 303

Query: 302 EVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLL-DPKLAKIKLLENLKQL 360
           E  ++YLT IQQVD VPT+A LFN PIP+NSVGI+I+  L+LL + KL  IKL EN KQL
Sbjct: 304 ENSFKYLTEIQQVDFVPTIATLFNLPIPRNSVGIIIEPLLKLLRNSKLESIKLKENYKQL 363

Query: 361 DSISNGHEVIQDEANID--QLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXXXXXXXXXX 418
             +++ H  + D ++++  +L+  M  IQ DLTRSATNY Y+ +  G+            
Sbjct: 364 LDLAHIHSTMDDISSLEDFELFTKMVSIQEDLTRSATNYFYEFLAAGIISSIIGTILYAV 423

Query: 419 XGSNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVYLVDEKYT 478
             +  ++F      ++                EEEHQIWWWI TG    S     + K  
Sbjct: 424 LITKDLKFNGIEIISIIISLLIGLSMFGSSFVEEEHQIWWWIVTGLITLSLYLKPNTKLL 483

Query: 479 HFVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTE--QWYLNFFAIVICGLKGSSGDI 536
           H  + +C+R+IR WNNSGQK+  E+T+ +IL R   +  QWYL    I       S  ++
Sbjct: 484 HLTLFICVRLIRGWNNSGQKYVYESTISNILSRIEYKDMQWYLILATITFVSFNDSMKNL 543

Query: 537 VTFMCSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTD--VFDKSLIPL 594
            TF  S  L  L   +KV+W++ N E VP  + ++A     ++  D +   +F  +L PL
Sbjct: 544 PTFAMSLSLGVLVFSFKVSWSITNGEKVPFVIKDMARTVVKLLFPDESKDIIFSLALNPL 603

Query: 595 AQLXXXXXXXXXXXXXXXXKMGGNKNSHAI----STFITLLLIFQSQSPNIPLFFVFDVL 650
           AQL                K+  +K    I    +  + L+ I Q++  NIP+F VF+++
Sbjct: 604 AQLFFHCTLGFLVIKLLIQKLKIDKTVDNIFDELTKVMNLVAIMQTRPSNIPMFCVFEIM 663

Query: 651 KSSLNKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYA 710
           K  L KI+   YNS+ Y+ S  SL+LQ+FTFF FGGTNSIATVDLSNAYNGVSENYNIY 
Sbjct: 664 KMILVKIIKHDYNSNPYVTSIASLVLQHFTFFQFGGTNSIATVDLSNAYNGVSENYNIYY 723

Query: 711 VGFMMCVSNFAPSIYWSTFTWNLLYK--TNK--KWHNFFQSKLTFLMFNCISGCCLMFAC 766
           VG +M ++NFAPSIYW+ F+W++LY   TN   +  NF +SK+  L+F  I GC L  +C
Sbjct: 724 VGLLMTIANFAPSIYWAVFSWDILYSYDTNSILRRQNFMKSKVLPLLFYFIIGCFLFLSC 783

Query: 767 VALRFHLFIWSVFSPKLCYYATWNIFMNLVIGWILEIPLAL 807
             LR+HLFIWSVFSPKLCYY  W+IFMN ++GW+ E  L L
Sbjct: 784 FILRYHLFIWSVFSPKLCYYVAWSIFMNCIVGWVFEGILVL 824

>NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa]
           {ON} Anc_1.317 YJL062W
          Length = 831

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/804 (51%), Positives = 529/804 (65%), Gaps = 25/804 (3%)

Query: 22  GFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDFLFEKSNSKFSFLHSLL 81
           GFFPQK VLK  A F      Q E KPVF KLVLVVIDALRSDFLF+++NS F F+HS L
Sbjct: 23  GFFPQKNVLKGLADFHYNSEQQRETKPVFQKLVLVVIDALRSDFLFDETNSHFHFIHSQL 82

Query: 82  NEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFF 141
           NEG+AWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAE             + QF 
Sbjct: 83  NEGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSTTLADQDSLLAQFH 142

Query: 142 SHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVDHNVTRHLPKQLNNQQEWDA 201
              KK+ FFGDDTWLKLFP+++F+E +GTNSFFVSDFE VD NV+RHL KQL +  +WD 
Sbjct: 143 LQNKKINFFGDDTWLKLFPRDWFNEVEGTNSFFVSDFEVVDTNVSRHLTKQLKHNHDWDV 202

Query: 202 LILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENVDDETLICVMGDHGMNDVGNH 261
           LI+HYLGLDHIGHK G +S+FMP K  EMD I++Q+YEN+DD+TL+ VMGDHGMN+VGNH
Sbjct: 203 LIMHYLGLDHIGHKDGASSKFMPEKHIEMDNIVRQVYENIDDDTLLVVMGDHGMNEVGNH 262

Query: 262 GGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLTRIQQVDIVPTLA 321
           GGSSAGETSA L  +S KL++   P +Q  + LP++    E ++Q+LT +QQ+D+VPTLA
Sbjct: 263 GGSSAGETSAGLVFLSNKLKKGELPLKQRHLNLPIKRQTDE-NFQFLTSVQQIDLVPTLA 321

Query: 322 ALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQLDSISNGHEVIQ---DEANIDQ 378
            LFN PIPKN+VGI+I E LQ L   +  IKL+EN  QL  +S G ++     D  +   
Sbjct: 322 TLFNIPIPKNNVGIVIPEFLQFLRKDMINIKLMENYHQLLQLSKGQDLPNIPFDHMDSKN 381

Query: 379 LYDLMKDIQSDLTRSATNYNYDLMGMG--LAXXXXXXXXXXXXGSNRMEFGHPFFFTMXX 436
           + + MK+IQ +LT++ATNYNY  +G G  L              + +  +      T+  
Sbjct: 382 IMNKMKEIQDELTKNATNYNYSYLGRGYLLLIFTTVTVFIVFILNQKSLYCATTIITIVI 441

Query: 437 XXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVYLV------DEKYTHFVILVCLRIIR 490
                         EEEHQIWWWI TG+ + S +  +         + HF+I VC RIIR
Sbjct: 442 SLLVGLSSFGSSFVEEEHQIWWWIITGSIMFSCIETLISNPSKSTVFNHFLIAVCARIIR 501

Query: 491 AWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGS-SGDIVTFMCSFVLTALC 549
            WNNSGQKH  E  + +ILK +    WYL    I   GLK +   D ++F+  F +T LC
Sbjct: 502 GWNNSGQKHVYEFILTNILKNHYNTLWYLICTTIYYIGLKNTIRTDFLSFLGPFFMTTLC 561

Query: 550 LVYKVTWALVNRETVPHWLYEVAYKSCSIMMG---DTTDVFDKSLIPLAQLXXXXXXXXX 606
            VYK+ WA+VN E+VP W Y +  ++  I++       D F ++L+PLA L         
Sbjct: 562 FVYKLDWAIVNNESVPEWFYVITKEASDILLKVGHSPKDAFKEALLPLATLFYQTFVALV 621

Query: 607 XXXXXXXKMGGNKNS--HAISTFITLLLIFQSQSPNIPLFFVFDVLKSSLNKIVSKRY-- 662
                       + +    IS +I+LLLIFQS + NIP F VF+ LK S+ K++   +  
Sbjct: 622 SIRIIFLVFFSRRKTFFDDISNYISLLLIFQSTATNIPQFLVFEFLKKSITKVLQNYHQE 681

Query: 663 NSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFMMCVSNFAP 722
           N + Y+   +SLILQ FTFF FGGTNSIAT+D+SNAY+G+SENYNIY VG  M +SNFAP
Sbjct: 682 NKNNYL-PLISLILQSFTFFQFGGTNSIATIDISNAYHGISENYNIYLVGIFMTISNFAP 740

Query: 723 SIYWSTFTWNLLY----KTNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFHLFIWSV 778
           SIYW    W +LY    +++ KW+ +F++KL  L+FNCI GCCL+ AC  LR+HLFIWSV
Sbjct: 741 SIYWIISMWPILYAEIPESSSKWNIYFKNKLPLLVFNCIVGCCLLAACYILRYHLFIWSV 800

Query: 779 FSPKLCYYATWNIFMNLVIGWILE 802
           FSPKLCY+  WN+FMN V+GW++E
Sbjct: 801 FSPKLCYFLGWNVFMNFVVGWLVE 824

>NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON}
           Anc_1.317 YJL062W
          Length = 857

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/833 (49%), Positives = 532/833 (63%), Gaps = 50/833 (6%)

Query: 19  FCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDFLFEKSNSKFSFLH 78
           F  GFFPQK V+K ++QF     LQ++ +P FNKLVL+VIDALRSDFLF+   S F F+H
Sbjct: 19  FATGFFPQKTVIKGDSQFQINATLQSQTRPTFNKLVLIVIDALRSDFLFDSQKSHFHFVH 78

Query: 79  SLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVR 138
           S LN+G+AWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAE             ++
Sbjct: 79  SQLNKGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDISSTLEDQDSLIK 138

Query: 139 QFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVDHNVTRHLPKQLNNQQE 198
           QF+  GK L+FFGDDTWLKLFP  +F E++GTNSFFVSDFE VD NVTRHLP+QL    +
Sbjct: 139 QFYMQGKNLKFFGDDTWLKLFPHHWFSEFEGTNSFFVSDFEIVDKNVTRHLPEQL-AAND 197

Query: 199 WDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV------DDETLICVMGD 252
            D LILHYLGLDHIGHK G +S+FM  K  EMDEI+K IYE+       DD TL+ VMGD
Sbjct: 198 ADVLILHYLGLDHIGHKDGASSKFMKHKHLEMDEIIKMIYESTQYSNEYDDNTLMVVMGD 257

Query: 253 HGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPV---QNADGEVDYQYLT 309
           HGMN+VGNHGGSSAGETSA +  +S+KL +Y+ P EQ+  ++P+    N +G+ ++QYL 
Sbjct: 258 HGMNEVGNHGGSSAGETSAGMVFLSEKLAKYSTPQEQMNFEVPLLPNLNEEGQNNFQYLN 317

Query: 310 RIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQLDSIS----N 365
            IQQVD+VPTLA LF  PIPKNSVG++I E LQ+LDP++   K+ EN  QL  +S    N
Sbjct: 318 SIQQVDLVPTLATLFGLPIPKNSVGVIIPEFLQMLDPQIISTKIKENYNQLLQLSKKSAN 377

Query: 366 GHEVIQD---EANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXXXXXXXXXXXGSN 422
            +E   D   + N + L + MK+IQ++LT++ATNYNY+L+ +G +               
Sbjct: 378 EYEYNFDSDLDVNQEILQNEMKNIQNELTKTATNYNYNLLIIGYSILVISTLFTSLLIWK 437

Query: 423 RMEFGHPFFF--TMXXXXXXXXXXXXXXXXEEEHQIWWWISTG---ATLASSVYL----- 472
                + F                      EEEHQIWWWI+TG    +L S++ L     
Sbjct: 438 DYSKKNIFQLIPITVISIMLGVSTFSSSFVEEEHQIWWWITTGFITVSLVSTLTLQNGFS 497

Query: 473 -VDEKYTHFVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGL-K 530
            +     H +I  C RI+R W+NSGQK+  ++ + ++LK +   QWYLN   I+I G  K
Sbjct: 498 PLKTILYHLIIFGCARILRGWSNSGQKYIYDHVLSNVLKSHTNIQWYLNLLTILIIGFQK 557

Query: 531 GSSGDIVTFMCSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTDVFDKS 590
            S+ +   F  +F L+ LC +YKV WA+VN E VP W Y   Y++CSI++G T   F  S
Sbjct: 558 DSTSNFFKFTITFFLSVLCFIYKVNWAIVNNENVPDWFYASTYEACSILIGPTATTFQDS 617

Query: 591 LIPLAQLXXXXXXXXXXXXXXXXKMGGNKNSH------AISTFITLLLIFQSQSPNIPLF 644
           LIP+A L                K+   KN+        I  +I LLLIF++ S  I  F
Sbjct: 618 LIPMANLFLKAIVTTIIGRIIYSKIFIGKNNKDSLLIPDIVKYIKLLLIFETSSTKISQF 677

Query: 645 FVFDVLK---SSLNKIVSKRYNSDAY------MISAVSLILQYFTFFHFGGTNSIATVDL 695
            +F+++      L  +V    ++D        +I  +SLILQ FTFF FGGTNSIAT+D+
Sbjct: 678 LIFEIINHIWPKLLNLVKDTSDNDIANSIELSLIPLISLILQNFTFFQFGGTNSIATIDI 737

Query: 696 SNAYNGVSENYNIYAVGFMMCVSNFAPSIYWSTFTWNLLYKT------NKKWHNFFQSKL 749
           SNAY+G+SENYNIY VG  M +SNFAPSIYW+  TW  LY +      N KW  F  +KL
Sbjct: 738 SNAYHGISENYNIYQVGLFMTISNFAPSIYWTIITWPTLYNSTSITNKNSKWIIFASNKL 797

Query: 750 TFLMFNCISGCCLMFACVALRFHLFIWSVFSPKLCYYATWNIFMNLVIGWILE 802
             L FNCI GCCL+ +C  LR+HLFIWSVFSPKLCY+  WN+FMN ++G+I+E
Sbjct: 798 PILFFNCIVGCCLLASCYILRYHLFIWSVFSPKLCYFLGWNLFMNSIVGYIVE 850

>KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON}
           Anc_1.317 YJL062W
          Length = 830

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/824 (48%), Positives = 535/824 (64%), Gaps = 29/824 (3%)

Query: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQ---NEAKPVFNKLVLVV 57
           M  RL A LI QL+A+ +FC GFFPQKKVLK +A+F  E   +   N  +PVFNK +LVV
Sbjct: 1   MLGRLGAALILQLIAIFIFCLGFFPQKKVLKGQAEFNPENLDRLGSNREEPVFNKFILVV 60

Query: 58  IDALRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDA 117
           +DALRSDF+F+  NS F F+HS LN G AWGFTA+S+PPTVTLPRLKGITTGSTPNFLDA
Sbjct: 61  VDALRSDFIFDSHNSHFDFVHSKLNSGEAWGFTAFSSPPTVTLPRLKGITTGSTPNFLDA 120

Query: 118 ILNVAEXXXXXXXXXXXXWVRQFFSHG-KKLRFFGDDTWLKLFP--KEYFDEYDGTNSFF 174
           +LNVAE            W+ QF ++G + +RFFGDDTWLKLF    E F E++GTNSFF
Sbjct: 121 LLNVAEDDQTSTIKEQDSWINQFLTNGNQSIRFFGDDTWLKLFAPANETFQEWEGTNSFF 180

Query: 175 VSDFEQVDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEIL 234
           VSDF QVD NVTRH+P QL  + +WD LILHYLGLDHIGHKGG  S FMP K +EMD +L
Sbjct: 181 VSDFTQVDLNVTRHIPTQLQEKDQWDTLILHYLGLDHIGHKGGAYSHFMPEKHKEMDNVL 240

Query: 235 KQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQ---IG 291
           K +YENVD +TLI VMGDHGMNDVGNHGGSS GET A L  +S+KL R+  P  Q   I 
Sbjct: 241 KDLYENVDPDTLIVVMGDHGMNDVGNHGGSSPGETHAGLVFLSEKLSRFPKPHSQYETIP 300

Query: 292 VQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKI 351
           +  PV  ADG+  ++YLT++QQVDIVPTLA LFN PIPKNSVGILI++ + LLD  L + 
Sbjct: 301 LNTPV-TADGDKTFEYLTQVQQVDIVPTLATLFNVPIPKNSVGILIKDFIPLLDKHLREA 359

Query: 352 KLLENLKQLDSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXXX 411
           K+ EN +QL ++SN  E +     +D++Y+ M+ +Q +LTR+AT+YNY  +  G      
Sbjct: 360 KVGENYQQLFTLSNSMETVNVGLTVDEMYEKMRAVQENLTRNATDYNYRALVPGYVILVC 419

Query: 412 XXXXXXXXGSNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVY 471
                      RM     F   +                EEEHQ+WWW+ TG+ L +  +
Sbjct: 420 VTAYCLILAVQRMRLSGAFVALLGISFLTGISMFGSSFVEEEHQLWWWVITGSILFTLAF 479

Query: 472 LVDEKYTH---FVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFA-IVIC 527
                +T      + + +R+IR WNN+GQK      + +IL  +PT +W LN  A + +C
Sbjct: 480 RQSSWHTTSSCITLSLAVRLIRGWNNTGQKTTYTYVIGNILAAHPTIKWNLNVLAFLAVC 539

Query: 528 GLKGSSGDIVTFMCSFVLTALCLVYKVTWALVNRETVPHWLY---EVAYKSCSIMMGDTT 584
             + ++  +++F    VL  + L YK+ WALVN+E VP + +   ++  +   + +G+  
Sbjct: 540 --QSNTESLMSFCGHIVLIVVALAYKINWALVNKENVPVYAFQFLQIIGRLIKVNVGEDI 597

Query: 585 DVFDKSLIPLAQLXXXXXXXXXXXXXXXXKMGGNKNSHA----ISTFITLLLIFQSQSPN 640
           +  +++LIPLA++                K+   +  H+    IS    +LL+F S + N
Sbjct: 598 ENLEEALIPLARVFYRLVLSFTVVKIVLAKIRL-QPPHSLIKDISKNFVVLLMFLSSTSN 656

Query: 641 IPLFFVFDVLKSSLNKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYN 700
           IP F +F+++K  + +I+   Y SD  + + VSLILQ FTFF FG TNSIAT+DLSNAY+
Sbjct: 657 IPQFLIFEIMKVCITQIIKDEYGSDISITAIVSLILQNFTFFQFGRTNSIATIDLSNAYH 716

Query: 701 GVSENYNIYAVGFMMCVSNFAPSIYWSTFTWNLLYKT-----NKKWHNFFQSKLTFLMFN 755
           G+SENYNIYAVG++M +SNFAP++YW+ + WN+ Y T       +W  F + KL   +FN
Sbjct: 717 GISENYNIYAVGWLMVISNFAPALYWAIYPWNITYVTPTGICKARWLRFAKGKLPITLFN 776

Query: 756 CISGCCLMFACVALRFHLFIWSVFSPKLCYYATWNIFMNLVIGW 799
            + GCCL+ ACVALR+HLFIWSVFSPKLCYY  WN+FM  +IGW
Sbjct: 777 GLVGCCLLAACVALRYHLFIWSVFSPKLCYYVFWNLFMASIIGW 820

>Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar to
           Ashbya gossypii AEL166C
          Length = 806

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/810 (49%), Positives = 524/810 (64%), Gaps = 10/810 (1%)

Query: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA 60
           M  R ++LLI QLVA+  F  GFFPQK VL  +++F+  P      +P F K+V++VIDA
Sbjct: 1   MLFRAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDA 60

Query: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDFLF+ + S F F+H L+N+G AWG+TAYSNPPTVTLPRLKGITTGS PNFLDAILN
Sbjct: 61  LRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILN 120

Query: 121 VAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180
           VAE            W+ Q   HGK++ F+GDDTWLKLFP  +F   DGTNSFFVSDFE+
Sbjct: 121 VAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEE 180

Query: 181 VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN 240
           VD NVTRHLP  L + QEWD LILHYLGLDHIGHKGG  SQFM  K  EMD ++K IY+ 
Sbjct: 181 VDRNVTRHLPYDL-SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDA 239

