Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C070101.1ON2052058761e-120
ZYRO0F18590g1.1ON2002054532e-56
ZYRO0F15840g1.120ON2002054532e-56
Kpol_2002.21.1ON2091042976e-33
TPHA0E036201.120ON1951942897e-32
TPHA0E040801.1ON1951942897e-32
TBLA0A070401.120ON201702697e-29
TBLA0A075901.1ON201702697e-29
Suva_3.1481.1ON175762251e-22
YCR040W (MATALPHA1)1.120ON175702207e-22
YCL066W (HMLALPHA1)1.1ON175702207e-22
Smik_92.1singletonON156662143e-21
Skud_3.1191.120ON174652139e-21
Skud_71.1singletonON155612083e-20
CAGL0B00242g1.1ON1841192033e-19
CAGL0B01243g1.120ON1431192003e-19
Suva_69.2singletonON145621918e-18
NCAS0B091501.1ON150741367e-10
KNAG0C001501.1ON145781201e-07
Ecym_10031.1ON263681212e-07
Ecym_11141.120ON263681212e-07
NDAI0A001001.1ON135701155e-07
KAFR0D007101.120ON172541113e-06
Kwal_33.matalpha1singletonOFF24474900.003
Kwal_33.12992singletonOFF24474900.003
Kwal_YGOB_matalpha11.120ON24474900.003
Kwal_YGOB_HMalpha11.1ON24474900.003
KLTH0F00374g1.1ON24977870.007
Smik_3.1441.120ON5423780.015
KLLA0C00352g1.1ON26186780.12
Smik_88.1singletonON3519680.19
Skud_80.1singletonON3218670.30
Suva_3.140singletonON3120660.42
Suva_3.791.120ON3517650.49
TDEL0H037107.80ON104136664.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C07010
         (205 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....   342   e-120
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...   179   2e-56
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...   179   2e-56
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...   119   6e-33
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...   115   7e-32
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...   115   7e-32
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...   108   7e-29
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...   108   7e-29
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...    91   1e-22
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...    89   7e-22
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...    89   7e-22
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...    87   3e-21
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...    87   9e-21
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    85   3e-20
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    83   3e-19
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    82   3e-19
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        78   8e-18
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      57   7e-10
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    51   1e-07
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    51   2e-07
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    51   2e-07
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    49   5e-07
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    47   3e-06
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...    39   0.003
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...    39   0.003
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...    39   0.003
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...    39   0.003
KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...    38   0.007
Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa] ...    35   0.015
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    35   0.12 
Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON} ...    31   0.19 
Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W (R...    30   0.30 
Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)    30   0.42 
Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)    30   0.49 
TDEL0H03710 Chr8 complement(618159..621284) [3126 bp, 1041 aa] {...    30   4.6  

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score =  342 bits (876), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 169/205 (82%)

Query: 1   MAVSSKSFRGFRVNRPLFKVQINKDSRTSQCXXXXXXXXXXXXXCQPENSGRLEERHVKT 60
           MAVSSKSFRGFRVNRPLFKVQINKDSRTSQC             CQPENSGRLEERHVKT
Sbjct: 1   MAVSSKSFRGFRVNRPLFKVQINKDSRTSQCKAKTKFKKAKLDKCQPENSGRLEERHVKT 60

Query: 61  FVVXXXXXXXXXXXXXXXEKIEQEKRKVYSETSPEIGSLWDSPIAWDNEDLLFSIASDVL 120
           FVV               EKIEQEKRKVYSETSPEIGSLWDSPIAWDNEDLLFSIASDVL
Sbjct: 61  FVVILRPIKIPLPPNILLEKIEQEKRKVYSETSPEIGSLWDSPIAWDNEDLLFSIASDVL 120

Query: 121 GNIYKKPARETASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTF 180
           GNIYKKPARETASNKPLNSFMAFRAYNSQFGYGLKQNI        WHSHPEQQGIWDTF
Sbjct: 121 GNIYKKPARETASNKPLNSFMAFRAYNSQFGYGLKQNILSSLLASAWHSHPEQQGIWDTF 180

Query: 181 AQQFNFVKPKCGFVEWVDQRYERES 205
           AQQFNFVKPKCGFVEWVDQRYERES
Sbjct: 181 AQQFNFVKPKCGFVEWVDQRYERES 205

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  179 bits (453), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 123/205 (60%), Gaps = 9/205 (4%)

