Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C070001.2ON23723710651e-148
Kpol_2002.31.2ON2232332502e-25
TPHA0E040701.2ON2312352275e-22
TPHA0E036101.121ON2312352275e-22
ZYRO0F15818g1.121ON2251802162e-20
ZYRO0F18568g1.2ON2251802162e-20
NCAS0B091401.2ON205732142e-20
NDAI0A001101.2ON211762134e-20
Suva_3.135singletonON119722022e-19
Suva_3.74singletonON119722022e-19
Suva_3.751.121ON119722022e-19
YCR096C (HMRA2)singletonOFF119722022e-19
KNAG0C001601.2ON2031702055e-19
Skud_102.1singletonON185722028e-19
Smik_95.1singletonON185722028e-19
Smik_3.1421.121ON228722041e-18
Skud_3.1181.121ON210722031e-18
Suva_3.1471.2ON210722031e-18
YCR039C (MATALPHA2)1.121ON210722031e-18
YCL067C (HMLALPHA2)1.2ON210722031e-18
KAFR0D007201.121ON206871899e-17
Ecym_11151.121ON2301971892e-16
Ecym_10021.2ON2301971892e-16
TBLA0A070501.121ON261711734e-14
CAGL0B00264g1.2ON2101281671e-13
CAGL0B01265g1.121ON186631661e-13
TBLA0A076001.2ON230581611e-12
KLLA0C00374g1.2ON2231321443e-10
KLTH0F00396g1.2ON108591172e-07
Kwal_YGOB_matalpha21.121ON110541172e-07
Kwal_33.12995singletonOFF110541172e-07
Kwal_YGOB_HMalpha21.2ON110541172e-07
Kwal_33.matalpha2singletonOFF110541172e-07
AFL049C6.170ON257611144e-06
Ecym_22476.170ON349611144e-06
Suva_7.1726.170ON270711135e-06
ZYRO0G22044g6.170ON201681107e-06
Skud_16.1036.170ON295831073e-05
KLTH0H05236g6.170ON234761054e-05
YGL096W (TOS8)6.170ON276711064e-05
Smik_7.1816.170ON274711055e-05
Smik_6.3746.170ON294791047e-05
Suva_16.1326.170ON292641047e-05
Skud_7.1816.170ON274851039e-05
KLLA0B10450g6.170ON389521049e-05
YPL177C (CUP9)6.170ON306611021e-04
KAFR0G036506.170ON17780983e-04
CAGL0C01551g6.170ON22159984e-04
NCAS0H011306.170ON28073976e-04
SAKL0A05610g6.170ON32052976e-04
TDEL0F018106.170ON25668930.002
NDAI0F021706.170ON383105940.002
TPHA0B025806.170ON26474910.003
CAGL0H02959g6.170ON25959900.005
KAFR0A043706.170ON40961900.005
Kwal_27.110926.170ON22952890.005
NCAS0D035706.170ON25752890.005
AFR643C1.122ON10263840.006
Kpol_1036.566.170ON26572890.006
KNAG0M005006.170ON29854880.008
ADL394Cna 1ON10263820.012
AER456Wna 2ON5756780.016
NDAI0I013206.170ON40969860.018
KNAG0F022106.170ON32452850.024
TBLA0C037406.170ON29367830.035
Kpol_2002.481.122ON9074710.35
Kpol_408.2singletonON9074710.35
Kpol_1058.2na 2ON9074710.35
TPHA0E04055singletonON8458642.7
TPHA0E035951.122ON8458642.7
TBLA0G01060na 2ON17454663.6
CAGL0K09680g2.134ON15448645.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C07000
         (237 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...   414   e-148
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...   100   2e-25
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...    92   5e-22
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...    92   5e-22
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...    88   2e-20
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...    88   2e-20
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...    87   2e-20
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...    87   4e-20
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...    82   2e-19
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...    82   2e-19
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...    82   2e-19
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...    82   2e-19
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...    84   5e-19
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)        82   8e-19
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)          82   8e-19
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...    83   1e-18
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...    83   1e-18
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...    83   1e-18
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...    83   1e-18
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...    83   1e-18
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...    77   9e-17
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...    77   2e-16
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...    77   2e-16
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...    71   4e-14
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...    69   1e-13
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...    69   1e-13
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...    67   1e-12
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    60   3e-10
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    50   2e-07
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    50   2e-07
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    50   2e-07
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    50   2e-07
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    50   2e-07
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    49   4e-06
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    49   4e-06
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    48   5e-06
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    47   7e-06
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    46   3e-05
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    45   4e-05
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    45   4e-05
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    45   5e-05
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    45   7e-05
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    45   7e-05
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    44   9e-05
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    45   9e-05
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    44   1e-04
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    42   3e-04
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    42   4e-04
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    42   6e-04
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    42   6e-04
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    40   0.002
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    41   0.002
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    40   0.003
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    39   0.005
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    39   0.005
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    39   0.005
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    39   0.005
AFR643C Chr6 complement(1608340..1608648) [309 bp, 102 aa] {ON} ...    37   0.006
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    39   0.006
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    39   0.008
ADL394C Chr4 complement(18058..18366) [309 bp, 102 aa] {ON} Non-...    36   0.012
AER456W Chr5 (1512285..1512285,1512359..1512531) [174 bp, 57 aa]...    35   0.016
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    38   0.018
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    37   0.024
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    37   0.035
Kpol_2002.48 s2002 complement(103569..103598,103652..103813,1038...    32   0.35 
Kpol_408.2 s408 complement(1157..1186,1240..1401,1457..1537) [27...    32   0.35 
Kpol_1058.2 s1058 (4720..4800,4856..5017,5071..5100) [273 bp, 90...    32   0.35 
TPHA0E04055 Chr5 (848518..848580,848636..848797,848896..848925) ...    29   2.7  
TPHA0E03595 Chr5 (764541..764603,764659..764820,764919..764948) ...    29   2.7  
TBLA0G01060 Chr7 complement(267271..267300,267367..267663,267722...    30   3.6  
CAGL0K09680g Chr11 (949389..949853) [465 bp, 154 aa] {ON} simila...    29   5.9  