Query: 241 VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNAD 300
           VD+ TL+CV+GDHGMND+GNHGGSSAGETSAA+  ISKKL  Y  P  Q GVQ+P+ N+D
Sbjct: 240 VDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSD 299

Query: 301 GEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQL 360
           G  DYQYLTRIQQVDIVPTL +LFNFPIP+NSVGI+I++ L LL    A+IK+ +N +QL
Sbjct: 300 G--DYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLG-TFAEIKVKDNFRQL 356

Query: 361 DSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXXXXXXXXXXXG 420
             ++N        A+ID L + MK  Q DL  +ATNYNY  + +GL+             
Sbjct: 357 MKLANNTPEFAG-ASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEF 415

Query: 421 SNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVYLVDEKYTHF 480
               +       T+                EEEHQIWWWI T A   S V      + HF
Sbjct: 416 YRTFKQTKILSLTVAISLSLGLSMFSSSFVEEEHQIWWWILTAAVGISWVMNPSLTWDHF 475

Query: 481 VILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGSSGDIVTFM 540
           ++ VC R+IR WNNSGQK+  ENT++ IL+R P  +W +N   + +   +    +++TF+
Sbjct: 476 LVSVCARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETVEFNLMTFV 535

Query: 541 CSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTDVFDKSLIPLAQLXXX 600
            SFV   LCL YK  W LVN   VP+WL      +CS ++G   ++  ++L+PLA+L   
Sbjct: 536 SSFVTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLIGP-DNMLKEALVPLARLCFQ 594

Query: 601 XXXXXXXXXXXXXKMGGN-KNSHAISTFITLLLIFQSQSPNIPLFFVFDVLKSSLNKIVS 659
                        +   + K   +I   I  +L+ Q+   NIPLF +F V+K ++N+I++
Sbjct: 595 SILASIVFRVCYNRFKSSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILT 654

Query: 660 KRYNSDAYMISAV-SLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFMMCVS 718
              ++D   IS + SLI+Q FTFF FGGTNSIAT++L+N+YNGVS++YNIY VGF+  +S
Sbjct: 655 NLSSNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFIS 714

Query: 719 NFAPSIYWSTFTWNLLYKTNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFHLFIWSV 778
           NFAP IYWS     +  + NKK H +   +L  L    ++G  L+ +C+ALR+HLFIWSV
Sbjct: 715 NFAPVIYWSLNLIEVYQEPNKK-HTYLVERLPILFHYSVTGVFLLISCLALRYHLFIWSV 773

Query: 779 FSPKLCYYATWNIFMNLVIGWILEIPLALT 808
           FSPKLCYY  W+I +N ++  +   PL LT
Sbjct: 774 FSPKLCYYIAWSILINGLLEHLFN-PLLLT 802

>TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {ON}
           Anc_1.317 YJL062W
          Length = 824

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/810 (50%), Positives = 532/810 (65%), Gaps = 25/810 (3%)

Query: 14  VAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDFLFEKSNSK 73
           +A+++FC GFFP K VL+   +F  E  LQ   KPVF KLV VVIDALRSDFL+E+ NS 
Sbjct: 12  IAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQNSH 71

Query: 74  FSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXX 133
           F F+H +LN G AWGFTA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAE          
Sbjct: 72  FHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQ 131

Query: 134 XXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVDHNVTRHLPKQL 193
             W+ QF+ H K +RFFGDDTWLKLFP   F EY+GTNSFFVSDFEQVD NVTRHL KQ 
Sbjct: 132 DSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLEKQF 191

Query: 194 NNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENVDD--ETLICVMG 251
             +++WD LILHYLGLDHIGHKGG  S+FM  K EEMD IL+ IY ++ D  +TL+CVMG
Sbjct: 192 KEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTLLCVMG 251

Query: 252 DHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQ----NADGEVDYQY 307
           DHGMN+ GNHGGSS+GETSA L +ISKK ++ A P +QI   LP++      + E DY++
Sbjct: 252 DHGMNNGGNHGGSSSGETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKF 311

Query: 308 LTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQLDSIS--- 364
           L+ +QQVD VPTL+ALFN P+P NSVG+LI E L+LLDPKL + KL EN  QL  +S   
Sbjct: 312 LSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSL 371

Query: 365 ---NGHEVIQDEAN-IDQLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXXXXXXXXXXXG 420
              N +  I  + + I+ +   M+ +QS+L +SATNYN + + + +              
Sbjct: 372 TTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATNYNMNAIYIAIILLSIVTLIIIHKA 431

Query: 421 SNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVYLVDEKYTHF 480
            +  +F       +                EEEHQIWWW+ TG    S VY  D K+++F
Sbjct: 432 FSNYKFN---ILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYNSDSKFSNF 488

Query: 481 VILVCLRIIRAWNNSGQKHFNENTVFDILK-RNPTEQWYLNFFAIVICGLKGSSGDIVTF 539
           ++ +CLR+IR WNNSGQK++    +  +LK +    QWYLN   I+    KGS  +  +F
Sbjct: 489 IVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKGSMNNFPSF 548

Query: 540 MCSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTT----DVFDKSLIPLA 595
           M SF+L  LCL+YKV+WA+VN+E VP  +       C+ +M         +F+ +LIPLA
Sbjct: 549 MSSFLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLFESTLIPLA 608

Query: 596 QLXXXXXXXXXXXXXXXXKMGGNKNSHAIST---FITLLLIFQSQSPNIPLFFVFDVLKS 652
           +L                K+   +  + +S     I  LLIFQ+   NI L+ +F +L++
Sbjct: 609 RLFFCCVVILLSLTLVIGKLSPTRLGNPVSNIKKIIIFLLIFQTSPENIGLYLLFGILET 668

Query: 653 SLNKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVG 712
           +L  I+ K Y+ +  +I+ +SL++QYFTF+ FG TNSIAT+DL+NAYNGVSE+YNIY VG
Sbjct: 669 NLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSEDYNIYFVG 728

Query: 713 FMMCVSNFAPSIYWSTFTWNLLYKTNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFH 772
           +MM +SN+AP+IYWS F W ++    +KW  F + K   L+FNCISG  L+  C  LR+H
Sbjct: 729 WMMSISNYAPAIYWSMFPW-IIDDNKQKWKKFIERKNIILLFNCISGLFLLITCTILRYH 787

Query: 773 LFIWSVFSPKLCYYATWNIFMNLVIGWILE 802
           LFIWSVFSPKLCYY  WNIFMN++IGWILE
Sbjct: 788 LFIWSVFSPKLCYYMMWNIFMNVIIGWILE 817

>AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL062W
           (LAS21)
          Length = 806

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/805 (48%), Positives = 502/805 (62%), Gaps = 10/805 (1%)

Query: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA 60
           M+ + + LL  QL+AV +F AGFFPQKKVLK +AQF      Q   +P F+KLVLVVIDA
Sbjct: 1   MRFKEVGLLFCQLLAVLIFAAGFFPQKKVLKGDAQFQYMAETQRALEPAFDKLVLVVIDA 60

Query: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LR+DFLF+++ S F F+H LLN G AWGFTAYSNPPTVTLPRLKGITTGS PNFLDAILN
Sbjct: 61  LRADFLFQQNVSHFDFVHELLNRGEAWGFTAYSNPPTVTLPRLKGITTGSAPNFLDAILN 120

Query: 121 VAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180
           VAE            W+ QF  HGKK+ FFGDDTWLKLFP+E+F ++DGTNSFFVSDFE+
Sbjct: 121 VAEDDSSSNLKDQDSWISQFAKHGKKIHFFGDDTWLKLFPEEFFQKHDGTNSFFVSDFEE 180

Query: 181 VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN 240
           VD NVTRHLP +L + ++WD LILHYLGLDHIGHKGG  SQFMP K  EMD +++QIY+ 
Sbjct: 181 VDTNVTRHLPHELQH-KDWDVLILHYLGLDHIGHKGGAASQFMPPKHREMDAVIRQIYDQ 239

Query: 241 VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNAD 300
           VD+ TL+CVMGDHGMND+GNHGGSSAGETSA +  ISK L  Y  PA Q GV  PV  A+
Sbjct: 240 VDNRTLLCVMGDHGMNDLGNHGGSSAGETSAGMVFISKMLSSYPRPAAQDGVSSPVTAAE 299

Query: 301 GEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQL 360
              DYQ+ TRIQQVD VPT+A+LFN PIPKNS+G+ ++E   LL  + A  K++EN  QL
Sbjct: 300 ---DYQFFTRIQQVDFVPTIASLFNIPIPKNSLGVFVREFSSLLG-QHATTKIIENYHQL 355

Query: 361 DSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXXXXXXXXXXXG 420
             ++      +   +ID +   MKD+Q+ L R+ATNYNY ++ +G+              
Sbjct: 356 MQLAAKKTAARGNDDIDSMLAEMKDVQATLARTATNYNYAMLFLGVGMLSIVTAATAYCY 415

Query: 421 SNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVYLVDEKYTHF 480
            +           +                EEEHQIWWWI       S         +H 
Sbjct: 416 ISSARLNEASVLMIAVTALLGSSVFGSSFVEEEHQIWWWIIIAVVGYSWATRPSCTPSHL 475

Query: 481 VILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGSSGDIVTFM 540
           V LVC R++R WNNSGQK   + TV ++LK +P+ +W L    + +  L G +   +  +
Sbjct: 476 VFLVCARLLRGWNNSGQKFMYDFTVAELLKSHPSIKWLLVCATLAVVALDGFTERPLLSI 535

Query: 541 CSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTDVFDKS-LIPLAQLXX 599
            + +   L  VYK  WA VN E  P +   +  K+CS++    T   DK  L+PLA+L  
Sbjct: 536 FNLLAGLLWFVYKTCWANVNGEVSPTYAQTLVTKACSLLFAGGTPWDDKQLLVPLARLFF 595

Query: 600 XXXXXXXXXXXXXXKM-GGNKNSHAISTFITLLLIFQSQSPNIPLFFVFDVLKSSLNKIV 658
                          +    K    +    T++LI Q+ S NIPLF VF +++SSL  I+
Sbjct: 596 KVTAAIVCMRIAYNVVFAKRKFLSELFPLFTIVLIMQTASQNIPLFLVFTIMRSSLRNIL 655

Query: 659 SKRY-NSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFMMCV 717
              Y      M   +SLILQ  +FF FGGTNSIAT+DL+N+YNG+SENYNIY VG +MC+
Sbjct: 656 RVGYPQQRCEMFFVLSLILQNLSFFQFGGTNSIATIDLTNSYNGISENYNIYVVGLLMCI 715

Query: 718 SNFAPSIYWSTFTWNLLYKTNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFHLFIWS 777
            N AP+IYWS          +KK  ++ Q KL+ + F  ++   L+ AC+ +R+HLFIWS
Sbjct: 716 GNMAPAIYWSLAAVVDHQLYSKK--SYAQQKLSSMFFYSVNSLLLLVACICMRYHLFIWS 773

Query: 778 VFSPKLCYYATWNIFMNLVIGWILE 802
           VFSPKLCY   WNI ++ +   +LE
Sbjct: 774 VFSPKLCYLLGWNILIHFLTETVLE 798

>CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062w LAS21
          Length = 842

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/845 (46%), Positives = 519/845 (61%), Gaps = 45/845 (5%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSD 64
           L  L+++  +AV +F  GFFPQKKVL   A      A      PVF+KLV+VV+DA+RSD
Sbjct: 2   LFLLVVAHAIAVLIFGCGFFPQKKVLDGHAALDGTHA----RDPVFDKLVVVVVDAMRSD 57

Query: 65  FLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEX 124
           FLF+ S SKF F+H  L +GSAWGFTA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAE 
Sbjct: 58  FLFDASISKFHFIHEKLADGSAWGFTAHSNPPTVTLPRLKGITTGSTPNFLDAILNVAED 117

Query: 125 XXXXXXXXXXXWVRQFFSH-GKKLRFFGDDTWLKLFP--------KEYFDEYDGTNSFFV 175
                      W+ QF ++ GK++RFFGDDTWLKLFP        +  FDEY+GTNSFFV
Sbjct: 118 DTSSSLLAQDSWLWQFRNNAGKRIRFFGDDTWLKLFPPVEANEDSQTMFDEYEGTNSFFV 177

Query: 176 SDFEQVDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILK 235
           SDF QVD NVTRH+ +QL    EWD LILHYLGLDHIGHK GP S+FM  K EEMD I++
Sbjct: 178 SDFTQVDLNVTRHIDRQLRETSEWDVLILHYLGLDHIGHKDGPYSRFMGPKHEEMDSIIR 237

Query: 236 QIYENVD-DETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQ----- 289
           ++Y+ +D   TL+ +MGDHGMND+GNHGGSSAGETSA +  +S KL  Y P  EQ     
Sbjct: 238 KLYDELDMQSTLLVLMGDHGMNDLGNHGGSSAGETSAGMVFLSDKLAAYKPSKEQSSAKE 297

Query: 290 IGVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLL-DPKL 348
             +++P  NA  E  + YL +IQQ+D+VPT+++LFN  IPKN+VG++I E LQL  D  L
Sbjct: 298 FPMKIPSLNAGEEKTFHYLKKIQQIDVVPTISSLFNVAIPKNNVGVIIPEFLQLFKDVSL 357

Query: 349 AKIKLLENLKQLDSISNGHEVIQDEAN---IDQLYDLMKDIQSDLTRSATNYNYDLMGMG 405
            K  + EN  QL  ++ G   I +E     I+ +   MKD+Q +L ++AT+YNY L+ +G
Sbjct: 358 QKAIVKENWNQLSGLTKGKTQIMEETKNFVIEDVIKNMKDVQENLAKTATDYNYPLLFIG 417

Query: 406 LAXXXXXXXXXXXXGSNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGAT 465
                          +  +         +                EEEHQ WWWI TG  
Sbjct: 418 CFLSIVITGTIYYRYARHVAININTSILIAIAALMGISVFGSSFIEEEHQFWWWIITGLV 477

Query: 466 LASSVYLVDEKY-THFVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAI 524
           L S V L    + +H ++L CLR+IR WNNSGQK+  +N + ++LK N    W+LN   +
Sbjct: 478 LLSMVNLNFSSWKSHIIVLFCLRLIRGWNNSGQKYTYDNVIANLLKGNIDALWWLNLITV 537

Query: 525 VICGLKGSS---GDIVTFMCSF-------VLTALCLVYKVTWALVNRETVPHWLYEVAYK 574
            + GL   S   G+    +  F       +L+ +  +YKV W++VN E VP   Y+   +
Sbjct: 538 TVVGLNLKSLRFGNHTVSLLGFSDLLSMGLLSMITFLYKVNWSIVNGERVPDLFYKWVLE 597

Query: 575 SCSIMMGDTT-----DVFDKSLIPLAQLXXXXXXXXXXXXXXXXKM----GGNKNSHAIS 625
           + S+++ D T     D+   +LIPLA++                K       +K+   +S
Sbjct: 598 TASLIVEDATLYREEDLIHTALIPLARIFFKLFFAVLVSRLMIQKFFQVSDISKSLAVVS 657

Query: 626 TFITLLLIFQSQSPNIPLFFVFDVLKSSLNKIVSKRYNSDAYMISAVSLILQYFTFFHFG 685
            ++T+ L+FQ+ S NI LF  F+++      I+ +RY SD  +     +ILQ+FTFF  G
Sbjct: 658 RYVTIFLVFQTPSHNIGLFLFFEIINEITVHIIRERYQSDYLLAVIFGIILQFFTFFQSG 717

Query: 686 GTNSIATVDLSNAYNGVSENYNIYAVGFMMCVSNFAPSIYWSTFTWNLLY--KTNKKWHN 743
           GTNSIATVDLSNAYNGVSENYNIY VG MMC+SNFAP+IYWS + W + Y    + +W  
Sbjct: 718 GTNSIATVDLSNAYNGVSENYNIYVVGLMMCISNFAPTIYWSFYNWRITYANANSSRWQT 777

Query: 744 FFQSKLTFLMFNCISGCCLMFACVALRFHLFIWSVFSPKLCYYATWNIFMNLVIGWILEI 803
              +K  F++     GCCL+ AC+ LR+HLFIWSVFSPKLCYY  W IF+ +++ WI EI
Sbjct: 778 LVAAKYPFIIIQSTIGCCLLLACIILRYHLFIWSVFSPKLCYYMVWTIFVGIIVHWIPEI 837

Query: 804 PLALT 808
            L LT
Sbjct: 838 LLLLT 842

>KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 787

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/804 (47%), Positives = 507/804 (63%), Gaps = 43/804 (5%)

Query: 1   MQKRLLALLIS-QLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVID 59
           M ++L  +L + QLVAV LFC GFFPQK VLK++++FI  P +Q  +KPVF KLVLVVID
Sbjct: 1   MGRKLYYVLATLQLVAVFLFCGGFFPQKVVLKNDSKFIVNPEVQLASKPVFKKLVLVVID 60

Query: 60  ALRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAIL 119
           ALRSDFLF+K +S F FLH LLN G AWG+TAYSNPPTVTLPRLKGITTGS PNFLDAIL
Sbjct: 61  ALRSDFLFQKDSSDFEFLHGLLNSGEAWGYTAYSNPPTVTLPRLKGITTGSAPNFLDAIL 120

Query: 120 NVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFE 179
           NVAE             ++QF +H  K+ FFGDDTWLKLFP E+F EYDGTNSFFVSDFE
Sbjct: 121 NVAEDDTSSNLKEQDSLLKQFHTHHYKMNFFGDDTWLKLFPLEFFSEYDGTNSFFVSDFE 180

Query: 180 QVDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYE 239
           +VD NVTRH+P Q+ +Q+ WD LILHYLGLDHIGHKGG  S FMP+K  EMD ++KQIYE
Sbjct: 181 EVDFNVTRHVPYQMEHQKNWDVLILHYLGLDHIGHKGGSKSHFMPSKHREMDSVIKQIYE 240

Query: 240 NVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNA 299
            +D +TL+ V+GDHGMND+GNHGGSS+GETSAALA +SK+L++Y     Q    +PV+  
Sbjct: 241 KIDGDTLMVVLGDHGMNDLGNHGGSSSGETSAALAFLSKRLKKYQSSDIQQSSNVPVE-- 298

Query: 300 DGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQ 359
           D   DY+YL  ++Q+DIVPTL+ LFN PIPKNS+G++I E LQLL  KLA IK+ +N  Q
Sbjct: 299 DAHPDYKYLKEVEQIDIVPTLSMLFNLPIPKNSMGVIIDELLQLLPSKLAAIKVQDNYLQ 358

Query: 360 LDSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLAXXXXXXXXXXXX 419
           L  +  G+E   ++ +   L + M++IQS L  +ATNYNY  +  G              
Sbjct: 359 LTKLKPGYEAQLEKKSAGTLLEEMREIQSSLAMAATNYNYTFLTYGTTLMIIGTLIVTVW 418

Query: 420 GSNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSVYLVDEKYTH 479
                +    +   +                EEEHQIWWWI+    L   +         
Sbjct: 419 ---NFQLSQEYIEHVGTSVLLGISMFASSFIEEEHQIWWWITISVLLLMQI----SNGKK 471