Query: 3   VSSKSFRGFRVNRPLFKVQINKDSRTSQCXXXXXXXXXXXXXCQPENSGR-LEERHVKTF 61
           +++KSFRGF+ N+PLFKV++ K  R+ +                   +G+ +E++ V  F
Sbjct: 1   MNTKSFRGFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKCI------AGKCIEDQQVNVF 54

Query: 62  VVXXXXXXXXXXXXXXXEKIEQEKRKVYSET-SPEIGSLWDSPIAWDNEDLLFSIASDVL 120
           +                 KIE+EK K+  +  + +   LWD  + W  E   FSIA   L
Sbjct: 55  MTVSKLIKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYW-GEGYFFSIADSSL 113

Query: 121 GNIYKKPARETASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTF 180
            N+  K +R+  S KPLNSFMAFRAYNSQFG GLKQNI        WHSHPEQQ IWDTF
Sbjct: 114 NNLSTKGSRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTF 173

Query: 181 AQQFNFVKPKCGFVEWVDQRYERES 205
           AQQFNFVKPKCGFVEWVDQRYERES
Sbjct: 174 AQQFNFVKPKCGFVEWVDQRYERES 198

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  179 bits (453), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 123/205 (60%), Gaps = 9/205 (4%)

Query: 3   VSSKSFRGFRVNRPLFKVQINKDSRTSQCXXXXXXXXXXXXXCQPENSGR-LEERHVKTF 61
           +++KSFRGF+ N+PLFKV++ K  R+ +                   +G+ +E++ V  F
Sbjct: 1   MNTKSFRGFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKCI------AGKCIEDQQVNVF 54

Query: 62  VVXXXXXXXXXXXXXXXEKIEQEKRKVYSET-SPEIGSLWDSPIAWDNEDLLFSIASDVL 120
           +                 KIE+EK K+  +  + +   LWD  + W  E   FSIA   L
Sbjct: 55  MTVSKLIKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYW-GEGYFFSIADSSL 113

Query: 121 GNIYKKPARETASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTF 180
            N+  K +R+  S KPLNSFMAFRAYNSQFG GLKQNI        WHSHPEQQ IWDTF
Sbjct: 114 NNLSTKGSRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTF 173

Query: 181 AQQFNFVKPKCGFVEWVDQRYERES 205
           AQQFNFVKPKCGFVEWVDQRYERES
Sbjct: 174 AQQFNFVKPKCGFVEWVDQRYERES 198

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score =  119 bits (297), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 64/104 (61%), Gaps = 4/104 (3%)

Query: 105 AWDNEDLLFSIASDVLGNIYKKPAR----ETASNKPLNSFMAFRAYNSQFGYGLKQNIXX 160
           +WD +DL  S        +   P      +T+S K LN FMAFRAYNSQFGYGLKQ I  
Sbjct: 101 SWDEDDLFLSDTETEYDLLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILS 160

Query: 161 XXXXXXWHSHPEQQGIWDTFAQQFNFVKPKCGFVEWVDQRYERE 204
                 WHS PEQQ  W   +QQFNFVKPKCGFVEWV Q YERE
Sbjct: 161 SLLSEAWHSDPEQQKKWTVLSQQFNFVKPKCGFVEWVGQTYERE 204

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score =  115 bits (289), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 99/194 (51%), Gaps = 16/194 (8%)

Query: 15  RPLFKVQINKDSRTSQCXXXXXXXXXXXXXCQPENSGRLEERHVKTFVVXXXXXXXXXXX 74
           +PLFKV +NK    S                  +N+ +L+++    F+            
Sbjct: 10  QPLFKVSLNKKRIRS------------IKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPP 57

Query: 75  XXXXEKIEQEKRKV---YSETSPEIGSLWDSPIAWDNEDLLFSI-ASDVLGNIYKKPARE 130
                 I+ E R++    S  + ++ SL++  + WD +++L     +D +  I      E
Sbjct: 58  TCLLRSIDAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEEE 117

Query: 131 TASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPK 190
               K LNSF+AFRAYN+QFG GL Q++        WHS PEQ  +WD FAQQFNFVKPK
Sbjct: 118 LLFKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPK 177

Query: 191 CGFVEWVDQRYERE 204
           CGFVEWV Q YERE
Sbjct: 178 CGFVEWVGQTYERE 191

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score =  115 bits (289), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 99/194 (51%), Gaps = 16/194 (8%)