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score =  414 bits (1065), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 210/237 (88%), Positives = 210/237 (88%)

Query: 1   MTTKIPINLLLNPQQHXXXXXXXXXXXXXXXLRGTRVTQHKREADELFFKLSNGIGKPEF 60
           MTTKIPINLLLNPQQH               LRGTRVTQHKREADELFFKLSNGIGKPEF
Sbjct: 1   MTTKIPINLLLNPQQHDDKKEKKDKSESCSKLRGTRVTQHKREADELFFKLSNGIGKPEF 60

Query: 61  ELRCELKKVLSSLKVVTTXXXXXXXXXXXXRTTFQLSKTLSVVLSEFKKVEESNIQFHKS 120
           ELRCELKKVLSSLKVVTT            RTTFQLSKTLSVVLSEFKKVEESNIQFHKS
Sbjct: 61  ELRCELKKVLSSLKVVTTNGKLEENGELLLRTTFQLSKTLSVVLSEFKKVEESNIQFHKS 120

Query: 121 RDWDSERKETNLRCKVPNFEIVPLNTKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKP 180
           RDWDSERKETNLRCKVPNFEIVPLNTKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKP
Sbjct: 121 RDWDSERKETNLRCKVPNFEIVPLNTKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKP 180

Query: 181 YLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLLFTKKNSKTDTKV 237
           YLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLLFTKKNSKTDTKV
Sbjct: 181 YLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLLFTKKNSKTDTKV 237

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score =  100 bits (250), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 113/233 (48%), Gaps = 31/233 (13%)