Query: 480 FVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGL-----KGSSG 534
            V+L  LR+IR WNNSGQK+  +N +  +LK + +  W+LN    +  G      K  S 
Sbjct: 472 LVVLSGLRLIRGWNNSGQKYIYDNVLHTLLKSHTSVLWWLNVVTFLSVGFPFLRNKDESE 531

Query: 535 DIVTFMCSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGD---TTDVFDKSL 591
            +V+ +    L    + YK+ +A+VN + VP  LY  A +SC++ + +   T     + L
Sbjct: 532 KMVSLLSVSFLALSSITYKICFAIVNGDKVPSGLYTFALRSCAMYLANENATESDISQCL 591

Query: 592 IPLAQLXXXXXXXXXXXXXXXXKMGGNKNSHAISTFITLL---LIFQSQSPNIPLFFVFD 648
           +P+A++                K   NK+++ ++  ++++   L+ Q+ S NIPLF +F+
Sbjct: 592 VPIARI-FFQICGVSIIILLFMKYALNKSTNMLNKLLSVIKFVLLLQTSSANIPLFLIFE 650

Query: 649 VLKSSLNKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNI 708
           +L S    I               SL LQ  TFF FGGTNSIATV+L+NAYNGVS NYNI
Sbjct: 651 ILTSVTPDIT-----------PIFSLCLQNLTFFQFGGTNSIATVNLTNAYNGVSSNYNI 699

Query: 709 YAVGFMMCVSNFAPSIYWSTFTWNLLYKTNKKWHNFFQSKLTFLMFNCISGCCLMFACVA 768
           Y VG +M +SN+APSIYW+    +L+ ++ K+       K   L    I+G CLM AC+A
Sbjct: 700 YVVGVLMFLSNYAPSIYWAL---SLIPQSYKQ-------KTLRLQHYYITGTCLMIACIA 749

Query: 769 LRFHLFIWSVFSPKLCYYATWNIF 792
           LR+HLFIWSVFSPKLCYYA W+++
Sbjct: 750 LRYHLFIWSVFSPKLCYYAAWSLY 773

>YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}
           LAS21Integral plasma membrane protein involved in the
           synthesis of the glycosylphosphatidylinositol (GPI) core
           structure; mutations affect cell wall integrity
          Length = 830

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/836 (45%), Positives = 512/836 (61%), Gaps = 47/836 (5%)

Query: 3   KRLLALLISQLVAVSLFCAGFFPQKKVLK--SEAQFIEEPALQNEAKPVFNKLVLVVIDA 60
           K+   L  +QL+A+ LF   FFP+K VL   S+    ++  LQ + +P F KLV V+IDA
Sbjct: 4   KQFTCLSCAQLLAILLFIFAFFPRKIVLTGISKQDPDQDRDLQRD-RP-FQKLVFVIIDA 61

Query: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDFLF+   S F+ +H  LN G AWG+T+++NPPTVTLPRLK ITTGSTP+F+D +LN
Sbjct: 62  LRSDFLFDSQISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLN 121

Query: 121 VAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180
           VA+            W++QF  H   +RF GDDTWLKLFP+++FD  D T+SFFVSDF Q
Sbjct: 122 VAQDIDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPQQWFDFADPTHSFFVSDFTQ 181

Query: 181 VDHNVTRHLPKQLNNQ-QEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYE 239
           VD+NVTR+LP +L  +  +WD  ILHYLGLDHIGHK GP+S+FM AK +EMD ILK IY+
Sbjct: 182 VDNNVTRNLPGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMAAKHQEMDSILKSIYD 241

Query: 240 NV-----DDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQL 294
            V     DD+TLICV+GDHGMN++GNHGGSSAGETSA L  +S KL ++A P  Q+   L
Sbjct: 242 EVLEHEDDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLAQFARPESQVNYTL 301

Query: 295 PVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLL 354
           P+ NA  + ++QYL  +QQ+DIVPT+AALF  PIP NSVGI+I + LQLL  KLA +K  
Sbjct: 302 PI-NASPDWNFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASMK-- 358

Query: 355 ENLKQLDSISNGH-EVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLM-----GMGLAX 408
           EN   L  +S+ H EV  D+   + +Y  M  IQ  LT+SATNYNY L+     G  +  
Sbjct: 359 ENFMHLWKLSDHHGEVALDDFTAEDIYTKMYTIQETLTKSATNYNYPLLTLAFVGFLIIT 418

Query: 409 XXXXXXXXXXXGSNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTG-ATLA 467
                      G +  +        +                EEEHQ+WWWI T  + + 
Sbjct: 419 IIAIYVLLRYSGPDFWQLRVSSLSVLLVSIILGVSTFASSFIEEEHQLWWWIVTAFSAVP 478

Query: 468 SSVY----LVDEKYTHFVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFA 523
             VY    L+  ++  F+++ C+R I+ WNNSGQK    N + ++L +NP+ +W LN   
Sbjct: 479 LFVYRLNVLIIVRW--FIMMACVRSIKFWNNSGQKFIYSNVMSNLLNQNPSWKWCLNMLT 536

Query: 524 IVICGLKGSSGDIVTFMCSFVLTALCLVYKVTWALV--NRETVPHWLYEVAYKSCSIMMG 581
            ++  +  +   ++ F+ + +L  LC  YK++W +V  N+  +P +++++  K   I   
Sbjct: 537 FLVLIMASAGFQVLHFIVTTILVGLCFTYKISWEIVNGNQAEIPLFMHDLLAK---IDFA 593

Query: 582 DTTDVFDKSLIPLAQLXXXXXXXXXXXXXXXXKMGG-NKNS--HAISTFITLLLIFQSQS 638
            T    + +LI LA++                K+   NKN     +  +IT+LL+FQ+ S
Sbjct: 594 PT----ESNLIVLARVFFQAWAIVVISRLVLTKLKVLNKNYLIKDMKVYITILLMFQTSS 649

Query: 639 PNIPLFFVFDVLKSSL------NKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIAT 692
            NI  F VF +L+S +          S    S  Y  + VSLILQ FTFF FGGTNSI+T
Sbjct: 650 QNIGQFLVFQILESQIFYFFQNIPTASLTSTSKIYFSNLVSLILQNFTFFQFGGTNSIST 709

Query: 693 VDLSNAYNGVSENYNIYAVGFMMCVSNFAPSIYWSTFTWNLLYKT---NKKWHNFFQSKL 749
           +DL NAY+GVS +YNIY VG +M V+NFAP+IYWS   W++ Y +     K   F +SKL
Sbjct: 710 IDLGNAYHGVSSDYNIYVVGILMSVANFAPAIYWSMLPWSINYASIPAQVKLQTFIRSKL 769

Query: 750 TFLMFNCISGCCLMFACVALRFHLFIWSVFSPKLCYYATWNIFMNLVIGWILEIPL 805
               ++CI G CLM ACV LRFHLFIWSVFSPKLCY+  WN  M L+ GW+ E+ L
Sbjct: 770 PAFTYHCIFGTCLMTACVVLRFHLFIWSVFSPKLCYFLGWNFVMGLLNGWLPELAL 825

>Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062W
           (REAL)
          Length = 831

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/834 (44%), Positives = 506/834 (60%), Gaps = 46/834 (5%)

Query: 3   KRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALR 62
           K+L  +  +QL+A+ LF   FFP+K VL   +Q   +     +    F KLV V+IDALR
Sbjct: 4   KQLTCITCAQLLAIVLFIFAFFPRKIVLTGISQQDADQDRDLQHNRPFQKLVFVIIDALR 63

Query: 63  SDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVA 122
           SDFLF+   S F+ +H  LN G AWG+T+++NPPTVTLPRLK ITTGSTP+F+D +LNVA
Sbjct: 64  SDFLFDSHISHFNNVHEWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVA 123

Query: 123 EXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVD 182
           +            W++QF  H   +RF GDDTWLKLFP+E+FD  D T+SFFVSDF QVD
Sbjct: 124 QDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPQEWFDFTDPTHSFFVSDFTQVD 183

Query: 183 HNVTRHLPKQLNNQ-QEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV 241
           +NVTR+LP ++  +  +WD  ILHYLGLDHIGHK GP+S+FM  K +EMD ILK IY+ V
Sbjct: 184 NNVTRNLPGKIFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMGTKHQEMDSILKSIYDQV 243

Query: 242 -----DDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPV 296
                +++TLICV+GDHGMN++GNHGGSSAGETSA L  +S KL ++  P  QI   LP+
Sbjct: 244 LVHEHEEDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSKFVKPESQINRTLPI 303

Query: 297 QNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLEN 356
            NA  + D+QYL  +QQ+DIVPT+AALF  PIP NSVGI+I + LQLL  KLA IK  EN
Sbjct: 304 -NAAPDRDFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASIK--EN 360

Query: 357 LKQLDSISNGH-EVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMG-----LAXXX 410
              L  +S+ + +   D+  ID +Y  M  IQ  LT+SATNYNY L+ +      +    
Sbjct: 361 FMHLWKLSDHNGDFTLDDLTIDGIYTKMYSIQETLTKSATNYNYPLLALAFISFLIITII 420

Query: 411 XXXXXXXXXGSNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLAS-- 468
                    GS+  +        +                EEEHQ+WWWI T  ++    
Sbjct: 421 AIYQLQRNSGSSLWQPRTSPLSVLLISVILGISTFASSFIEEEHQLWWWIVTAFSVVPLF 480

Query: 469 ----SVYLVDEKYTHFVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAI 524
               +V++V      F+++VC+R+I+ WNNSGQK    N + ++L +NP  +W+LN F +
Sbjct: 481 VYNLNVFVVAR---WFIMMVCVRLIKFWNNSGQKFIYSNVMSNLLNQNPIWKWWLNLFTL 537

Query: 525 VICGLKGSSGDIVTFMCSFVLTALCLVYKVTWALV--NRETVPHWLYEVAYKSCSIMMGD 582
           +   +  S   ++ F+ + +L  LC  YK++W +V  N+  +P +++++  K   +    
Sbjct: 538 LALIIASSRFQVLHFIVTTILVGLCFTYKISWEIVNGNQAEIPIFMHDLLAKIDFVPT-- 595

Query: 583 TTDVFDKSLIPLAQLXXXXXXXXXXXXXXXXKMGG-NKNS--HAISTFITLLLIFQSQSP 639
                + +LI LA++                K+   NKN     I  +IT+LLI Q+ S 
Sbjct: 596 -----ESNLILLARVFFQAWAIVVVSRLVLTKLKVLNKNYLIEDIKVYITILLILQTSSQ 650

Query: 640 NIPLFFVFDVLKS-------SLNKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIAT 692
           NI  F +F +L+S       SL        +S  Y+ + VSLILQ FTFF FGGTNSI+T
Sbjct: 651 NIGQFIIFQILQSQIYYFFKSLPAPFLLTPSSKVYLSNLVSLILQNFTFFQFGGTNSIST 710

Query: 693 VDLSNAYNGVSENYNIYAVGFMMCVSNFAPSIYWSTFTWNLLYKTNK---KWHNFFQSKL 749
           +DL NAY+GVS +YN+  VG +M ++NFAPSIYWS   W++ Y +     K   F +SKL
Sbjct: 711 IDLGNAYHGVSSDYNMCTVGMLMSIANFAPSIYWSMLPWSMNYDSTSSQVKIQTFIRSKL 770

Query: 750 TFLMFNCISGCCLMFACVALRFHLFIWSVFSPKLCYYATWNIFMNLVIGWILEI 803
               ++CI G CLM AC+ LRFHLFIWSVFSPKLCY+  WN  M  + GWI E+
Sbjct: 771 PAFTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNFVMGFLNGWITEL 824

>Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {ON}
           YJL062W (REAL)
          Length = 831

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/833 (44%), Positives = 496/833 (59%), Gaps = 40/833 (4%)

Query: 3   KRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALR 62
           K+   L  +QL A+ LF   FFP+K VL   +Q   +     +    F KLV V+IDALR
Sbjct: 4   KQFTCLSCAQLFAILLFIFAFFPRKIVLTGISQQDPDEDRDLQHNRPFQKLVFVIIDALR 63

Query: 63  SDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVA 122
           SDFLF+   S F+ +H  LN G AWG+T+++NPPTVTLPRLK ITTGSTP+F+D +LNVA
Sbjct: 64  SDFLFDAQISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVA 123

Query: 123 EXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVD 182
           +            W++QF  H   +RF GDDTWLKLFP E+FD  D T+SFFVSDF QVD
Sbjct: 124 QDIDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFADPTHSFFVSDFTQVD 183

Query: 183 HNVTRHLPKQLNNQ-QEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV 241
           +NVTR+L K+L  +  +WD  ILHYLGLDHIGH+ GP+S+FM  K +EMD ILK IY+ V
Sbjct: 184 NNVTRNLQKKLFQEWAQWDVAILHYLGLDHIGHRDGPHSKFMGTKHQEMDSILKSIYDQV 243

Query: 242 -----DDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPV 296
                DD+TLICV+GDHGMN++GNHGGSSAGETSA L  +S KL R+A P  Q    LP+
Sbjct: 244 LEHENDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSRFAKPEPQETHILPI 303

Query: 297 QNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLEN 356
            N   + D+QYL  +QQ+DIVPT+AALF  PIP NSVGI+I + LQLL  KLA +K  EN
Sbjct: 304 -NGTPDHDFQYLESVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASMK--EN 360

Query: 357 LKQLDSISNGH-EVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLA-----XXX 410
              L  +S+ H +V  D+  I+ +Y  M DIQ  LTRSATNYNY L+ +           
Sbjct: 361 FMHLWRLSDHHDDVALDDFTINDIYTKMHDIQETLTRSATNYNYPLLAVAFVSFLFTTIV 420

Query: 411 XXXXXXXXXGSNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTGATLASSV 470
                    G +           +                EEEHQ+WWWI T +++    
Sbjct: 421 AVYQLQRYSGPSFCHLHISSLSVILVSVILGVSTFASSFIEEEHQLWWWIVTASSVVPLF 480

Query: 471 YLVDEKYTH---FVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVIC 527
                 +     F+++ C+R+I+ WNNSGQK    N + ++L +NP  +WYLN    +  
Sbjct: 481 LYPSNAFVFARWFIMIACVRLIKFWNNSGQKFIYSNVMSNLLNQNPFWKWYLNSSTFLAL 540

Query: 528 GLKGSSGDIVTFMCSFVLTALCLVYKVTWALV--NRETVPHWLYEVAYKSCSIMMGDTTD 585
            +  +   ++ F+ + +L  LC  YK++W +V  N+  +P ++  +  K   +       
Sbjct: 541 IIPSARSQLLHFIVTTILVGLCFTYKISWEIVNGNQAEIPPFMQGLLTKMDFLPT----- 595

Query: 586 VFDKSLIPLAQLXXXXXXXXXXXXXXXXKMGGNKNSHAIST---FITLLLIFQSQSPNIP 642
             + +L+ LA++                K+      + I     +IT+LLIFQ+ S NI 
Sbjct: 596 --ENNLLLLARVFFQAWSIVVISRLALTKLKVLDKRYLIEDMKLYITVLLIFQTSSQNIG 653

Query: 643 LFFVFDVLKSS-------LNKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDL 695
            F +F +L+S        L   +S    S+ Y+ S VSLILQ FTFF FGGTNSI+T+DL
Sbjct: 654 QFIIFQILQSQIYYFFQHLPTSLSLTSPSEVYLSSLVSLILQNFTFFQFGGTNSISTIDL 713

Query: 696 SNAYNGVSENYNIYAVGFMMCVSNFAPSIYWSTFTWNLLY---KTNKKWHNFFQSKLTFL 752
            NAY+GVS +YNIY VG +M V+NFAP+IYWS   W++ Y    +  K   F  SK+   
Sbjct: 714 GNAYHGVSSDYNIYVVGILMSVANFAPAIYWSMLPWSINYGSASSQNKLQTFIMSKMPAF 773

Query: 753 MFNCISGCCLMFACVALRFHLFIWSVFSPKLCYYATWNIFMNLVIGWILEIPL 805
            ++CI G CLM AC+ LRFHLFIWSVFSPKLCY+  WN+ M L+ GW+ E+ +
Sbjct: 774 TYHCIFGACLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGLLNGWLPELAI 826

>Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON}
           YJL062W (REAL)
          Length = 830

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/836 (44%), Positives = 502/836 (60%), Gaps = 43/836 (5%)

Query: 3   KRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFI----EEPALQNEAKPVFNKLVLVVI 58
           K+L+ L  +QL A+ LF   FFP+K VL   +Q      ++  LQ+E +P F KLV VVI
Sbjct: 4   KQLMCLSCAQLFAILLFIFAFFPRKIVLPGISQQAPDQDQDRDLQHE-RP-FQKLVFVVI 61

Query: 59  DALRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAI 118
           DALRSDFLF+   S F+ +H  LN G AWG+T+++NPPTVTLPRLK ITTGSTP+F+D +
Sbjct: 62  DALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLL 121

Query: 119 LNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDF 178
           LNVA+            W++QF  H   +RF GDDTWLKLFP E+FD  D T+SFFVSDF
Sbjct: 122 LNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDF 181

Query: 179 EQVDHNVTRHLPKQLNNQ-QEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQI 237
            QVD+NVTR+L  +L  +  +WD  ILHYLGLDHIGHK GP+S+FM  K +EMD ILK I
Sbjct: 182 TQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTI 241

Query: 238 YENV-----DDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGV 292
           Y+ V     DD+TLICV+GDHGMN++GNHGGSSAGETSA L  +S KL ++  PA Q   
Sbjct: 242 YDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAEN 301

Query: 293 QLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIK 352
            LP+ N   + D+QYL  +QQ+DIVPT+AALF  PIP NSVGI+I + LQLL  K+A +K
Sbjct: 302 ALPI-NGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK 360

Query: 353 LLENLKQLDSISNGH-EVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLA---- 407
             EN   L  +S+   EV+ D+ +I  +Y  M DIQ  LT+SATNYNY L+ +  A    
Sbjct: 361 --ENFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLI 418

Query: 408 -XXXXXXXXXXXXGSNRMEFGHPFFFTMXXXXXXXXXXXXXXXXEEEHQIWWWISTG-AT 465
                        G    +        +                EEEHQ+WWWI T  A 
Sbjct: 419 ITIIATYQLQRHSGPTFCKLRTSSLSVLLVSVILGVSTFASSFIEEEHQLWWWIVTAFAA 478

Query: 466 LASSVYLVDEKYTH--FVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFA 523
           +    Y ++       F++L C+R+I+ WNNSGQK    N +  IL RNP  +W LN   
Sbjct: 479 VPLFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLT 538

Query: 524 IVICGLKGSSGDIVTFMCSFVLTALCLVYKVTWALVN--RETVPHWLYEVAYKSCSIMMG 581
            +I  +      ++  + S +L  LC  YK++W +VN  +  +P +L ++  K   I   
Sbjct: 539 FLILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTKIDFIPN- 597

Query: 582 DTTDVFDKSLIPLAQLXXXXXXXXXXXXXXXXKMGGNKNSHAIST---FITLLLIFQSQS 638
                 + +LI LA++                K+      + I     +IT+LLI Q+ S
Sbjct: 598 ------ESNLITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSS 651

Query: 639 PNIPLFFVFDVLKSSL----NKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVD 694
            NI LF VF +L+S +        S    +  Y+ + VSL+LQ F+FF FGGTNSI+T+D
Sbjct: 652 QNIGLFIVFQILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTID 711