Query: 15  RPLFKVQINKDSRTSQCXXXXXXXXXXXXXCQPENSGRLEERHVKTFVVXXXXXXXXXXX 74
           +PLFKV +NK    S                  +N+ +L+++    F+            
Sbjct: 10  QPLFKVSLNKKRIRS------------IKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPP 57

Query: 75  XXXXEKIEQEKRKV---YSETSPEIGSLWDSPIAWDNEDLLFSI-ASDVLGNIYKKPARE 130
                 I+ E R++    S  + ++ SL++  + WD +++L     +D +  I      E
Sbjct: 58  TCLLRSIDAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEEE 117

Query: 131 TASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPK 190
               K LNSF+AFRAYN+QFG GL Q++        WHS PEQ  +WD FAQQFNFVKPK
Sbjct: 118 LLFKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPK 177

Query: 191 CGFVEWVDQRYERE 204
           CGFVEWV Q YERE
Sbjct: 178 CGFVEWVGQTYERE 191

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score =  108 bits (269), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%)

Query: 135 KPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPKCGFV 194
           + LN F+AFRAYNSQFGYGLKQNI        WH +P QQ +W+ F+Q++NFVKPKCGFV
Sbjct: 127 RVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFV 186

Query: 195 EWVDQRYERE 204
           EW+ Q YERE
Sbjct: 187 EWLGQTYERE 196

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score =  108 bits (269), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%)

Query: 135 KPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPKCGFV 194
           + LN F+AFRAYNSQFGYGLKQNI        WH +P QQ +W+ F+Q++NFVKPKCGFV
Sbjct: 127 RVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFV 186

Query: 195 EWVDQRYERE 204
           EW+ Q YERE
Sbjct: 187 EWLGQTYERE 196

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score = 91.3 bits (225), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 43/76 (56%), Positives = 49/76 (64%)

Query: 126 KPARETASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFN 185
           + A  T S K LNSFMAFRAY SQFG G+KQNI        WH+   Q GIWD FAQQ+N
Sbjct: 82  RKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYN 141

Query: 186 FVKPKCGFVEWVDQRY 201
           F+ P  GFVEW+   Y
Sbjct: 142 FINPGFGFVEWLTNNY 157

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score = 89.4 bits (220), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 47/70 (67%)

Query: 132 ASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPKC 191
           +S K LNSFMAFRAY SQFG G+KQN+        WH+   Q GIWD FAQQ+NF+ P  
Sbjct: 88  SSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGF 147

Query: 192 GFVEWVDQRY 201
           GFVEW+   Y
Sbjct: 148 GFVEWLTNNY 157

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score = 89.4 bits (220), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 47/70 (67%)

Query: 132 ASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPKC 191
           +S K LNSFMAFRAY SQFG G+KQN+        WH+   Q GIWD FAQQ+NF+ P  
Sbjct: 88  SSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGF 147

Query: 192 GFVEWVDQRY 201
           GFVEW+   Y
Sbjct: 148 GFVEWLTNNY 157

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 87.0 bits (214), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (69%)

Query: 132 ASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPKC 191
           ++ K LNSFMAFRAY SQFG G+KQNI        WH+   Q GIWD FAQQ+NF+ P  
Sbjct: 88  STKKYLNSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKTQHGIWDYFAQQYNFINPGF 147

Query: 192 GFVEWV 197
           GFVEW+
Sbjct: 148 GFVEWL 153

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score = 86.7 bits (213), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 44/65 (67%)

Query: 137 LNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPKCGFVEW 196
           +NSFMAFRAY SQFG G+KQNI        WH+   Q GIWD FAQQ+NF+ P  GFVEW
Sbjct: 92  INSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 151

Query: 197 VDQRY 201
           +   Y
Sbjct: 152 LTNNY 156

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 43/61 (70%)

Query: 137 LNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPKCGFVEW 196
           +NSFMAFRAY SQFG G+KQNI        WH+   Q GIWD FAQQ+NF+ P  GFVEW
Sbjct: 92  INSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 151

Query: 197 V 197
           +
Sbjct: 152 L 152

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 82.8 bits (203), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 69/119 (57%), Gaps = 3/119 (2%)

Query: 79  EKIEQEKRKVYSETSPEIGSLWDSPIAWDNEDLLFSIASDVLGNIYKKPARETASNKPLN 138
           ++I +E+ K+ S     I ++ D   +W+ +  +    +  +GN+ K  ++ ++  +P+N
Sbjct: 61  KRIREERMKLTSSFESGI-NIIDIETSWEIDKFISHHFNTSIGNVLK--SKSSSKKRPMN 117