Query: 4   KIPINLLLNPQQHXXXXXXXXXXXXXXXLRGTRVTQHKREADELFFKLSNGIGKPEFELR 63
           KIPIN+LLNP                      ++ Q   +   L  K+       E E  
Sbjct: 3   KIPINILLNPSHQENLK--------------DKLQQINDKLTSLCSKIPGNTSGLEQEDH 48

Query: 64  CELKKVLSSLKVVTTXXXXXXXXXXXXRTTFQLSKTLSVVLSEFKKVEESNIQFHKSRDW 123
            EL+++L  L  V              RTT+QLS TLS+++   +   E N +   S++ 
Sbjct: 49  LELQRILLFLTTVVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANE-NYESQTSKE- 106

Query: 124 DSERKETNLRCKVPN------FEIVPLNTKQDYSTGKR-----HRGHRLPSEKVEKLELW 172
           +SE + T+      N      F IV     QD    K+     +RGHRLP + V+ LE W
Sbjct: 107 NSEEELTSPSSSDSNDRNEFVFNIVT----QDMMNKKKMNIKSYRGHRLPKQNVKLLERW 162

Query: 173 FNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLL 225
           + QN+  PYL+ +++  L+  TSLS +QIKNW+SNRRRK+KS  I+  +S LL
Sbjct: 163 YIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLL 215

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score = 92.0 bits (227), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 109/235 (46%), Gaps = 27/235 (11%)

Query: 4   KIPINLLLNPQQHXXXXXXXXXXXXXXXLRGTRVTQHKREADELFFKLSNGIGKPEFELR 63
           KIPIN LLNP QH               L+   +T        L  KL + I        
Sbjct: 3   KIPINKLLNPSQHYNLTEK---------LQQINIT-----LSNLCTKLPDTITDLTEADH 48

Query: 64  CELKKVLSSLKVVTTXXXXXXXXXXXXRTTFQLSKTLSVVLSEFKKV---EESNIQFHKS 120
            EL+ +L  L  V              +TT+QL  TL++++   K+    E    +  K 
Sbjct: 49  RELQDILLYLTTVVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKY 108

Query: 121 RDWDSERKETNLRCKVPNFE----IVPLNT-KQDY-----STGKRHRGHRLPSEKVEKLE 170
               S+  ETN  C   + E    I+  N   QD         K +RGHRLP + V+ LE
Sbjct: 109 ESGTSDNSETNSSCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLE 168

Query: 171 LWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLL 225
            W+  +   PYLN+  ++ L+ +TSLS IQ+KNW+SNRRRK+KS  I+  +S LL
Sbjct: 169 DWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score = 92.0 bits (227), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 109/235 (46%), Gaps = 27/235 (11%)

Query: 4   KIPINLLLNPQQHXXXXXXXXXXXXXXXLRGTRVTQHKREADELFFKLSNGIGKPEFELR 63
           KIPIN LLNP QH               L+   +T        L  KL + I        
Sbjct: 3   KIPINKLLNPSQHYNLTEK---------LQQINIT-----LSNLCTKLPDTITDLTEADH 48

Query: 64  CELKKVLSSLKVVTTXXXXXXXXXXXXRTTFQLSKTLSVVLSEFKKV---EESNIQFHKS 120
            EL+ +L  L  V              +TT+QL  TL++++   K+    E    +  K 
Sbjct: 49  RELQDILLYLTTVVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKY 108

Query: 121 RDWDSERKETNLRCKVPNFE----IVPLNT-KQDY-----STGKRHRGHRLPSEKVEKLE 170
               S+  ETN  C   + E    I+  N   QD         K +RGHRLP + V+ LE
Sbjct: 109 ESGTSDNSETNSSCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLE 168

Query: 171 LWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLL 225
            W+  +   PYLN+  ++ L+ +TSLS IQ+KNW+SNRRRK+KS  I+  +S LL
Sbjct: 169 DWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score = 87.8 bits (216), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 93/180 (51%), Gaps = 11/180 (6%)