Query: 695 LSNAYNGVSENYNIYAVGFMMCVSNFAPSIYWSTFTWNLLYK---TNKKWHNFFQSKLTF 751
           L NAY+G+S +YNI  VG +M ++NFAP+IYWS   W++ Y+   +  K   F +SKL  
Sbjct: 712 LGNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPA 771

Query: 752 LMFNCISGCCLMFACVALRFHLFIWSVFSPKLCYYATWNIFMNLVIGWILEIPLAL 807
             ++CI G CLM AC+ LRFHLFIWSVFSPKLCY+  WN+ M  + GW+ E+ + L
Sbjct: 772 FTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVIL 827

>KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa]
           {ON} similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1016

 Score =  201 bits (512), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 136/407 (33%), Positives = 206/407 (50%), Gaps = 41/407 (10%)

Query: 7   ALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDFL 66
           +L + Q++A++ F  GF   + VL++ A         +EA+  F+K V++VIDALR DF 
Sbjct: 47  SLAVLQIIAIAFFARGFLLTRTVLENVAT-----GADHEAR--FSKCVILVIDALRFDFS 99

Query: 67  FEKSNSKFSF----------LHSLLNEGSAWGFTAY-----SNPPTVTLPRLKGITTGST 111
                +  +F          LH+  N  ++   ++      ++PPT TL RLKG+TTGS 
Sbjct: 100 IPVDPADNAFNSYFHNNLDVLHTSFNNATSETHSSLLLKFIADPPTTTLQRLKGLTTGSL 159

Query: 112 PNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTN 171
           P F+DA  N                ++Q F + + + F GDDTW  LF            
Sbjct: 160 PTFIDAGSNFNGAVIEEDNL-----IKQMFLNNQSVLFAGDDTWDNLFNPFLSPASQPFE 214

Query: 172 SFFVSDFEQVDHNVTRHLPKQL----NNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQ 227
           S  V D + VD+ V R     L       +EWD LI H LG+DH+GHK GPN   M  KQ
Sbjct: 215 SLNVWDLDTVDNGVIRFFEDNLFAKSEKSEEWDVLIGHMLGIDHVGHKYGPNHFTMKEKQ 274

Query: 228 EEMDEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPA 287
            + +E +K+I E++DD+TL+ VMGDHGM+  GNHGG S  E  AAL L SK+   ++   
Sbjct: 275 LQANEFIKRICESIDDDTLLVVMGDHGMDHTGNHGGDSKSELEAALWLHSKRPNMWS--- 331

Query: 288 EQIGVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPK 347
                 LP Q  D     +   ++ Q+D+VPTL+ L   PIP N++G  IQE     +  
Sbjct: 332 -----HLPEQFYDISALGENYRQVNQIDLVPTLSLLLGLPIPFNNLGWPIQEVAATQEQL 386

Query: 348 LAKIKLLENLKQLDSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSA 394
            +  K+   L Q+ +  +   VI      ++L +L+ +   D+ +++
Sbjct: 387 RSYSKI--ALDQIKAYKDISRVITAAEKNERLNELLNESLEDILQAS 431

>Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa]
           {OFF} YLL031C (GPI13) - phosphoryltransferase that adds
           phosphoethanolamine to the third mannose residue of the
           GPI anchor precursor [contig 141] PARTIAL
          Length = 602

 Score =  193 bits (490), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 133/403 (33%), Positives = 194/403 (48%), Gaps = 38/403 (9%)

Query: 7   ALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDF- 65
           ++ + Q++A++ F  GF   + VL       E  A   + +P F+K V++VIDALR DF 
Sbjct: 51  SIAVLQIIAIAFFARGFLLTRTVL-------ENVATHADYEPKFDKCVILVIDALRFDFS 103

Query: 66  --LFEKSNSKFSFLHSLLN---------EGSAWGFTAYSNPPTVTLPRLKGITTGSTPNF 114
             +  + N    + H+ L+           S+      S+PPT TL RLKG+TTGS P F
Sbjct: 104 IPIDPQENGYNPYYHNNLDVFHSGFRDQNHSSLLLKFISDPPTTTLQRLKGLTTGSLPTF 163

Query: 115 LDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFF 174
           +DA  N                ++Q + + K + F GDDTW  LF            S  
Sbjct: 164 IDAGSNFNGAIIEEDNL-----IKQMYLNNKTILFAGDDTWDNLFGTFLSPSSKPYESLN 218

Query: 175 VSDFEQVDHNV----TRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEM 230
           V D + VD+ V      HL     ++  WD LI H LG+DH+GHK GPN   M  KQ + 
Sbjct: 219 VWDLDTVDNGVIDYFEEHLLSPAKDEAHWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQA 278

Query: 231 DEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQI 290
           +E +K+I E +DD+TL+ VMGDHGM+  GNHGG S  E  A L + S K   +       
Sbjct: 279 NEFIKRICEKLDDDTLLVVMGDHGMDHTGNHGGDSRSELEATLWMYSTKPDMWN------ 332

Query: 291 GVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAK 350
              LP    +  V  +    + Q+D+V TL+ L   PIP N++G  IQE      P+  K
Sbjct: 333 --HLPQDAYNTSVLGENHREVNQIDLVSTLSLLLGLPIPFNNLGWPIQEVAT--SPEEVK 388

Query: 351 IKLLENLKQLDSISNGHEVIQDEANIDQLYDLMKDIQSDLTRS 393
           +     L Q+ +  +   VI      + L  L+ D   D++ +
Sbjct: 389 LFSETALNQIRAYKDASNVITSSDKNELLNTLLADAMKDISHA 431

>SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1013

 Score =  196 bits (498), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 138/413 (33%), Positives = 205/413 (49%), Gaps = 41/413 (9%)

Query: 6   LALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDF 65
           LALL  Q +A++ F  GF   + VL       +  A +      F+K V++V+DALR DF
Sbjct: 47  LALL--QFIAIAFFTRGFLLTRHVL-------DNVATKKSEYGTFDKAVVLVVDALRFDF 97

Query: 66  LFEKSNSKFSFLHSLLN-------------EGSAWGFTAYSNPPTVTLPRLKGITTGSTP 112
           +   S ++  +  +  N             E S+      ++PPT TL RLKG+TTGS P
Sbjct: 98  VIPVSETQDYYNENYHNNLEVLYEKFKDVSESSSLLLKFIADPPTTTLQRLKGLTTGSLP 157

Query: 113 NFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNS 172
            F+DA  N                ++Q F + K + F GDDTW  LF     ++     S
Sbjct: 158 TFIDAGSNFNGEVIEEDNL-----IKQMFLNDKTVFFAGDDTWNALFSPFLAEQSRPYES 212

Query: 173 FFVSDFEQVDHNVT----RHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQE 228
             V D + VD+ V      HL ++   Q+EWD LI H LG+DH+GHK GPN   M  KQ 
Sbjct: 213 LNVWDLDTVDNGVISFFKEHLFEKTPAQREWDVLIGHMLGIDHVGHKYGPNHFTMREKQL 272

Query: 229 EMDEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAE 288
           ++D  ++QI E++D++TL+ ++GDHGM+  GNHGG S  E  + L L SKK   +   ++
Sbjct: 273 QVDNFIRQIMESIDEDTLLVILGDHGMDHTGNHGGDSRDELESTLWLHSKKHGMWDHYSD 332

Query: 289 QIGVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKL 348
           +            E+   Y  ++ Q+D+VPTL+ L   PIP N++G  I+E  +  D   
Sbjct: 333 E-------TYDTSELGKNY-RQVNQIDLVPTLSLLLGLPIPFNNLGWPIREIAKTKDELE 384

Query: 349 AKIKLLENLKQLDSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDL 401
              +L   L+QL S  N   VI      ++L  L+ +    L  +    NY L
Sbjct: 385 LYTQL--TLEQLQSYKNISGVINTAEKNEKLESLLANTTFSLDYAPQYQNYFL 435

>Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)
           [2871 bp, 956 aa] {ON} ANNOTATED BY YGOB -
          Length = 956

 Score =  196 bits (497), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 133/403 (33%), Positives = 194/403 (48%), Gaps = 38/403 (9%)

Query: 7   ALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDF- 65
           ++ + Q++A++ F  GF   + VL       E  A   + +P F+K V++VIDALR DF 
Sbjct: 51  SIAVLQIIAIAFFARGFLLTRTVL-------ENVATHADYEPKFDKCVILVIDALRFDFS 103

Query: 66  --LFEKSNSKFSFLHSLLN---------EGSAWGFTAYSNPPTVTLPRLKGITTGSTPNF 114
             +  + N    + H+ L+           S+      S+PPT TL RLKG+TTGS P F
Sbjct: 104 IPIDPQENGYNPYYHNNLDVFHSGFRDQNHSSLLLKFISDPPTTTLQRLKGLTTGSLPTF 163

Query: 115 LDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFF 174
           +DA  N                ++Q + + K + F GDDTW  LF            S  
Sbjct: 164 IDAGSNFNGAIIEEDNL-----IKQMYLNNKTILFAGDDTWDNLFGTFLSPSSKPYESLN 218

Query: 175 VSDFEQVDHNVT----RHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEM 230
           V D + VD+ V      HL     ++  WD LI H LG+DH+GHK GPN   M  KQ + 
Sbjct: 219 VWDLDTVDNGVIDYFEEHLLSPAKDEAHWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQA 278

Query: 231 DEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQI 290
           +E +K+I E +DD+TL+ VMGDHGM+  GNHGG S  E  A L + S K   +       
Sbjct: 279 NEFIKRICEKLDDDTLLVVMGDHGMDHTGNHGGDSRSELEATLWMYSTKPDMWN------ 332

Query: 291 GVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAK 350
              LP    +  V  +    + Q+D+V TL+ L   PIP N++G  IQE      P+  K
Sbjct: 333 --HLPQDAYNTSVLGENHREVNQIDLVSTLSLLLGLPIPFNNLGWPIQEVAT--SPEEVK 388

Query: 351 IKLLENLKQLDSISNGHEVIQDEANIDQLYDLMKDIQSDLTRS 393
           +     L Q+ +  +   VI      + L  L+ D   D++ +
Sbjct: 389 LFSETALNQIRAYKDASNVITSSDKNELLNTLLADAMKDISHA 431

>TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4.28
           YLL031C
          Length = 1005

 Score =  194 bits (493), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 119/349 (34%), Positives = 181/349 (51%), Gaps = 34/349 (9%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSD 64
           L +L + Q +A++ F  GF   ++VL       ++ A++      F+K V++++DALR D
Sbjct: 39  LASLALLQFIAIAFFTRGFLLTRQVL-------DDVAIKTAEYGKFDKAVVLIVDALRFD 91

Query: 65  FLFE------------KSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTP 112
           F+               +N    +     ++GS+      ++ PTVTL RLKG+TTGS P
Sbjct: 92  FVIPVDQDHQGYSGNFHNNIDVLYESMFADQGSSLLLKFIADAPTVTLQRLKGLTTGSLP 151

Query: 113 NFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNS 172
            F+DA  N                ++Q +  GK++ F GDDTW  LF            S
Sbjct: 152 TFIDAGSNFDGSVIEEDNL-----IKQMYEQGKQIYFAGDDTWESLFSPFLSPRSKYYES 206

Query: 173 FFVSDFEQVDHNVTRHLPKQL--NNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEM 230
           F V D + VD+ V  +  + L     ++WD LI H LG+DH+GHK GPN   M  KQ ++
Sbjct: 207 FNVWDLDTVDNGVISYFNEHLLETANRDWDVLIGHMLGVDHVGHKYGPNHFTMREKQLQV 266

Query: 231 DEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQI 290
           ++ L +I E +DD+TL+ +MGDHGM+  GNHGG S  E  + L L SK+   +       
Sbjct: 267 NDFLIKIKETIDDDTLLVIMGDHGMDHTGNHGGDSKDELESTLFLYSKRPNMW------- 319

Query: 291 GVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQE 339
           G+  P Q    ++   Y   + Q+D+VPTL+ L   PIP N++G  I+E
Sbjct: 320 GLNDPSQYNTTDLG-AYYREVNQIDLVPTLSILMGLPIPFNNLGWPIEE 367

>TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4.28
           YLL031C
          Length = 1028

 Score =  193 bits (491), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 133/422 (31%), Positives = 214/422 (50%), Gaps = 54/422 (12%)

Query: 6   LALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDF 65
           +ALL  Q+++++ F  GF   +  ++  AQ+  E    +E K  F+K V++++DALR DF
Sbjct: 49  IALL--QVISIAFFTKGFSFCRSPIRHTAQYSPE---YSEVKK-FDKAVVLLVDALRFDF 102

Query: 66  LF----------EKSNSKFSFLHSLLNE----------------GSAWGFTAYSNPPTVT 99
           +           E  ++    +  LLN+                 S+  F   + PPT T
Sbjct: 103 VVPINELDPIYNENYHNNIDIISELLNQNDNSTKNESKKDRVQKSSSLLFKFLAEPPTTT 162

Query: 100 LPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLF 159
             RLKGITTG  P+FLD I+ + +             ++Q F   K + F GDDTW ++F
Sbjct: 163 FHRLKGITTGLLPSFLDGIMKLNDRVVEDDSI-----IKQLFLRNKTIYFSGDDTWSRMF 217

Query: 160 PKEYFDEYDGTNSFFVSDFEQVDHNVTR----HLPKQLNNQQEWDALILHYLGLDHIGHK 215
                 +     S+ + D   VD  V +    HL  +  + +EWD LI H +G+DH   K
Sbjct: 218 EPYLSPKSVPLESYNIWDLNTVDDGVFKFFNEHLTSKNTSNREWDILIGHIVGIDHAATK 277

Query: 216 GGPNSQFMPAKQEEMDEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALAL 275
            GPN   +  KQ +++E +KQI +++DD+TL+ VMGDHGM+  GNHGG S+GE  ++L L
Sbjct: 278 YGPNHITVKQKQIQINEFIKQIVKSLDDQTLLIVMGDHGMDITGNHGGKSSGELESSLFL 337

Query: 276 ISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGI 335
            SKK   +             +++  E +  +  +I Q+DIVPT + LF  PIP N++G 
Sbjct: 338 YSKKSSVWKQ-----------EHSLHENNNDFYKKINQIDIVPTFSLLFGIPIPYNNLGW 386

Query: 336 LIQETLQLLDPKLAKIKLLENLKQLDSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSAT 395
            I E + L D +   I +   L+Q+       ++IQD+ + + L  L +  + D+ ++  
Sbjct: 387 PINE-ISLSDEE-NNIHMKLALEQIRKYQLDSDIIQDKKDNNTLNTLYEQAKLDINKTHA 444

Query: 396 NY 397
            Y
Sbjct: 445 FY 446

>ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar to
           uniprot|Q07830 Saccharomyces cerevisiae YLL031C
          Length = 1009

 Score =  191 bits (485), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 131/397 (32%), Positives = 200/397 (50%), Gaps = 39/397 (9%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSD 64
           L +L   Q +A++ F  GF   ++VL +    +  P      K  F+K V++VIDALR D
Sbjct: 39  LASLAALQFIAIAFFTRGFLLTRQVLDN----VSSPFPNQYGK--FDKAVVLVIDALRFD 92

Query: 65  FLFEKSNSK-------FSFLHSLLNE----GSAWGFTAYSNPPTVTLPRLKGITTGSTPN 113
           F+     S         + + +L N+    GS+  F   ++PPT TL RLKG+TTGS P 
Sbjct: 93  FVIPVDESHPQHNPNYHNNIKALWNDESLKGSSLLFKFIADPPTTTLQRLKGLTTGSLPT 152

Query: 114 FLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSF 173
           F+DA  N                ++Q +   K + F GDDTW  LF      + +   S 
Sbjct: 153 FIDAGSNFDGSVIEEDNL-----IKQLYLAQKNVYFAGDDTWSALFHPFLSAQSEPYPSL 207

Query: 174 FVSDFEQVDHNVTRHLPKQL-----NNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQE 228
            V D + VD+ V  +  + L        ++WD L+ H LG+DH+GHK GPN   M  KQ 
Sbjct: 208 NVWDLDTVDNGVMSYFERHLLEGGQTRHRDWDVLVGHMLGVDHVGHKYGPNHFTMREKQL 267

Query: 229 EMDEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAE 288
           ++DE +++I   +D +TL+ VMGDHGM+  GNHGG S  E  + L L SK+   + P  +
Sbjct: 268 QVDEFIRKIIAAIDKDTLLIVMGDHGMDHTGNHGGDSIDELESTLFLYSKRPDMWQPNED 327

Query: 289 QIGVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKL 348
                 P      ++   Y  ++ Q+D+VPTL+ L N PIP NS+G  ++E       K 
Sbjct: 328 ------PNVYDVSDLGKNY-KQVNQIDLVPTLSLLLNLPIPFNSLGWPLEEIAT--SKKE 378

Query: 349 AKIKLLENLKQLDSISNGHEVI---QDEANIDQLYDL 382
               +   L+QL +  N   ++   + +A +D L++L
Sbjct: 379 FDFNVRLTLQQLSNYKNVSGMVTNSERQAELDHLWNL 415

>KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C,
          Length = 1005

 Score =  191 bits (485), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 200/391 (51%), Gaps = 39/391 (9%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSD 64
           L +L + Q ++++ F  GF   + VL + A+   +P L  EAK  ++K+VL+++DALR D
Sbjct: 47  LASLAVLQFISIAFFAKGFLLTRTVLDNVAEL--DPQLPFEAK--YDKMVLLIVDALRFD 102

Query: 65  FLF--EKSNSKFS---------FLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPN 113
           F+   +++++K++            +  N   +      ++PPT TL RLKG+TTGS P 
Sbjct: 103 FVIPVDENHAKYNPNYHNNLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPT 162

Query: 114 FLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSF 173
           F+DA  N                ++Q + H KK+ F GDDTW  LF      E     S 
Sbjct: 163 FIDAGSNFNGDVIDEDNL-----IKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESL 217

Query: 174 FVSDFEQVDHNVTRHLPKQLNNQQ---EWDALILHYLGLDHIGHKGGPNSQFMPAKQEEM 230
            V D + VD+ V  +L +   N++   E+D LI H LG+DH+GHK GPN   M  KQ ++
Sbjct: 218 NVWDLDTVDNGVISYLEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQV 277

Query: 231 DEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQI 290
           DE+L++I    DD TL  VMGDHGM+  GNHGG S  E  + L L       YA  A   
Sbjct: 278 DELLRKIISTADDNTLYVVMGDHGMDHTGNHGGDSQDELESVLWL-------YAKNANWS 330

Query: 291 GVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAK 350
                    D    Y+   ++ Q+D+VPTL+ L   PIP N++G  + E     DP+  +
Sbjct: 331 KDYDSYNTTDLGTSYK---QMNQIDLVPTLSLLLGIPIPFNNLGWPLDEIAN--DPE--E 383

Query: 351 IKLLENL--KQLDSISNGHEVIQDEANIDQL 379
           + L  N+   QL+   +   +I   A  D L
Sbjct: 384 LTLYHNICRNQLEKYLSVSNIIGATARRDAL 414

>Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} similar
           to Ashbya gossypii AGR126C
          Length = 1014

 Score =  191 bits (484), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/349 (33%), Positives = 182/349 (52%), Gaps = 33/349 (9%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSD 64
           L +L + Q +A++ F  GF   + VL + A F E      ++   F+K V++++DALR D
Sbjct: 47  LFSLAVLQAIAIAFFTRGFLLSRTVLDNVASFDET----KDSYGKFDKAVILIVDALRFD 102