Query: 139 SFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPKCGFVEWV 197
           +FMAFR Y +Q G GLKQN         W++    Q IWD FAQQFNF  P+CGFV ++
Sbjct: 118 AFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYI 176

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 81.6 bits (200), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 68/119 (57%), Gaps = 3/119 (2%)

Query: 79  EKIEQEKRKVYSETSPEIGSLWDSPIAWDNEDLLFSIASDVLGNIYKKPARETASNKPLN 138
           ++I +E+ K+ S     I ++ D   +W+ +  +    +  +GN+ K   + ++  +P+N
Sbjct: 20  KRIREERMKLTSSFESGI-NIIDIETSWEIDKFISHHFNTSIGNVLKS--KSSSKKRPMN 76

Query: 139 SFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPKCGFVEWV 197
           +FMAFR Y +Q G GLKQN         W++    Q IWD FAQQFNF  P+CGFV ++
Sbjct: 77  AFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYI 135

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 78.2 bits (191), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 41/62 (66%)

Query: 128 ARETASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFV 187
           A  T S K LNSFMAFRAY SQFG G+KQNI        WH+   Q GIWD FAQQ+NF+
Sbjct: 84  ASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFI 143

Query: 188 KP 189
            P
Sbjct: 144 NP 145

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 57.0 bits (136), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 4/74 (5%)

Query: 126 KPARETASN--KPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQ 183
           KP ++  SN  KP+N F+ FR+Y S++GYG+KQ +        W S    Q +WD FA Q
Sbjct: 79  KPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQ 138

Query: 184 FNFVKPKCGFVEWV 197
           ++ V   C    WV
Sbjct: 139 YSTV--GCEMGVWV 150

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 38/78 (48%)

Query: 107 DNEDLLFSIASDVLGNIYKKPARETASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXX 166
           D+ +++    S  L     +  RE   +  LNSF+AFRAY SQF  G+ QN         
Sbjct: 62  DDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGINQNKLSSILSKF 121

Query: 167 WHSHPEQQGIWDTFAQQF 184
           W S+  QQ  WD   +Q+
Sbjct: 122 WKSNQSQQTFWDRLTEQY 139

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 135 KPLNSFMAFRAYNSQFGYGLKQNIXXXX-XXXXWHSHPEQQGIWDTFAQQFNFVKPKCGF 193
           K +N FMAFR+Y S+F  G+   +         WH  P+ +  W+ FA+ +N  +P   F
Sbjct: 111 KKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSF 170

Query: 194 VEWVDQRY 201
            EW+++ Y
Sbjct: 171 PEWLEKTY 178

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 135 KPLNSFMAFRAYNSQFGYGLKQNIXXXX-XXXXWHSHPEQQGIWDTFAQQFNFVKPKCGF 193
           K +N FMAFR+Y S+F  G+   +         WH  P+ +  W+ FA+ +N  +P   F
Sbjct: 111 KKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSF 170

Query: 194 VEWVDQRY 201
            EW+++ Y
Sbjct: 171 PEWLEKTY 178

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 39/70 (55%)

Query: 126 KPARETASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFN 185
           +P +     K +N FM FR+Y SQ+G GLKQ++        W++H   Q +WD FAQQ N
Sbjct: 52  RPYQSRCYAKSINGFMLFRSYYSQYGKGLKQSLLSPLLSKLWNAHETDQLLWDQFAQQCN 111

Query: 186 FVKPKCGFVE 195
            +  + G  E
Sbjct: 112 AIGHEGGICE 121

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%)

Query: 130 ETASNKPLNSFMAFRAYNSQFGYGLKQNIXXXXXXXXWHSHPEQQGIWDTFAQQ 183
           E   N+ LN FMAFR+Y SQ+  GLKQ          WHS  ++Q  W +  Q+
Sbjct: 114 EICQNRNLNPFMAFRSYYSQYAQGLKQIELSEVLAKAWHSDTKEQNYWISLTQK 167

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 132 ASNKPLNSFMAFRAYNSQFGYG-LKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPK 190
            S K +N F+ FR+Y ++   G ++Q          W SH +    W+ F + +N     
Sbjct: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152

Query: 191 CGFVEWVDQRYERE 204
             F EW+++ Y+ E
Sbjct: 153 MCFTEWLEKNYKPE 166

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 132 ASNKPLNSFMAFRAYNSQFGYG-LKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPK 190
            S K +N F+ FR+Y ++   G ++Q          W SH +    W+ F + +N     
Sbjct: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152