Query: 65  FLF----------EKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNF 114
           F+           +  ++    L+   +      F A  +PPT TL RLKG+TTGS P F
Sbjct: 103 FVIPVDTAAEGYNDNYHNNLKVLYEYWDNSVLLKFIA--DPPTTTLQRLKGLTTGSLPTF 160

Query: 115 LDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFF 174
           +DA  N                ++Q + H K + F GDDTW  LF     +      S  
Sbjct: 161 IDAGSNFNGDVIVEDNL-----IKQLYLHNKSIYFVGDDTWDALFHPYLSNMSVPYESLN 215

Query: 175 VSDFEQVDHNVTRHLPKQLNNQ----QEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEM 230
           V D + VD+ V  +  + L ++    +EWD LI H LG+DH+GHK GPN   M  KQ+++
Sbjct: 216 VWDLDTVDNGVISYFEEHLLDKDPLDREWDVLIGHMLGIDHVGHKYGPNHFTMSEKQQQV 275

Query: 231 DEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQI 290
           D+ ++++  ++D++TL+ VMGDHGM+  GNHGG S  E  + L L SK+   +       
Sbjct: 276 DKFIRKVIASIDEDTLLVVMGDHGMDHTGNHGGDSNDELESTLWLHSKRKNAWK------ 329

Query: 291 GVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQE 339
            ++ P Q     +   Y  ++ Q+D+VPTL+ L   PIP N++G  + E
Sbjct: 330 -LKSPDQYNTSRLGENY-RQVNQIDLVPTLSLLLGTPIPFNNLGWPVDE 376

>CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highly
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031c GPI13
          Length = 1019

 Score =  191 bits (484), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 129/415 (31%), Positives = 207/415 (49%), Gaps = 52/415 (12%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSD 64
           L AL   Q VA++ F  GF   + VL + +   + P   ++    F+K+VL+V+DALR D
Sbjct: 39  LGALAFLQFVAIAFFAKGFLLSRTVLDNVSTTSDNPLAVDKK---FDKMVLLVVDALRFD 95

Query: 65  FLFEKSNSKFSF---LHSLL-------------------NEGSAWGFTAYSNPPTVTLPR 102
           F+   S S  ++    H+ L                   N GS+      ++PPT TL R
Sbjct: 96  FVVPVSTSHPNYNENFHNNLDVLYNTWLSTRHGGRGGYSNSGSSILLKFIADPPTTTLQR 155

Query: 103 LKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKE 162
           LKG+TTGS P F+DA  N                ++Q F   K + F GDDTW  LF   
Sbjct: 156 LKGLTTGSLPTFIDAGSNFDGSVIEEDNL-----IKQLFLANKSVSFVGDDTWDALFHPF 210

Query: 163 YFDEYDGTNSFFVSDFEQVDHNVTRHLPKQLNNQ---QEWDALILHYLGLDHIGHKGGPN 219
             +  +   S  V D + VD+ V  +    L ++   + WD L+ H LG+DH+GHK GPN
Sbjct: 211 LANNSEPYPSLNVWDLDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPN 270

Query: 220 SQFMPAKQEEMDEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKK 279
              M  KQ +++  +++I E++D++TL+ VMGDHGM+  GNHGG S  E  + L   +K+
Sbjct: 271 HFTMREKQNQVNRFIQEIIESIDNDTLLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKR 330

Query: 280 LRRYAPPAEQIGVQLPVQNADGEVDYQYLTR----IQQVDIVPTLAALFNFPIPKNSVGI 335
              +             +N +G  D + L +    + Q+D+VPTL+ L + P+P N++G 
Sbjct: 331 QNTW-------------KNQNGNYDIENLAQNYHSVNQIDLVPTLSLLLDIPVPFNNLGW 377

Query: 336 LIQETLQLLDPKLAKIKLLENLKQLDSISNGHEVIQDEANIDQLYDLMKDIQSDL 390
            I E  +    +LA   ++  L+QL   ++  ++   E   + +  L ++  +D+
Sbjct: 378 PISEAFENEKEELACDNVV--LQQLKRYADVMQLTYTEELEETMSALWRNSTADV 430

>NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON}
           Anc_4.28
          Length = 1034

 Score =  191 bits (484), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 127/370 (34%), Positives = 195/370 (52%), Gaps = 41/370 (11%)

Query: 6   LALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFN---------KLVLV 56
           ++L I Q +A++ F  GF   + VL++ +   +  ++  E+ P+FN         K V+V
Sbjct: 40  ISLAILQFIAIAFFIKGFLLTRNVLENVSTLNDYTSIL-ESNPIFNNPSDIAKFDKTVIV 98

Query: 57  VIDALRSDFLFEKSNSK----------FSFLHSLLNEGSAWGFTAY----SNPPTVTLPR 102
           VIDALR DF+     S           F  ++   NE S+   +      ++PPT TL R
Sbjct: 99  VIDALRFDFVIPVDESNPNYNPNYHNNFKVMYDHFNETSSADSSLLLKFIADPPTTTLQR 158

Query: 103 LKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKE 162
           LKG+TTGS P F+DA  N                ++Q + + K + F GDDTW  LF   
Sbjct: 159 LKGLTTGSLPTFIDAGSNFDGSVIEEDNL-----IKQMYLNNKTVYFVGDDTWDSLFHPF 213

Query: 163 YFDEYDGTNSFFVSDFEQVDHNVTRHLPKQL----NNQQE---WDALILHYLGLDHIGHK 215
              +     S  V D + VD+ V  +  K+L    NNQ+E   WD LI H LG+DH+GHK
Sbjct: 214 LSSKSQPFESLNVWDLDTVDNGVISYFEKELISKKNNQKEEKEWDVLIGHMLGMDHVGHK 273

Query: 216 GGPNSQFMPAKQEEMDEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALAL 275
            GP+   M  KQ +++E + ++ +++D++TL+ VMGDHGM+  GNHGG S  E  + L L
Sbjct: 274 YGPSHFSMKDKQLQLNEFVTKVIDSLDEDTLLVVMGDHGMDHTGNHGGDSQDELESTLFL 333

Query: 276 ISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGI 335
            SKK + +    +    Q  + N + ++   Y  ++ Q+D+VPTL+ L   PIP N++G 
Sbjct: 334 FSKKQQMWNLDPDN---QETLYNVN-KLGKHY-RQVNQIDLVPTLSLLTGLPIPFNNLGW 388

Query: 336 LIQETLQLLD 345
            I+E  +  D
Sbjct: 389 PIKEIAKNFD 398

>NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON}
           Anc_4.28
          Length = 1011

 Score =  186 bits (473), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 130/388 (33%), Positives = 195/388 (50%), Gaps = 34/388 (8%)

Query: 12  QLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDFLF--EK 69
           Q +A++ F  GF   + VL + A   +  +++N  K  FNK V++V+DALR DF+    +
Sbjct: 46  QFIAIAFFLKGFLLTRNVLDNVATLADYQSIENYGK--FNKSVILVVDALRFDFVIPVNQ 103

Query: 70  SNSKFS-FLHSLLN----------EGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAI 118
           SN  ++ + H+ L             S+      ++PPT TL RLKG+TTGS P F+DA 
Sbjct: 104 SNPDYNDYYHNNLKVLYEKFEDQSSSSSLLLKFMADPPTTTLQRLKGLTTGSLPTFIDAG 163

Query: 119 LNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDF 178
            N                ++Q F + K++ F GDDTW  LF            S  V D 
Sbjct: 164 SNFDGSVIEEDNI-----IKQMFLNDKQVLFVGDDTWDALFNPFLSPMSQPFESLNVWDL 218

Query: 179 EQVDHNVTRHLPKQL---NNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILK 235
           + VD+ V       L    N Q W+ LI H LG+DH+GHK GPN   M  KQ ++D+ ++
Sbjct: 219 DTVDNGVISFFNDHLLENTNDQSWNVLIGHMLGMDHVGHKFGPNHFTMKQKQLQIDKFIR 278

Query: 236 QIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLP 295
           +I +++DD+TL+ +MGDHGM+  GNHGG S  E  + L L SK+   +        +Q  
Sbjct: 279 EIMDSIDDDTLLVIMGDHGMDHTGNHGGDSKDELESTLFLYSKRNNAW-------NLQ-D 330

Query: 296 VQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLE 355
             N D          + Q+D+V TL+ L   PIP N++G  I E       K A      
Sbjct: 331 TSNYDTRNQGDRYRSVNQIDLVSTLSFLLGLPIPFNNLGWPINEI--FCTEKEASSFTNA 388

Query: 356 NLKQLDSISNGHEV-IQDEANIDQLYDL 382
            LKQL + +    + I +E+ +++LY +
Sbjct: 389 ALKQLRTYTEAIGIKINNESLLEELYQI 416

>KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4.28
           YLL031C
          Length = 1017

 Score =  185 bits (470), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 185/351 (52%), Gaps = 32/351 (9%)

Query: 5   LLALLIS-QLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRS 63
           LL  L S Q +A++ F  GF   + VL + ++   +  LQ  + P F++ V++++DALR 
Sbjct: 38  LLMFLASLQFIAIAFFSRGFLLSRHVLDNISKADSQLTLQ--SSPKFDRAVVLIVDALRF 95

Query: 64  DFLF----EKSNSKFSFLHSLLN-----------EGSAWGFTAYSNPPTVTLPRLKGITT 108
           DF+     EK+NS +   H+ +N             S+      ++PPT TL RLKG+TT
Sbjct: 96  DFVIPIEKEKANSNY---HNNINIMYDKFMDNSESCSSLLLKFMADPPTTTLQRLKGLTT 152

Query: 109 GSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYD 168
           GS P F+DA  N                ++Q + H K + F GDDTW  LF     +   
Sbjct: 153 GSLPTFIDAGSNFNGDTIEEDNL-----IKQLYLHDKNVLFVGDDTWDALFNPFLSNNSA 207

Query: 169 GTNSFFVSDFEQVDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQE 228
              S  V D + VD+ V       ++++ EWD L+ H LG+DH+GHK GP+   M  KQ 
Sbjct: 208 PFESLNVWDLDTVDNGVISFFNDHIHSK-EWDVLVGHMLGVDHVGHKYGPDHFTMKEKQT 266

Query: 229 EMDEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAE 288
           +++E +  + +++DD+TL+ VMGDHGM+  GNHGG S  E  + L L SK   ++    +
Sbjct: 267 QVNEFIHYVMQSLDDDTLLVVMGDHGMDRTGNHGGDSIDELESTLFLYSKTPGKFGAMTD 326

Query: 289 QIGVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQE 339
             G Q     +D    Y+    + Q+D+V TL+ +   PIP N++G  I+E
Sbjct: 327 --GNQSIYNISDYGSSYR---SVNQIDLVSTLSLMLGTPIPFNNLGWPIEE 372

>YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}
           GPI13ER membrane localized phosphoryltransferase that
           adds phosphoethanolamine onto the third mannose residue
           of the glycosylphosphatidylinositol (GPI) anchor
           precursor; similar to human PIG-O protein
          Length = 1017

 Score =  184 bits (467), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 122/379 (32%), Positives = 195/379 (51%), Gaps = 43/379 (11%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAK---PVFNKLVLVVIDAL 61
           L+ + I Q ++++ F  GF   + VL + +        QNE     P FNK V++VIDAL
Sbjct: 39  LVFIAILQFISIAFFTRGFLLSRHVLDNISS-------QNETSKLPPRFNKAVILVIDAL 91

Query: 62  RSDFLF----EKSNSKFSFLHSLLN---------EGSAWGFTAYSNPPTVTLPRLKGITT 108
           R DF        SN   ++ +++L+         + S+      ++PPT TL RLKG+TT
Sbjct: 92  RFDFAIPVNESHSNYNLNYHNNILSLYDSFASDKDASSLLLKFIADPPTTTLQRLKGLTT 151

Query: 109 GSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYD 168
           GS P F+DA  N               +++Q     K ++F GDDTW+ LF     ++  
Sbjct: 152 GSLPTFIDAGSNF-----DGTVIEEDNFLKQLHLANKTVKFAGDDTWMALFHPFLSNDSF 206

Query: 169 GTNSFFVSDFEQVDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQE 228
              S  V D + VD+ V  +    L   +EWD +I H LG+DH+GHK GP+   M  KQ 
Sbjct: 207 PLESLNVWDLDTVDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQI 266

Query: 229 EMDEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAE 288
           ++D+ +  I +++DD+TL+ ++GDHGM+  GNHGG S  E  + L L SKK     P   
Sbjct: 267 QVDQFIDWILKSIDDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKK-----PDMW 321

Query: 289 QIGVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETL------- 341
           ++         +   DY+    ++Q+D+V +LA L   PIP N++G  I E         
Sbjct: 322 RLKETSNYNIDNLGHDYR---SVRQIDLVSSLALLMGQPIPFNNLGWPIDEIARNDREWS 378

Query: 342 QLLDPKLAKIKLLENLKQL 360
           Q ++  +++++L ++  Q+
Sbjct: 379 QFVNSAISQLQLYKDTMQI 397

>AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL031C
           (GPI13)
          Length = 1013

 Score =  183 bits (465), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 145/418 (34%), Positives = 207/418 (49%), Gaps = 49/418 (11%)

Query: 7   ALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDFL 66
           AL   Q +A++ F  GF   +KVL   A   E  A    AK  F++LVL+V+DALR DF+
Sbjct: 49  ALAALQFIAIAFFTRGFLLSRKVLDDVANRDESTA---PAK--FDRLVLLVVDALRFDFV 103

Query: 67  F------EKSNSKF----SFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLD 116
                  E  NS +      L+   +E     F A  +PPT TL RLKG+TTGS P F+D
Sbjct: 104 IPVDVAAEGYNSHYHNHLRALYERWDESILLKFLA--DPPTTTLQRLKGLTTGSLPTFID 161

Query: 117 AILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVS 176
           A  N                ++Q     K + F GDDTW  LF     +      S  V 
Sbjct: 162 AGSNFNGIVIDEGYI-----IKQMCLINKTIYFAGDDTWDALFHPYLSNVSMPYESLNVW 216

Query: 177 DFEQVDHNVTR----HLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDE 232
           D + VD+ V      HL      ++EWD L+ H LG+DH+GHK GP+   M  KQ ++D 
Sbjct: 217 DLDTVDNGVISFFEDHLLNNPTEKKEWDVLVGHMLGIDHVGHKYGPSHFSMAEKQSQVDG 276

Query: 233 ILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKK---LRRYAPPA-- 287
            ++QI + VD++TL+ VMGDHGM+  GNHGG S  E  + L L +K+    RR AP A  
Sbjct: 277 FIRQIIDAVDEDTLLVVMGDHGMDHTGNHGGDSPAELESTLWLYTKRPGTWRRQAPAAYN 336

Query: 288 -EQIGVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDP 346
             ++G              +Y   + Q+D+VP+L+ L   PIP N++G  I+E     D 
Sbjct: 337 TTELG--------------RYYRAVNQIDLVPSLSLLLGLPIPFNNLGWPIEELAH--DD 380

Query: 347 KLAKIKLLENLKQLDSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGM 404
              ++   + L QL++  N    I D + +  L +L  +  S+ +  A NY   L+ M
Sbjct: 381 DEWRLFTRQTLMQLETYRNTSNSITDSSKLKILEELKINANSN-SSDAGNYQAILLEM 437

>Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  179 bits (455), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 119/348 (34%), Positives = 178/348 (51%), Gaps = 30/348 (8%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSD 64
           L+ + I Q ++++ F  GF   + VL +    I      ++  P FNK V++VIDALR D
Sbjct: 39  LVFIAILQFISIAFFTRGFLLSRHVLDN----ISSRNETSDLPPRFNKAVVLVIDALRFD 94

Query: 65  FLFEKS-----------NSKFSFLHSLLNE--GSAWGFTAYSNPPTVTLPRLKGITTGST 111
           F    +           N+  S   S  N+   S+      ++PPT TL RLKG+TTGS 
Sbjct: 95  FAIPVNESDPDHNPNYHNNILSLYDSFTNDKNSSSLLLKFIADPPTTTLQRLKGLTTGSL 154

Query: 112 PNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTN 171
           P F+DA  N                ++QFF   K ++F GDDTW  LF     ++     
Sbjct: 155 PTFIDAGSNFDGTIIEEDNL-----LKQFFLANKTVKFAGDDTWTALFYPFLSNDSFPLE 209

Query: 172 SFFVSDFEQVDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMD 231
           S  V D + VD+ V  +    L   +EWD +I H LG+DH+GHK GP+   M  KQ ++D
Sbjct: 210 SLNVWDLDTVDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVD 269

Query: 232 EILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIG 291
             +  I  ++DD+TL+ ++GDHGM+  GNHGG S  E  + L L SKK     P   ++ 
Sbjct: 270 RFIDWILNSIDDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKK-----PEMWRLK 324

Query: 292 VQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQE 339
                  +D   +Y+    ++Q+D+V +L+ L + PIP N++G  I E
Sbjct: 325 DAFNYNTSDSGYNYR---SVRQIDLVSSLSLLLDQPIPFNNLGWPIDE 369

>Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON}
           complement(442..3471) [3030 nt, 1010 aa]
          Length = 1009

 Score =  179 bits (453), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 119/355 (33%), Positives = 180/355 (50%), Gaps = 36/355 (10%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSD 64
           L+A+L  Q ++++ FC GF   + VL +          Q+  K  F+K V+++IDALR D
Sbjct: 31  LIAIL--QFISIAFFCKGFLLTRNVLDNVNNLNPSDLNQDYTKK-FDKAVILIIDALRFD 87

Query: 65  FLFEKS-----------NSKFSFLHSLLNEG-----SAWGFTAYSNPPTVTLPRLKGITT 108
           F+   +           N+  +     +++      S+      ++PPT TL RLKG+TT
Sbjct: 88  FVIPVNSTDPLHNQNYHNNIITLYDQFISQNNNKDHSSILLKFIADPPTTTLQRLKGLTT 147

Query: 109 GSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYD 168
           GS P F+DA  N                ++Q +   +++ F GDDTW  LF     +   
Sbjct: 148 GSLPTFIDAGTNFDGSVIEEDNL-----IKQLYLKNEEIYFVGDDTWDSLFNPFLSNHSK 202

Query: 169 GTNSFFVSDFEQVDHNVTR----HLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMP 224
              S  V D + VD+ V      HL  Q  N ++WD LI H LG+DH+GHK GPN   M 
Sbjct: 203 PFESLNVWDLDTVDNGVISYFNDHLINQKTNDKKWDILIGHMLGVDHVGHKYGPNHFTMR 262

Query: 225 AKQEEMDEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYA 284
            KQ +++  +  I E++DD+TL+ +MGDHGM+  GNHGG S  E  + L + SKK   + 
Sbjct: 263 EKQLQVNNFINDIIESIDDDTLLVIMGDHGMDHTGNHGGDSKDELESTLFMYSKKTDVW- 321

Query: 285 PPAEQIGVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQE 339
               ++G      N + E        + Q+D+VPTL+ L + PIP N++G  I E
Sbjct: 322 ----ELG---DPNNYNIENSGDNYRSVNQIDLVPTLSLLLDVPIPFNNLGWPINE 369

>KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4.28
           YLL031C
          Length = 1016

 Score =  179 bits (453), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/379 (32%), Positives = 190/379 (50%), Gaps = 38/379 (10%)

Query: 6   LALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDF 65
           +ALL  Q +A++ F  GF   ++VL +       P   N     F+K V++++DALR DF
Sbjct: 42  IALL--QFIAIAFFTKGFLLSRQVLDNIT-----PLDSNVIDAKFDKAVILIVDALRFDF 94

Query: 66  LFEKSNSK---------FSFLHSLLNEGSAWGFTAY----SNPPTVTLPRLKGITTGSTP 112
           +    +++            L+     G++ G +      ++PPT TL RLKG+TTGS P
Sbjct: 95  VIPVDSTEHLNNNYHNNIDILYDTFKNGNSHGSSILLKFLADPPTTTLQRLKGLTTGSLP 154

Query: 113 NFLDAILNVAEXXXXXXXXXXXXWVRQFFSH-GKKLRFFGDDTWLKLFPKEYFDEYDGTN 171
            F+DA  N                +RQ   +  +++ F GDDTW  LF     +      
Sbjct: 155 TFIDAGSNFNGNVIFEDNL-----IRQLSENLNREILFVGDDTWDALFHPFLSNNSLPYE 209

Query: 172 SFFVSDFEQVDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMD 231
           S  V D + VD+ V     + L    +WD LI H LG+DH+GHK GPN   M  KQ +++
Sbjct: 210 SLNVWDLDTVDNGVIDFFDENLKKNDDWDVLIGHMLGVDHVGHKYGPNHFTMREKQLQVN 269

Query: 232 EILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIG 291
             +K+I +++D+ TL+ VMGDHGM+  GNHGG S  E  + L L +KK   +    +   
Sbjct: 270 TFIKKIIDSIDNNTLLVVMGDHGMDHTGNHGGDSIDELESTLFLYTKKKNIFRKHDDFT- 328

Query: 292 VQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKI 351
              P    D   +Y+    + Q+D+V TL+ L   PIP N++G  I+E   +   K  KI
Sbjct: 329 ---PYNITDLGKNYR---AVNQIDLVSTLSYLLGIPIPFNNLGWPIEE---IFHSKNDKI 379

Query: 352 KLLENLKQLDSISNGHEVI 370
           K+ +  + LD +    E++
Sbjct: 380 KMTK--RVLDQLRTYQEIM 396

>Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  175 bits (444), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 117/348 (33%), Positives = 176/348 (50%), Gaps = 30/348 (8%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSD 64
           L+ + I Q ++++ F  GF   + VL + +   E   L     P FNK V++VIDALR D
Sbjct: 39  LVFIAILQFISIAFFTRGFLLSRHVLDNISTQNETTTLH----PRFNKTVVLVIDALRFD 94

Query: 65  FLF----EKSNSKFSFLHSLLN---------EGSAWGFTAYSNPPTVTLPRLKGITTGST 111
           F+       SN   ++ +++L+         + S+      ++PPT TL RLKG+TTGS 
Sbjct: 95  FVIPVDESGSNHNLNYHNNILSLYDSFANDKDASSLLLKFIADPPTTTLQRLKGLTTGSL 154

Query: 112 PNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTN 171
           P F+DA  N                ++Q     K ++F GDDTW+ LF     ++     
Sbjct: 155 PTFIDAGSNFDGTVIEEDNL-----LKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLE 209

Query: 172 SFFVSDFEQVDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMD 231
           S  V D + VD  V  +    L   QEWD +I H LG+DH+GHK GP+   M  KQ ++D
Sbjct: 210 SLNVWDLDSVDKGVMDYFHDHLQQDQEWDVMIGHMLGIDHVGHKYGPDHFTMREKQVQVD 269

Query: 232 EILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIG 291
           E +  I +++D+ TL+ ++GDHGM+  GNHGG S  E  + L L SKK   +        
Sbjct: 270 EFINWILKSIDENTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPNLWKLKDS--- 326

Query: 292 VQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQE 339
                 N D     +    ++Q+D+V +L+ L   PIP N++G  I E
Sbjct: 327 -----SNYDISALGRDYRSVRQIDLVSSLSLLLGQPIPFNNLGWPIDE 369

>Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON}
           YLL031C (REAL)
          Length = 1016

 Score =  174 bits (441), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 115/348 (33%), Positives = 178/348 (51%), Gaps = 31/348 (8%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSD 64
           L+ + + Q ++++ F  GF   + VL + +   E         P FNK V++V+DALR D
Sbjct: 39  LIFIAVLQFISIAFFTRGFLLSRHVLDNISALNE-----TSIPPRFNKAVVLVVDALRFD 93

Query: 65  FLF----EKSNSKFSFLHSLLN---------EGSAWGFTAYSNPPTVTLPRLKGITTGST 111
           F+       SN   ++ +++L+         + S+      ++PPT TL RLKG+TTGS 
Sbjct: 94  FVIPVNESSSNHNLNYHNNILSLYDSFANDEDASSLLLKFIADPPTTTLQRLKGLTTGSL 153

Query: 112 PNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTN 171
           P F+DA  N                ++Q     K ++F GDDTW+ LF     ++     
Sbjct: 154 PTFIDAGSNFDGTVIEEDNL-----LKQLHLVNKTVKFAGDDTWMALFHPFLSNDSFPLE 208

Query: 172 SFFVSDFEQVDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMD 231
           S  V D + VD+ V  +    L   +EWD +I H LG+DH+GHK GPN   M  KQ ++D
Sbjct: 209 SLNVWDLDTVDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPNHFTMKEKQFQVD 268

Query: 232 EILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIG 291
           + +  I +++DD+TL+ ++GDHGM+  GNHGG S  E  + L L SKK     P      
Sbjct: 269 QFIAWILKSIDDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKK-----PNMWNFK 323

Query: 292 VQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQE 339
                   +   DY+    ++Q+D+V +L+ L   PIP N++G  I E
Sbjct: 324 DASNYNITNLGCDYR---SVRQIDLVSSLSLLLGQPIPFNNLGWPIDE 368

>TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]
           {ON} Anc_4.28 YLL031C
          Length = 1065

 Score =  171 bits (434), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 122/412 (29%), Positives = 205/412 (49%), Gaps = 59/412 (14%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSD 64
           + ++ I Q ++++ F  GF   + VL + +      ++ N+ KP F+K V++++DALR +
Sbjct: 58  IFSIAILQFISIAFFSRGFLLTRNVLDNISTDNNPNSILND-KPQFDKTVILIVDALRFN 116

Query: 65  FLFEKSNSKFSFLHSLLN-------------EGSAWGFTAYSNPPTVTLPRLKGITTGST 111
           F+         +  +  N             + S+      ++PPT T+ RLKG+TTG+ 
Sbjct: 117 FVIPVDVDSMDYNPNYHNNIDVLYDTFKNSQDSSSVLLKFIADPPTTTMQRLKGLTTGTL 176

Query: 112 PNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDE----- 166
           P F+DA  N               ++ +F++    + F GDDTW  LF K Y ++     
Sbjct: 177 PTFIDAGSNFDGSVILEDNLIKQLYLNKFWN---DIYFVGDDTWDALF-KPYLNQQFSRP 232

Query: 167 YDGTNSFFVSDFEQVDHNVTRHLPKQL-----NNQQEWDALILHYLGLDHIGHKGGPNSQ 221
           +D  N   V D + VD+ V  +  + L      +Q  +  LI H LG+DH+GHK GPN  
Sbjct: 233 FDSLN---VWDLDTVDNGVISYFHEYLIDQSSKDQMTYKTLIGHMLGVDHVGHKYGPNHF 289

Query: 222 FMPAKQEEMDEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLR 281
            M  KQ ++++ LK+I  ++DD TL+ VMGDHGM+  GNHGG S  E  + L + +KK  
Sbjct: 290 TMKEKQLQINQFLKEIINSIDDNTLLVVMGDHGMDHTGNHGGDSVDELESTLFMYAKKKN 349

Query: 282 RYAPPAEQIGVQLPVQNADGEVDY------QYLTRIQQVDIVPTLAALFNFPIPKNSVGI 335
            +              + D E  Y      +   ++ Q+D+VPTL+ L +  IP NS+G 
Sbjct: 350 SFT------------LDKDYETSYNISNFGESYKQVNQIDLVPTLSLLLDLQIPFNSLGW 397

Query: 336 LIQETLQLLDPKLAKIKLLENL--KQLDSISNGHEVI--QDEAN--IDQLYD 381
            I E  Q       ++++ +N+  +QL +      ++   DE N  +D+L++
Sbjct: 398 PIDEIAQ----NSQQLEMFQNITVQQLHTFKETSNLLTSDDERNLLLDELFE 445

>TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1026

 Score =  169 bits (429), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 120/365 (32%), Positives = 178/365 (48%), Gaps = 42/365 (11%)

Query: 5   LLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEA------KPVFNKLVLVVI 58
           L A+   Q +A++ F  GF   + VL    +        N +      +  F K V++VI
Sbjct: 30  LTAVAALQFIAIAFFTKGFLLSRNVLDDINELKPSMYAANSSNNGFVHQQKFEKTVILVI 89

Query: 59  DALRSDFLF--EKSNSKFSFLH-----SLLNE----------GSAWGFTAYSNPPTVTLP 101
           DALR DF+     +NS ++  H     +L ++           ++      ++PPT TL 
Sbjct: 90  DALRFDFVIPVNTNNSAYNSNHHNKITTLYDQFCKESVGKKQNNSLLLKFLADPPTTTLQ 149

Query: 102 RLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPK 161
           RLKG+TTGS P F+DA  N                ++Q + + K++ F GDDTW  LF  
Sbjct: 150 RLKGLTTGSLPTFIDAGSNFDGTVIEEDNL-----IKQMYLNNKEVFFVGDDTWDALFSP 204

Query: 162 EYFDEYDGTNSFFVSDFEQVDHNVTRHLPKQLNNQQE-------WDALILHYLGLDHIGH 214
              +      S  V D + VD+ V  +    L   +E       W+ LI H LG+DH+GH
Sbjct: 205 FLSNHSIPYESLNVWDLDTVDNGVISYFNDNLIRSEEYKKKNSQWNVLIGHMLGVDHVGH 264

Query: 215 KGGPNSQFMPAKQEEMDEILKQIYENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALA 274
           K GPN   M  KQ +++  +  I   +DD+TL+ +MGDHGM+  GNHGG S  E  + L 
Sbjct: 265 KYGPNHFTMKEKQLQVNNFINDIINVIDDDTLLVIMGDHGMDHTGNHGGDSIDELESTLF 324

Query: 275 LISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVG 334
           L SK+   +    +       V N D ++   Y   I Q+D+VPTLA L + PIP N++G
Sbjct: 325 LYSKRQNVWKLEDDH-----SVYNID-DLGSNY-KSINQIDLVPTLALLLDIPIPFNNLG 377

Query: 335 ILIQE 339
             I+E
Sbjct: 378 WPIKE 382

>Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {ON}
           YKL165C (REAL)
          Length = 945

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 98/402 (24%), Positives = 154/402 (38%), Gaps = 68/402 (16%)

Query: 43  QNEAKPVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSN 94
           Q+ + P   +L L+V D LR+D  F+K     +        ++ SL+   + +G  +++ 
Sbjct: 67  QSTSNPPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPYIRSLVMNNATYG-ISHTR 125

Query: 95  PPTVTLPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDT 154
            PT + P    +  G    F + +  V +                FF+       FG   
Sbjct: 126 MPTESRPGHVAMIAG----FYEDVSAVTKGWKSNPVN-----FDSFFNQSTHTYSFGSPD 176

Query: 155 WLKLFPKEYFDE-------YDGTNSFFVSDFEQVDHNVTRHLPKQLNN-----------Q 196
            L +F     D        YD T   F     ++D  V RHL +  +N           +
Sbjct: 177 ILPMFKDGASDPNRVDTWMYDHTFEDFTQSSIELDAYVFRHLNELFHNSTLNSTLDYEIR 236

Query: 197 QEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMG 251
           Q+ +   LH LG D  GH   P S       + +D+ +  + + V     DD+T      
Sbjct: 237 QDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKTAFIFTA 296

Query: 252 DHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNA----DGEVDYQY 307
           DHGM+  G+HG      T   L             A   G+  PVQN+    D   D   
Sbjct: 297 DHGMSAFGSHGDGHPNNTRTPLV------------AWGAGLNKPVQNSFPVFDNYTDNWE 344

Query: 308 LTRI-----QQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQLDS 362
           L+ I     +Q DI   ++ L     PKNSVG L    +  LD K +  KL        S
Sbjct: 345 LSNIKRNDVKQADIASLMSYLIGVNYPKNSVGEL---PIAYLDGKESD-KLSALYNNARS 400

Query: 363 ISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGM 404
           I   + V QDE    Q +   K+    + +S ++Y  ++ G+
Sbjct: 401 ILEQYLVKQDEVIDSQFF--YKEYFKFVEKSHSHYLKEIEGL 440

>Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 94/384 (24%), Positives = 140/384 (36%), Gaps = 78/384 (20%)

Query: 43  QNEAKPVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSN 94
           Q+   P   +L L+V D LR+D  F+K     +        F+ SL+   + +G  +++ 
Sbjct: 41  QSTPTPPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPFIRSLVMNNATYG-ISHTR 99

Query: 95  PPTVTLP-----------RLKGITTG--STPNFLDAILNVAEXXXXXXXXXXXXWVRQFF 141
            PT + P            +  +T G  S P   D+  N +               R   
Sbjct: 100 MPTESRPGHVAMIAGFYEDVSAVTKGWKSNPVDFDSFFNQSAHTYSFGSPDILPMFRDGA 159

Query: 142 SHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVDHNVTRHLPKQLNN------ 195
           S   K+     DTW+          YD T   F     ++D  V RHL +   N      
Sbjct: 160 SDPNKV-----DTWM----------YDHTFEDFTQSSIELDAYVFRHLDQLFRNSTLNST 204

Query: 196 -----QQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDET 245
                +Q+ +   LH LG D  GH   P S       + +D+ +  + E V     DD+T
Sbjct: 205 LDYEIRQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIEKVNRFFADDKT 264

Query: 246 LICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNA------ 299
                 DHGM+  G+HG      T   L             A   G+  PV N+      
Sbjct: 265 AFVFTADHGMSAFGSHGDGHPNNTRTPLI------------AWGAGLNKPVHNSYPVFDN 312

Query: 300 ---DGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLEN 356
              + E+       I+Q DI   ++ L     PKNSVG L    +  +D K +  KL   
Sbjct: 313 YTENWELSNIKRNDIKQADIASLMSYLIGVNYPKNSVGEL---PIAYIDGKESD-KLAAL 368

Query: 357 LKQLDSISNGHEVIQDEANIDQLY 380
                SI   + V QDE    Q +
Sbjct: 369 YNNARSILEQYLVKQDEVIDSQFF 392

>SAKL0C05434g Chr3 complement(516536..519643) [3108 bp, 1035 aa]
           {ON} similar to uniprot|P36051 Saccharomyces cerevisiae
           YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 1035

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 87/354 (24%), Positives = 128/354 (36%), Gaps = 64/354 (18%)

Query: 43  QNEAKPVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSN 94
           ++   P   +L L+V D LR+D  F+K     S        F+ SL+   + +G + ++ 
Sbjct: 152 RSTETPPAKRLFLIVGDGLRADTTFDKITHPVSGETTYLAPFIRSLVKNNATYGIS-HTR 210

Query: 95  PPTVTLPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDT 154
            PT + P    +  G    F + +  V +                FF+       FG   
Sbjct: 211 MPTESRPGHVAMIAG----FYEDVSAVTKGWQENPVDFD-----SFFNQSAHTYSFGSPD 261

Query: 155 WLKLFPKEYFDEYDGTNSFFVSDFE-------QVDHNVTRHLPKQLNNQ----------- 196
            L +F +   D +      +  +FE       ++D  V RHL +  +N            
Sbjct: 262 ILPMFKEGASDPHRVDAWMYGHEFEDFTQSSIELDAYVFRHLDQLFHNSTVDTALREEIM 321

Query: 197 QEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMG 251
           Q  +   LH LG D  GH   P S         +DE +  + E V     DD+T      
Sbjct: 322 QHGNVFFLHLLGCDTAGHSYRPYSAEYYDNVRYIDEQVAVLVEKVRDFFGDDDTAFIFTA 381

Query: 252 DHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLT-- 309
           DHGM+  G+HG      T   L             A   G+  PV+N   E D    T  
Sbjct: 382 DHGMSAFGSHGDGHPNNTRTPLV------------AWGAGLNTPVRNEKPEYDNYTATWD 429

Query: 310 -------RIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLEN 356
                   + Q DI   +A L     P NSVG L      L   + AK+K L N
Sbjct: 430 LAEVRRNDVNQADIASLMAYLIGTNYPANSVGEL--PLAYLAGTEEAKLKALYN 481

>YKL165C Chr11 complement(137932..140691) [2760 bp, 919 aa] {ON}
           MCD4Protein involved in glycosylphosphatidylinositol
           (GPI) anchor synthesis; multimembrane-spanning protein
           that localizes to the endoplasmic reticulum; highly
           conserved among eukaryotes
          Length = 919

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 94/384 (24%), Positives = 142/384 (36%), Gaps = 78/384 (20%)

Query: 43  QNEAKPVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSN 94
           Q+   P   +L L+V D LR+D  F+K     S        F+ SL+   + +G  +++ 
Sbjct: 41  QSTPTPPAKRLFLIVGDGLRADTTFDKVTHPVSGKTEFLAPFIRSLVMNNATYG-ISHTR 99

Query: 95  PPTVTLP-----------RLKGITTG--STPNFLDAILNVAEXXXXXXXXXXXXWVRQFF 141
            PT + P            +  +T G  S P   D+  N +               +   
Sbjct: 100 MPTESRPGHVAMIAGFYEDVSAVTKGWKSNPVNFDSFFNQSTHTYSFGSPDILPMFKDGA 159

Query: 142 SHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVDHNVTRHLPKQLNN------ 195
           S   K+     DTW+          YD T   F     ++D  V RHL +  +N      
Sbjct: 160 SDPNKV-----DTWM----------YDHTFEDFTQSSIELDAFVFRHLDQLFHNSTLNST 204

Query: 196 -----QQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDET 245
                +Q+ +   LH LG D  GH   P S       + +D+ +  + + V     DD+T
Sbjct: 205 LDYEIRQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKT 264

Query: 246 LICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQN----ADG 301
                 DHGM+  G+HG      T   L             A   G+  PV N    +D 
Sbjct: 265 AFIFTADHGMSAFGSHGDGHPNNTRTPLV------------AWGAGLNKPVHNPFPVSDN 312

Query: 302 EVDYQYLTRI-----QQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLEN 356
             +   L+ I     +Q DI   ++ L     PKNSVG L    +  +D K +  KL   
Sbjct: 313 YTENWELSSIKRNDVKQADIASLMSYLIGVNYPKNSVGEL---PIAYIDGKESD-KLAAL 368

Query: 357 LKQLDSISNGHEVIQDEANIDQLY 380
                SI   + V QDE    Q +
Sbjct: 369 YNNARSILEQYLVKQDEVIDSQFF 392

>Suva_11.58 Chr11 complement(123117..125876) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 121/328 (36%), Gaps = 50/328 (15%)