Query: 191 CGFVEWVDQRYERE 204
             F EW+++ Y+ E
Sbjct: 153 MCFTEWLEKNYKPE 166

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 132 ASNKPLNSFMAFRAYNSQFGYG-LKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPK 190
            S K +N F+ FR+Y ++   G ++Q          W SH +    W+ F + +N     
Sbjct: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152

Query: 191 CGFVEWVDQRYERE 204
             F EW+++ Y+ E
Sbjct: 153 MCFTEWLEKNYKPE 166

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 132 ASNKPLNSFMAFRAYNSQFGYG-LKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNFVKPK 190
            S K +N F+ FR+Y ++   G ++Q          W SH +    W+ F + +N     
Sbjct: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152

Query: 191 CGFVEWVDQRYERE 204
             F EW+++ Y+ E
Sbjct: 153 MCFTEWLEKNYKPE 166

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 128 ARETASNKPLNSFMAFRAYNSQFGYG-LKQNIXXXXXXXXWHSHPEQQGIWDTFAQQFNF 186
           +  T   K +N F+ FR+Y ++F  G ++Q          W  + +   +W+ F Q +N 
Sbjct: 89  SNNTVLKKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNR 148

Query: 187 VKPKCGFVEWVDQRYER 203
                 F  W+++ Y++
Sbjct: 149 EVTSMCFTLWLEENYQQ 165

>Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa]
           {ON} YCR040W (REAL)
          Length = 54

 Score = 34.7 bits (78), Expect = 0.015,   Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 179 TFAQQFNFVKPKCGFVEWVDQRY 201
           +F QQ+NF+ P  GFVEW+   Y
Sbjct: 14  SFPQQYNFINPGFGFVEWLTNNY 36

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 4/86 (4%)

Query: 120 LGNIYKKPARETASN---KPLNSFMAFRAYNSQFGYG-LKQNIXXXXXXXXWHSHPEQQG 175
           LGN  +  +R+  +    K +N F+AFR+Y S+   G L Q          W    + + 
Sbjct: 86  LGNSNQLSSRDVKTKTKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRK 145

Query: 176 IWDTFAQQFNFVKPKCGFVEWVDQRY 201
            W+  AQ++N       F  W++  Y
Sbjct: 146 NWELIAQEYNCDASGKHFFNWLEVNY 171

>Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON}
           YCL066W (REAL)
          Length = 35

 Score = 30.8 bits (68), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 15/19 (78%)

Query: 179 TFAQQFNFVKPKCGFVEWV 197
           +F QQ+NF+ P  GFVEW+
Sbjct: 14  SFPQQYNFINPGFGFVEWL 32

>Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W
           (REAL)
          Length = 32

 Score = 30.4 bits (67), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query: 180 FAQQFNFVKPKCGFVEWV 197
           F QQ+NF+ P  GFVEW+
Sbjct: 12  FPQQYNFINPGFGFVEWL 29

>Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)
          Length = 31

 Score = 30.0 bits (66), Expect = 0.42,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 182 QQFNFVKPKCGFVEWVDQRY 201
           QQ+NF+ P  GFVEW+   Y
Sbjct: 1   QQYNFINPGFGFVEWLTNNY 20

>Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)
          Length = 35

 Score = 29.6 bits (65), Expect = 0.49,   Method: Composition-based stats.
 Identities = 11/17 (64%), Positives = 14/17 (82%)

Query: 181 AQQFNFVKPKCGFVEWV 197
           AQQ+NF+ P  GFVEW+
Sbjct: 16  AQQYNFINPGFGFVEWL 32

>TDEL0H03710 Chr8 complement(618159..621284) [3126 bp, 1041 aa] {ON}
           Anc_7.80 YAL019W
          Length = 1041

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%)

Query: 112 LFSIASDVLGNIYKKPARETASNKPLNSFMAFRAYN 147
           LF    D L +I+K+ AR T  NK  N  +A  A N
Sbjct: 667 LFEAKKDYLASIFKQRARTTDDNKGFNPLLAQEAIN 702

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,553,562
Number of extensions: 664946
Number of successful extensions: 1138
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1134
Number of HSP's successfully gapped: 37
Length of query: 205
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 101
Effective length of database: 41,556,135
Effective search space: 4197169635
Effective search space used: 4197169635
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)