Query: 43  QNEAKPVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSN 94
           Q+   P   +L L+V D LR+D  F+K     +        F+ SL+   + +G  +++ 
Sbjct: 41  QSTPTPPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPFIRSLVMNNATYGI-SHTR 99

Query: 95  PPTVTLPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDT 154
            PT + P    +  G    F + +  V +                FF+       FG   
Sbjct: 100 MPTESRPGHVAMIAG----FYEDVSAVTKGWKSNPVD-----FDSFFNQSTHTYSFGSPD 150

Query: 155 WLKLFPKEYFDE-------YDGTNSFFVSDFEQVDHNVTRHLPKQLNN-----------Q 196
            L +F     D        YD T   F     ++D  V +HL +   N           +
Sbjct: 151 ILPMFKDGASDPNKVDAWMYDHTFEDFTQSSIELDAYVFKHLDQLFRNSTLNSTLDYEIR 210

Query: 197 QEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMG 251
           Q+ +   LH LG D  GH   P S       + +D+ +  + E V     DD+T      
Sbjct: 211 QDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPTLIEKVNKFFDDDKTAFVFTA 270

Query: 252 DHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPV-QNADGEVDYQYLTR 310
           DHGM+  G+HG      T   L      L +       +    PV  N     +   + R
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWGAGLNK------PVHTSYPVFDNYTENWELSSIKR 324

Query: 311 --IQQVDIVPTLAALFNFPIPKNSVGIL 336
             ++Q DI   ++ L     PKNSVG L
Sbjct: 325 NDVKQADIASLMSYLIGVNYPKNSVGEL 352

>NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {ON}
           Anc_1.184 YKL165C
          Length = 925

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 100/418 (23%), Positives = 154/418 (36%), Gaps = 81/418 (19%)

Query: 48  PVFNKLVLVVIDALRSDFLFE--------KSNSKFSFLHSLLNEGSAWGFTAYSNPPTVT 99
           P   +L L+V D LR+D  F+        K+     F+ SL+   + +G  +++  PT +
Sbjct: 45  PPAKRLFLIVGDGLRADTTFDLITHPTTGKTEFLAPFIRSLVKTNATYGI-SHTRMPTES 103

Query: 100 LPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLF 159
            P    +  G    F + +  V +                FF+       FG    L +F
Sbjct: 104 RPGHVAMIAG----FYEDVSAVTKGWKENPVD-----FDSFFNQSTHTYSFGSPDILPMF 154

Query: 160 ------PKE-----YFDEYDGTNSFFVSDFEQVDHNVTRHLPKQLNN-----------QQ 197
                 P +     Y  EY+     F     ++D  V RHL     N           +Q
Sbjct: 155 KDGASDPNKVDAWMYGHEYED----FTQSSIELDAYVFRHLDSLFKNSTSNVTLDHEIRQ 210

Query: 198 EWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMGD 252
           E +   LH LG D  GH   P S       + +DE +  + + V     D++T      D
Sbjct: 211 EGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSLLVDKVHDFFGDEDTAFIFTAD 270

Query: 253 HGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLTRIQ 312
           HGM+  G+HG      T   L      L +  P   ++ +      + G  D +    I+
Sbjct: 271 HGMSAFGSHGDGHPNNTRTPLVAWGAGLNK--PVKNEVPIYDNYTESWGLADIKR-NDIK 327

Query: 313 QVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLA-KIKLLEN-----LKQLDSISNG 366
           Q DI P ++ L     P NSVG L    L  +D   + K+K L N     L+Q   +   
Sbjct: 328 QADITPLMSYLIGANYPANSVGEL---PLSYIDSNESQKLKALYNNARSILEQY--LVKE 382

Query: 367 HEVIQDE------------------ANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGL 406
            EVI+ +                    I  L DL+ D + DL   A     +LM + L
Sbjct: 383 QEVIESQFIYKEYPKLSDKSHKQYLKEIHHLIDLIADGELDLENEAITLTEELMKVTL 440

>Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {ON}
           YKL165C (MCD4) - (putative) involved in cell polarity
           [contig 108] FULL
          Length = 922

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 80/325 (24%), Positives = 116/325 (35%), Gaps = 54/325 (16%)

Query: 48  PVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSNPPTVT 99
           P   +L L+V D LR+D  FEK     S        F+ SL+   + +G  +++  PT +
Sbjct: 46  PPAKRLFLIVGDGLRADTTFEKITHPVSGETAHLAPFIRSLVLNNATYG-VSHTRMPTES 104

Query: 100 LPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLF 159
            P    +  G    F + +  V +                FF+       FG    L +F
Sbjct: 105 RPGHVAMIAG----FYEDVSAVTKGWKENPVD-----FDSFFNQSAHTYSFGSPDILPMF 155

Query: 160 PKEYFDEYDGTNSFFVSDFE-------QVDHNVTRHLPKQLNNQ-----------QEWDA 201
                D +      +  +FE       ++D  V RHL    N             Q  + 
Sbjct: 156 KDGATDPHKVDAWMYGHEFEDFTQSSIELDAFVFRHLDNLFNTSTTNETLRQEITQSGNV 215

Query: 202 LILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMGDHGMN 256
             LH LG D  GH   P S       + +D+ L ++   V     DD+T      DHGM+
Sbjct: 216 FFLHLLGCDTAGHSYRPYSAEYYDNVKYIDQELSKLVVKVRDYFGDDDTAFIFTADHGMS 275

Query: 257 DVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLTRIQ---- 312
             G+HG      T   L      L +         V+ PV   D   +   L  IQ    
Sbjct: 276 AFGSHGDGHPNNTRTPLVAWGAGLNK--------PVKNPVPIYDNYTEGWDLATIQRNDV 327

Query: 313 -QVDIVPTLAALFNFPIPKNSVGIL 336
            Q DI   ++ L     P NSVG L
Sbjct: 328 KQADIASLMSYLIGANYPANSVGEL 352

>AEL113C Chr5 complement(409096..411873) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL165C
           (MCD4)
          Length = 925

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/332 (23%), Positives = 120/332 (36%), Gaps = 61/332 (18%)

Query: 44  NEAKPVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSNP 95
           NE  P   +L L+V D LR+D  F+K     +        +L SL+   + +G + ++  
Sbjct: 43  NEEPPA-KRLFLIVGDGLRADTSFDKVKHPVTGKTEFLAPYLRSLVEHNATYGIS-HTRM 100

Query: 96  PTVTLP-----------RLKGITTG--STPNFLDAILNVAEXXXXXXXXXXXXWVRQFFS 142
           PT + P            +  +T G    P   D++ N +               +   S
Sbjct: 101 PTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSVFNQSTHTYSFGSPDILPMFKSGAS 160

Query: 143 HGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVDHNVTRHLPKQLNN------- 195
              K+     D W+      Y  E++     F     ++D  V RH+     N       
Sbjct: 161 DPTKV-----DAWM------YGHEFED----FTQSSIELDAYVFRHMDALFRNATVDSKL 205

Query: 196 ----QQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETL 246
                Q+ +   LH LG D  GH   P S       + +D  L+++   V     DD+T 
Sbjct: 206 RHEMMQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDSQLERLVPKVREFFGDDDTA 265

Query: 247 ICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQ 306
                DHGM+  G+HG      T   L      L R  P    + V     N     D  
Sbjct: 266 FVFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNR--PVLNDVPV---YDNYTENWDLA 320

Query: 307 YLTR--IQQVDIVPTLAALFNFPIPKNSVGIL 336
           ++ R  + Q DI   ++ L     P NSVG L
Sbjct: 321 HVRRNDVNQADIASLMSYLIGLNYPTNSVGEL 352

>NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON}
           Anc_1.184 YKL165C
          Length = 924

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/323 (22%), Positives = 122/323 (37%), Gaps = 44/323 (13%)

Query: 43  QNEAKPVFNKLVLVVIDALRSDFLFE--------KSNSKFSFLHSLLNEGSAWGFTAYSN 94
           ++  KP   +L L+V D LR+D  F+        K+     ++ SL+   + +G  +++ 
Sbjct: 41  RSTEKPPAKRLFLIVGDGLRADTTFDMITHPVTGKTEFLAPYIRSLVLNNATYGI-SHTR 99

Query: 95  PPTVTLPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDT 154
            PT + P    +  G    F + +  V +                FF+       FG   
Sbjct: 100 MPTESRPGHVAMIAG----FYEDVSAVTKGWKENPVD-----FDSFFNQSSHTYSFGSPD 150

Query: 155 WLKLFPKEYFDEYDGTNSFFVSDFE-------QVDHNVTRHLPKQLNN-----------Q 196
            L +F +   D +      +  ++E       ++D  V RHL    +N           +
Sbjct: 151 ILPMFKEGATDPHKVDAWMYGHEYEDFTQSSIELDAYVFRHLDSLFHNSTLDSTLDHEIR 210

Query: 197 QEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMG 251
           QE +   LH LG D  GH   P S       + +DE +  + + V     DD+T      
Sbjct: 211 QEGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSILVDKVHTFFGDDDTAFIFTA 270

Query: 252 DHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLTRI 311
           DHGM+  G+HG      T   L      L +  P   ++ +      +    D +    +
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWGAGLNK--PVKNEVPIYDNYTESWKLADIKR-NDV 327

Query: 312 QQVDIVPTLAALFNFPIPKNSVG 334
           +Q DI   ++ L     P NSVG
Sbjct: 328 KQADITSLMSYLIGTNYPANSVG 350

>TBLA0C05840 Chr3 complement(1411740..1414583) [2844 bp, 947 aa]
           {ON} Anc_1.184 YKL165C
          Length = 947

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 124/328 (37%), Gaps = 62/328 (18%)

Query: 47  KPVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSNPPTV 98
           +P   +L L+V D LR+D  F+K N   +        FL S++ E   +G  +++  PT 
Sbjct: 45  EPPAKRLFLIVGDGLRADTTFDKINHPITGETDYLAPFLRSIVLEEGTYGI-SHTRMPTE 103

Query: 99  TLPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKL 158
           + P    +  G    F + +  V +                FF+  K    FG    L +
Sbjct: 104 SRPGHVAMIAG----FYEDVSAVTKGWKENPVN-----FDSFFNQSKHTYSFGSPDILPM 154

Query: 159 FPKEYFDEYDGTNSFFVSDFE-------QVDHNVTRHLPKQLNN-----------QQEWD 200
           F     D        +  +FE       ++D  V RH+ +   N           +Q+ +
Sbjct: 155 FKDGASDINRIDTWMYGHEFEDFTQSSIELDAYVFRHMNELFFNSTVNETLNYEIRQDGN 214

Query: 201 ALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMGDHGM 255
              LH LG D  GH   P S       + +D+++ ++ ++V     D++T      DHGM
Sbjct: 215 VFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKMVSKLVDDVTTFFNDNDTAFIFTADHGM 274

Query: 256 NDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNA----DGEVDYQYLTRI 311
           +  G+HG      T   L             A   G+  PV+N     D   +   L  I
Sbjct: 275 SAFGSHGDGHPNNTRTPLI------------AWGAGINKPVKNEVPIFDNYTEGWNLGSI 322

Query: 312 -----QQVDIVPTLAALFNFPIPKNSVG 334
                +Q DI   ++ L     P NSVG
Sbjct: 323 KRNDVKQADIASLMSYLIGANYPANSVG 350

>TPHA0A02800 Chr1 complement(603610..606372) [2763 bp, 920 aa] {ON}
           Anc_1.184 YKL165C
          Length = 920

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/319 (24%), Positives = 117/319 (36%), Gaps = 46/319 (14%)

Query: 48  PVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSNPPTVT 99
           P   +L L+V D LR+D  F+      S        ++ S++     +G  +++  PT +
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDLITHPVSGETAYLAPYIRSIVLNNGTYG-ISHTRMPTES 104

Query: 100 LP-----------RLKGITTG--STPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKK 146
            P            +  +T G    P   D+  N                 +Q  S   K
Sbjct: 105 RPGHVAMIAGFYEDVSAVTKGWKENPVNFDSFFNQTNHTYSFGSPDILPMFKQGASDPNK 164

Query: 147 LRFFGDDTWLKLFPKEYFDEYDGTNSFFVSD-FEQVDHNVTRHLPKQLNNQ--QEWDALI 203
           +     D W+     E F +       FV D   ++  N T  L   LN Q  Q+ +   
Sbjct: 165 I-----DAWMYGHEFEDFSQSSLELDAFVFDHVNELFKNAT--LDSDLNEQIKQDGNCFF 217

Query: 204 LHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMGDHGMNDV 258
           LH LG D  GH   P S       + +D  + Q+ E V     DD+T      DHGM+  
Sbjct: 218 LHLLGCDTAGHSYRPYSAEYYDNVKYIDMQISQLVEKVNDFFGDDQTAFVFTADHGMSAF 277

Query: 259 GNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNADGE---VDYQYLTRIQQVD 315
           G+HG      T   L      + +   P +    Q P+ N   E    DY     ++Q D
Sbjct: 278 GSHGDGHPNNTRTPLVAWGAGINK---PEKH---QYPIVNNYTESWGFDYIKRNDVKQAD 331

Query: 316 IVPTLAALFNFPIPKNSVG 334
           I   ++ L     P NSVG
Sbjct: 332 IASLMSYLIGTNYPANSVG 350

>ZYRO0G18458g Chr7 (1522413..1525178) [2766 bp, 921 aa] {ON} highly
           similar to uniprot|P36051 Saccharomyces cerevisiae
           YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 921

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 124/328 (37%), Gaps = 50/328 (15%)

Query: 43  QNEAKPVFNKLVLVVIDALRSDFLFE--------KSNSKFSFLHSLLNEGSAWGFTAYSN 94
           Q+  +P   +L L+V D LR+D  F+        K      F+ SL+   + +G + ++ 
Sbjct: 41  QSTDQPPAKRLFLIVGDGLRADTTFDYVRHPATGKKEFLAPFIRSLVLNNATYGIS-HTR 99

Query: 95  PPTVTLP-----------RLKGITTG--STPNFLDAILNVAEXXXXXXXXXXXXWVRQFF 141
            PT + P            +  +T G    P   D+  N +               +   
Sbjct: 100 MPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSCFNQSTHTYSFGSPDILPMFKDGA 159

Query: 142 SHGKKLRFFGDDTWLKLFPKEYFDEYD-GTNSFFVSDFEQVDHNVTRHLPKQLNNQQEWD 200
           S   ++     D W+     E F +     ++F     + + HN T  +   LNN+   D
Sbjct: 160 SDPNRV-----DAWMYGHEFEDFTQSSIEMDAFVFKHLDDLFHNST--INNTLNNEIRHD 212

Query: 201 A--LILHYLGLDHIGHKGGP-------NSQFMPAKQEEMDEILKQIYENVDDETLICVMG 251
                LH LG D  GH   P       N +++  K E + E ++  +   DDET      
Sbjct: 213 GNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDGKVETLVEQVRDFFG--DDETAFVFTA 270

Query: 252 DHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPV-QNADGEVDYQYLTR 310
           DHGM+  G+HG      T   L      L +   P   +    PV  N     D  ++ R
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWGAGLNK---PVHNLK---PVYDNYTQGWDLSHIKR 324

Query: 311 --IQQVDIVPTLAALFNFPIPKNSVGIL 336
             ++Q DI   ++ L     P NSVG L
Sbjct: 325 HDVKQADIASLMSYLIGANYPANSVGEL 352

>KAFR0G00500 Chr7 complement(134741..137509) [2769 bp, 922 aa] {ON}
           Anc_1.184 YKL165C
          Length = 922

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 122/327 (37%), Gaps = 48/327 (14%)

Query: 43  QNEAKPVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSN 94
           ++   P   +L L+V D LR+D  FEK     +        F+ SL+   + +G  +++ 
Sbjct: 41  RSTETPPAKRLFLIVGDGLRADTTFEKVTHPVTGKTEYLAPFIRSLVLNNATYG-VSHTR 99

Query: 95  PPTVTLPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDT 154
            PT + P    +  G    F + +  V +                FF+  +    FG   
Sbjct: 100 MPTESRPGHVAMIAG----FYEDVSAVTKGWKENPVD-----FDSFFNQSRHTYSFGSPD 150

Query: 155 WLKLFPKEYFDEYDGTNSFFVSDFE-------QVDHNVTRHLPKQLNN-----------Q 196
            L +F     D        +  +FE       ++D  V R+L +   N           +
Sbjct: 151 ILPMFKDGASDPNKVDAWMYGHEFEDFTQSSIELDAYVFRNLDELFYNSTIDATLDFEIK 210

Query: 197 QEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMG 251
           QE +   LH LG D  GH   P S       + +DE L  +   V     DD+T      
Sbjct: 211 QEGNVFFLHLLGCDTAGHSYRPYSAEYYDNIKYIDEQLSILIPKVHDFFNDDDTAFIFTA 270

Query: 252 DHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLTR- 310
           DHGM+  G+HG      T   L      L +  P   ++ +     N     +  ++ R 
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWGAGLNK--PQINKVPIY---DNYTESWNLSHIKRN 325

Query: 311 -IQQVDIVPTLAALFNFPIPKNSVGIL 336
            ++Q DI   ++ L     P NSVG L
Sbjct: 326 DVKQADIASLMSYLIGTNYPVNSVGEL 352

>CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa]
           {ON} highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165c sporulation protein
          Length = 921

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 85/372 (22%), Positives = 145/372 (38%), Gaps = 75/372 (20%)

Query: 48  PVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSNPPTVT 99
           P   +L L+V D LR+D  F+K     +        F+ SL+   + +G + ++  PT +
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDKITHPVTKKADYLAPFIRSLVQNNATYGIS-HTRMPTES 104

Query: 100 LP-----------RLKGITTG--STPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKK 146
            P            +  +T G    P   D+  N                 +   S   K
Sbjct: 105 RPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQTAHTYSFGSPDILPMFKDGASDPNK 164

Query: 147 LRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVDHNVTRHLP---------KQLNNQ- 196
           +     D W+      Y  EY+     F     ++D  V RHL          K+L+ Q 
Sbjct: 165 V-----DAWM------YGHEYED----FTQSSIELDAYVFRHLDQLFKNSSTDKELDKQI 209

Query: 197 -QEWDALILHYLGLDHIGHKGGPNS----QFMPAKQEEMDEILKQIYENV-DDETLICVM 250
            Q+ +A  LH LG D  GH   P S      +    +++++++KQ+ E   D++T     
Sbjct: 210 RQDGNAFFLHLLGCDTAGHSYRPYSAEYYDNVIYIDKQVEKLVKQVEEFFGDNDTAFIFT 269

Query: 251 GDHGMNDVGNHGGSSAGETSAAL----ALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQ 306
            DHGM+  G+HG      T   L    A +++ +R   P  ++      + N        
Sbjct: 270 ADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNRPVRLDTPEFDEYTENWNLANIKR----- 324

Query: 307 YLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQLDSISNG 366
               ++Q DI   ++ L     P NSVG L           LA I+  E  ++L+++ N 
Sbjct: 325 --NDVKQADIAALMSYLIGTNYPANSVGEL----------PLAYIEGSEG-QKLEALLNN 371

Query: 367 HEVIQDEANIDQ 378
            E I ++  + +
Sbjct: 372 AESILEQYRVKE 383

>Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AEL113C
          Length = 926

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 75/327 (22%), Positives = 116/327 (35%), Gaps = 56/327 (17%)

Query: 47  KPVFNKLVLVVIDALRSDFLFEK------SNSKF--SFLHSLLNEGSAWGFTAYSNPPTV 98
           +P   +L L+V D LR+D  F+K        ++F   F+ SL+   + +G +    P   
Sbjct: 45  QPPAKRLFLIVGDGLRADTTFDKITYPSAGEAEFLAPFIRSLVMNNATYGISHTRMP--- 101

Query: 99  TLPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVR--QFFSHGKKLRFFGDDTWL 156
                    T S P  +  I    E             V     F+       FG    L
Sbjct: 102 ---------TESRPGHVSMIAGFYEDVSAVTKGWKENPVNFDSVFNQSAHTYSFGSPDIL 152

Query: 157 KLFPKEYFDEYDGTNSFFVSDFE-------QVDHNVTRHLPKQLNNQ-----------QE 198
            +F     D    +   +  +FE       ++D  V RHL +   N            Q+
Sbjct: 153 PMFKDGASDPNKVSAWMYGHEFEDFTQSSIELDAYVFRHLDQLFRNSTVNATLNEEIFQD 212

Query: 199 WDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMGDH 253
            +   LH LG D  GH   P S       + +D+ +  + + V     DD+T      DH
Sbjct: 213 GNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKQISLLVDKVRDFFGDDDTAFLFTADH 272

Query: 254 GMNDVGNHGGSSAGETSAAL----ALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLT 309
           GM+  G+HG      T   L    A ++K +R   P  +           + E+      
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVRNKHPIHDN-------YTKNWELSDIKRN 325

Query: 310 RIQQVDIVPTLAALFNFPIPKNSVGIL 336
            + Q DI   ++ L     P NSVG L
Sbjct: 326 DVNQADIASLMSYLIGANYPANSVGEL 352

>TDEL0C03690 Chr3 (648638..651400) [2763 bp, 920 aa] {ON} Anc_1.184
           YKL165C
          Length = 920

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 74/329 (22%), Positives = 124/329 (37%), Gaps = 52/329 (15%)

Query: 43  QNEAKPVFNKLVLVVIDALRSDFLFE--------KSNSKFSFLHSLLNEGSAWGFTAYSN 94
           Q+   P   +L L+V D LR+D  F+        K+     ++ SL+   + +G  +++ 
Sbjct: 41  QSTDNPPAKRLFLIVGDGLRADTTFDLITHPTSGKTEYLAPYIRSLVLNNATYGI-SHTR 99

Query: 95  PPTVTLP-----------RLKGITTG--STPNFLDAILNVAEXXXXXXXXXXXXWVRQFF 141
            PT + P            +  +T G    P   D+  N +               ++  
Sbjct: 100 MPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSAHTYSFGSPDILPMFKEGA 159

Query: 142 SHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVD---HNVTRHLPKQLNNQQE 198
           S   ++     DTW   +  E+ D    +       F  +D   HN TR     LN++  
Sbjct: 160 SDPSRV-----DTWT--YGHEFEDFTQSSIELDAYVFRHLDDLFHNSTRD--STLNDEIR 210

Query: 199 WDA--LILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMG 251
            D   + LH LG D  GH   P S       + +D+ +  + + V     DD+T      
Sbjct: 211 GDGNVVFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQVSMLSDKVRSFFGDDDTAFIFTA 270

Query: 252 DHGMNDVGNHGGSSAGETSAAL----ALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQY 307
           DHGM+  G+HG      T   L    A ++K L+   P  +       +++         
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPLKNDYPVFDNYTFTWGLEDVQRH----- 325

Query: 308 LTRIQQVDIVPTLAALFNFPIPKNSVGIL 336
              ++Q DI   ++ L     P NSVG L
Sbjct: 326 --DVKQADIASLMSYLIGVNYPANSVGEL 352

>KLTH0F04884g Chr6 complement(431251..434019) [2769 bp, 922 aa] {ON}
           highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 922

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 120/323 (37%), Gaps = 50/323 (15%)

Query: 48  PVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSNPPTVT 99
           P   +L L+V D LR+D  F+K     +        FL SL+   + +G  +++  PT +
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDKITHPTTGETAHLAPFLRSLVLNNATYG-VSHTRMPTES 104

Query: 100 LPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLF 159
            P    +  G    F + +  V +                FF+       FG    L +F
Sbjct: 105 RPGHVAMIAG----FYEDVSAVTKGWKENPVD-----FDSFFNQSAHTYSFGSPDILPMF 155

Query: 160 PKEYFDEYDGTNSFFVSDFE-------QVDHNVTRHLP---------KQLNNQ--QEWDA 201
                D        +  +FE       ++D  V RHL          ++L+ Q  Q  + 
Sbjct: 156 KDGASDPNKVDAWMYGHEFEDFTQSSIELDAYVFRHLDNLFYNSTMDRELHEQIMQPGNV 215

Query: 202 LILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMGDHGMN 256
             LH LG D  GH   P S       + +D+ + ++   V     DD+T      DHGM+
Sbjct: 216 FFLHLLGCDTAGHSYRPYSPEYYDNVKYIDDEVSKLVPKVRDFFGDDDTAFVFTADHGMS 275

Query: 257 DVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNADGEV-DYQYLTR--IQQ 313
             G+HG      T   L      L R       +  + P+ +   E  D   + R  ++Q
Sbjct: 276 AFGSHGDGHPNNTRTPLIAWGAGLNR------PVLNKAPIYDNYTEGWDLANIQRNDVKQ 329

Query: 314 VDIVPTLAALFNFPIPKNSVGIL 336
            DI   +  L     P NSVG L
Sbjct: 330 ADIASLMTYLIGADYPANSVGEL 352

>TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1040

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 89/397 (22%), Positives = 162/397 (40%), Gaps = 85/397 (21%)

Query: 12  QLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPV---FNKLVLVVIDALRSDFLF- 67
           Q +A++ F  GF   + V   +   I     ++EA  +   F K +L++I  +  D L  
Sbjct: 46  QFIALAFFTRGFLLTRPVY-DDVSIIPTLNTEDEAFNINSKFKKTMLIIISGISFDNLIP 104

Query: 68  ---------EKSNSKFSFLHSLLNEG----------SAWGFTAYSNPPTVTLPRLKGITT 108
                    E  ++  + L++  N+           S+      + PPT TL R+K IT 
Sbjct: 105 IPEESINYNESYHNNLNVLYNNFNQSLQNTSNEESSSSLLIKLKTYPPTDTLQRVKCITG 164

Query: 109 GSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYD 168
           GS P+F+D  +                 ++Q + + + + F GD  W  L+ K YF  + 
Sbjct: 165 GSVPSFIDTGITFYGSMIEEDNI-----LKQMYLNNRSIYFTGDKFWNSLYSK-YFQNFK 218

Query: 169 GTNSF--FVSDFEQV---------DHNVTRHLPKQLNN--------------------QQ 197
             N+    +  F+++         + N +   P  L+                      +
Sbjct: 219 LANNIDDIIDYFQKITTSTNHSYGESNRSSDKPISLDTNLLQNISSIPTISNATVTTPSK 278

Query: 198 EWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENVDDETLICVMGDHGMND 257
           +WD LI H +  D +  K           Q +++  L     ++D++TL+ V+GD+  + 
Sbjct: 279 DWDILIGHIME-DTMNEK---------VTQLKVNSFLNDTINSIDNDTLLLVLGDY--ST 326

Query: 258 VGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLTRIQQVDIV 317
             NH           L + +KK + +      +G +  V N  GE +Y+    I Q D+V
Sbjct: 327 ANNH------MLDTGLFMYTKKFKNFWNLQNHLG-EYNVDNF-GE-NYRV---IDQFDVV 374

Query: 318 PTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLL 354
           P+L+ L   PIP N++G  I E +  ++  L  ++ L
Sbjct: 375 PSLSLLLGLPIPFNNLGWPIDEIISPINSNLNDVRTL 411

>KNAG0C01080 Chr3 complement(209716..212511) [2796 bp, 931 aa] {ON}
           Anc_1.184 YKL165C
          Length = 931

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 71/327 (21%), Positives = 121/327 (37%), Gaps = 48/327 (14%)

Query: 43  QNEAKPVFNKLVLVVIDALRSDFLFE--------KSNSKFSFLHSLLNEGSAWGFTAYSN 94
           ++  +P   +L L+V D LR+D  F+        K+     ++ SL+   + +G  +++ 
Sbjct: 41  RSTEQPPAKRLFLIVGDGLRADTTFDMITHPVTGKTEYLAPYIRSLVENNATYG-ISHTR 99

Query: 95  PPTVTLPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDT 154
            PT + P    +  G    F + +  V +                FF+       FG   
Sbjct: 100 MPTESRPGHVAMIAG----FYEDVSAVTKGWKENPVD-----FDSFFNQSTHTYSFGSPD 150

Query: 155 WLKLFPKEYFDEYDGTNSFFVSDFE-------QVDHNVTRHLPKQLNN-----------Q 196
            L +F     D        +  +FE       ++D  V  H+ +   N           +
Sbjct: 151 ILPMFKDGASDHNKVDAWMYGHEFEDFTQSSIELDAYVFNHMDQLFYNSTVNRTLDNEIR 210

Query: 197 QEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMG 251
           Q  +   LH LG D  GH   P S       + +D  ++++ + V     DD+T      
Sbjct: 211 QNGNVFFLHLLGCDTAGHSYRPYSPEYYDNVKYIDREVEKLMDKVHNFFDDDDTAFIFTA 270

Query: 252 DHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLTR- 310
           DHGM+  G+HG      T   L      L R  P    + +     N     +  ++ R 
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWGAGLNR--PKLNDVPIY---DNYTKPWNLSHIQRN 325

Query: 311 -IQQVDIVPTLAALFNFPIPKNSVGIL 336
            ++Q DI   ++ L     P NSVG L
Sbjct: 326 DVKQADIASLMSYLIGANYPVNSVGEL 352

>Kpol_2001.28 s2001 (81621..83408,83411..84382) [2760 bp, 919 aa]
           {ON} (81621..83408,83411..84382) [2760 nt, 920 aa]
          Length = 919

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 79/329 (24%), Positives = 115/329 (34%), Gaps = 62/329 (18%)

Query: 48  PVFNKLVLVVIDALRSDFLFEKSNSKFS--------FLHSLLNEGSAWGFTAYSNPPTVT 99
           P   +L LVV D LR+D  F+K     +        F+ SL+     +G  +++  PT +
Sbjct: 46  PPAKRLFLVVGDGLRADTTFDKITHPVTGKTEYLAPFIRSLVLNNGTYGI-SHTRMPTES 104

Query: 100 LPRLKGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLF 159
            P    +  G    F + +  V +                FF+       FG    L +F
Sbjct: 105 RPGHVAMIAG----FYEDVSAVTKGWKENPVD-----FDSFFNQSVHTYSFGSPDILPMF 155

Query: 160 PKEYFDEYDGTNSFFVSDFE-------QVDHNVTRHLPKQLNN-----------QQEWDA 201
                D        +  +FE       ++D  V  HL     N           +Q+ + 
Sbjct: 156 KDGASDPSRVDAWMYGHEFEDFTQSSIELDAFVFNHLDTLFKNSTTNNTLNAEIRQDGNV 215

Query: 202 LILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMGDHGMN 256
             LH LG D  GH   P S       + +D  +  + + V     DDET      DHGM+
Sbjct: 216 FFLHLLGCDTAGHSYRPYSAEYYDNVKYIDNQVSVLVDKVREFFGDDETAFVFTADHGMS 275

Query: 257 DVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNA----DGEVDYQYLTRI- 311
             G+HG      T   L             A   GV  PV+N     D   +   L  I 
Sbjct: 276 AFGSHGDGHPNNTRTPLV------------AWGAGVNKPVRNEYPIYDNYTEGWNLADIK 323

Query: 312 ----QQVDIVPTLAALFNFPIPKNSVGIL 336
               +Q DI   ++ L     P NSVG L
Sbjct: 324 RNDVKQADIASLMSYLIGVNYPSNSVGEL 352

>KLLA0B07249g Chr2 complement(630336..633095) [2760 bp, 919 aa] {ON}
           highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 919

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 92/396 (23%), Positives = 155/396 (39%), Gaps = 72/396 (18%)

Query: 52  KLVLVVIDALRSDFLFEK--------SNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRL 103
           +L L+V D LR+D  F+K         +    ++  L+   + +G  +++  PT + P  
Sbjct: 50  RLFLIVGDGLRADTTFDKILHPVTGEHDYLAPYIRDLVRNEATYG-VSHTRMPTESRPGH 108

Query: 104 KGITTGSTPNFLDAILNVAEXXXXXXXXXXXXWVRQFFSHGKKLRFFGDDTWLKLF---- 159
             +  G    F + +  V +                FF+  K    FG    L +F    
Sbjct: 109 VAMIAG----FYEDVSAVTKGWQENPVD-----FDSFFNQSKHTYSFGSPDILPMFKDGA 159

Query: 160 -PKEYFDEYDGTNSFFVSDFEQ----VDHNVTRHLPKQLNN-----------QQEWDALI 203
            P +  D +   + F   DF Q    +D  V RH+ +  NN           +Q+ +   
Sbjct: 160 TPNK-VDAWMYGHEF--EDFTQSSIELDAFVFRHIYELFNNTKSNKTLETEIKQDGNVFF 216

Query: 204 LHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV-----DDETLICVMGDHGMNDV 258
           LH LG D  GH   P S       + +D+ +K + E V     D++T      DHGM+  
Sbjct: 217 LHLLGCDTAGHSYRPYSAEYYDNVKYIDKEVKLLVEKVHEFFDDEDTAFIFTADHGMSAF 276

Query: 259 GNHGGSSAGETSAAL----ALISKKLRRYAPPAEQIGVQLPVQNADGEVDYQYLTRIQQV 314
           G+HG      T   L    A I+K ++  AP  +       + +            + Q 
Sbjct: 277 GSHGDGHPNNTRTPLVAWGAGINKPVKNQAPIFDNYTENWNLADIKRN-------DVNQA 329

Query: 315 DIVPTLAALFNFPIPKNSVGILIQETLQLLD-PKLAKIKLLEN----------LKQLDSI 363
           DI   ++ L     P NSVG L    L  +D P+  K+  L N          +K+ + I
Sbjct: 330 DIASLMSYLIGANYPVNSVGEL---PLNFIDAPEDKKLNALFNNAKAILEQYLVKEQEII 386

Query: 364 SNGHEVIQDEANIDQLY-DLMKDIQSDLTRSATNYN 398
           ++     + EA ++  Y + ++ I+S + R A   N
Sbjct: 387 ASQFVYKEYEAFVEIPYQEYLQQIESLIERIAKGEN 422

>KLLA0A11374g Chr1 complement(985471..987336) [1866 bp, 621 aa] {ON}
           some similarities with uniprot|P25353 Saccharomyces
           cerevisiae YCR026C NPP1
          Length = 621

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 7/82 (8%)

Query: 184 NVTRHLPKQLNN-----QQEWDALILHYLGL-DHIGHKGGPNSQFMPAKQ-EEMDEILKQ 236
           N+   L  +LN      Q E   L   Y+ + D +GHK G       +K  +E+D+ L+Q
Sbjct: 272 NIDEPLNDKLNTIRTALQNESTTLTFAYVPVVDTMGHKYGNLIDSGHSKVLKEVDDFLEQ 331

Query: 237 IYENVDDETLICVMGDHGMNDV 258
           ++ +VD+   I V+ DHGM+ +
Sbjct: 332 LFADVDENVNILVISDHGMSTI 353

>YLR047C Chr12 complement(239347..241407) [2061 bp, 686 aa] {ON}
           FRE8Protein with sequence similarity to iron/copper
           reductases, involved in iron homeostasis; deletion
           mutant has iron deficiency/accumulation growth defects;
           expression increased in the absence of copper-responsive
           transcription factor Mac1p
          Length = 686

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 8/71 (11%)

Query: 239 ENVDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKK--LRRYAPPAEQIGVQLPV 296
            ++     +  +GD+ M   GN   +   E +A   L+SKK  LR + PP       +P 
Sbjct: 486 RSISSSGRVSELGDNSMLSDGNPQPTEPNENTA---LLSKKSTLRNHHPPKTS---DIPD 539

Query: 297 QNADGEVDYQY 307
            NAD E+D+ Y
Sbjct: 540 INADDEIDFTY 550

>Kpol_1044.18 s1044 complement(37667..40735) [3069 bp, 1022 aa] {ON}
           complement(37667..40735) [3069 nt, 1023 aa]
          Length = 1022

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 70/152 (46%), Gaps = 20/152 (13%)

Query: 194 NNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENVDDETLICVMGDH 253
           N+ ++W+ LI H  GL         N   +   Q E+D+++  + +++D++TL+ V+   
Sbjct: 248 NDIEKWEVLIGHLYGLKPHDENLETNDPSILRNQIEIDKLITDLKKSMDNDTLLMVVS-- 305

Query: 254 GMNDVGNHGGSSAGETSAALALISKKLRRYA--PPAEQIGV----QLPVQNADGEVDYQY 307
                    G+S   T   +      L  Y+  P      V     L +   +  + Y  
Sbjct: 306 ---------GNSKFSTKDVIKNNKNILYLYSNVPNLWNYSVADNSNLIIGKDNSTLKY-- 354

Query: 308 LTRIQQVDIVPTLAALFNFPIPKNSVGILIQE 339
            + I +VDI+P+++ L + P+P +S+G+ I E
Sbjct: 355 -SNIDKVDIIPSISLLLDLPLPVDSLGLFIPE 385

>TBLA0F02430 Chr6 (594075..594566) [492 bp, 163 aa] {ON} Anc_6.108
           YGL057C
          Length = 163

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 14/98 (14%)

Query: 152 DDTWLKLFPKEYFDEYDGTNS-----FFVSDFEQVD-HNVTRHLPKQLNNQQEWDAL--- 202
           DD+ +   P++  D+Y   N+      FVS     D H +++HL +   N Q W++L   
Sbjct: 52  DDSTILATPEKLIDQYKQINNNTQLGHFVSKINDTDRHYLSQHLNELSENSQNWNSLDKG 111

Query: 203 ---ILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQI 237
              + +YL   +IG +   N Q  P+ Q  +D + +++
Sbjct: 112 LIKLQYYLAFGNIGPRNVENLQ-KPSPQ-SIDPLTRKV 147

>Ecym_1107 Chr1 complement(223755..225569) [1815 bp, 604 aa] {ON}
           similar to Ashbya gossypii AFR636C
          Length = 604

 Score = 32.0 bits (71), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 342 QLLDPKLAKIKLLENLKQLDSISNGHEVIQDEANID------QLYDLMKDIQSDLTRSA 394
           Q  DPK   I++L NLK ++S+     V  D  + D       L  L+  +QS + RSA
Sbjct: 161 QASDPKEKAIQILSNLKPMESVPTDVSVPADLGSTDLVLQQAALMQLLSTLQSQMARSA 219

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,202,663
Number of extensions: 3693745
Number of successful extensions: 13414
Number of sequences better than 10.0: 76
Number of HSP's gapped: 13418
Number of HSP's successfully gapped: 86
Length of query: 809
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 691
Effective length of database: 39,950,811
Effective search space: 27606010401
Effective search space used: 27606010401
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 70 (31.6 bits)