Query: 63  RCELKKVLSSLKVVTTXXXXXXXXXXXXRTTFQLSKTLSVVLSEFKKVEESNIQFHKSRD 122
           + EL+K+L SL ++                  QLS   S++L+E  +++    QF +S+ 
Sbjct: 47  KAELEKILPSLNILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKP 106

Query: 123 -----WDSERKETNLRCKVPNFEIVPLNT-KQDYSTGKRHRGHRLPSEKVEKLELWFNQN 176
                + +    T     V  F IV  +T      + K +RGHRLP      LE WFN+N
Sbjct: 107 KYHLPYAAALGNTGKEGMV--FNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRN 164

Query: 177 ISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLLFTKKNSKTDTK 236
           I  PYL   +++ L+ ET LS  QIKNW+SNRRRK+KS  I+  +S+L+   K SK  T+
Sbjct: 165 IEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV---KESKQGTE 221

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score = 87.8 bits (216), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 93/180 (51%), Gaps = 11/180 (6%)

Query: 63  RCELKKVLSSLKVVTTXXXXXXXXXXXXRTTFQLSKTLSVVLSEFKKVEESNIQFHKSRD 122
           + EL+K+L SL ++                  QLS   S++L+E  +++    QF +S+ 
Sbjct: 47  KAELEKILPSLNILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKP 106

Query: 123 -----WDSERKETNLRCKVPNFEIVPLNT-KQDYSTGKRHRGHRLPSEKVEKLELWFNQN 176
                + +    T     V  F IV  +T      + K +RGHRLP      LE WFN+N
Sbjct: 107 KYHLPYAAALGNTGKEGMV--FNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRN 164

Query: 177 ISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLLFTKKNSKTDTK 236
           I  PYL   +++ L+ ET LS  QIKNW+SNRRRK+KS  I+  +S+L+   K SK  T+
Sbjct: 165 IEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV---KESKQGTE 221

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score = 87.0 bits (214), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 42/73 (57%), Positives = 55/73 (75%)

Query: 157 RGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAG 216
           RGHRL  EKV+ LE W+ Q++  PYLN+ +L+ L+ ETSLS +QIKNW+SNRRRK+KS  
Sbjct: 133 RGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEKSLS 192

Query: 217 IADTISDLLFTKK 229
           IA  I D+L  +K
Sbjct: 193 IAPEIVDILNKQK 205

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score = 86.7 bits (213), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 40/76 (52%), Positives = 55/76 (72%)

Query: 153 GKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKK 212
            K HRGHRLP EKV +LE W+  +I KPYL+ + L+ L+ ET LS +QIKNW+SNRRRK+
Sbjct: 133 NKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKE 192

Query: 213 KSAGIADTISDLLFTK 228
           K   I+  I +++ T+
Sbjct: 193 KLLSISPDIVEIINTQ 208

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K +RGHR   E V  LE WF +NI  PYL+ + L  L+  TSLS IQIKNW+SNRRRK+K
Sbjct: 38  KPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 97

Query: 214 SAGIADTISDLL 225
           +  IA  ++DLL
Sbjct: 98  TITIAPELADLL 109

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K +RGHR   E V  LE WF +NI  PYL+ + L  L+  TSLS IQIKNW+SNRRRK+K
Sbjct: 38  KPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 97

Query: 214 SAGIADTISDLL 225
           +  IA  ++DLL
Sbjct: 98  TITIAPELADLL 109

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K +RGHR   E V  LE WF +NI  PYL+ + L  L+  TSLS IQIKNW+SNRRRK+K
Sbjct: 38  KPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 97

Query: 214 SAGIADTISDLL 225
           +  IA  ++DLL
Sbjct: 98  TITIAPELADLL 109

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K +RGHR   E V  LE WF +NI  PYL+ + L  L+  TSLS IQIKNW+SNRRRK+K
Sbjct: 38  KPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 97

Query: 214 SAGIADTISDLL 225
           +  IA  ++DLL
Sbjct: 98  TITIAPELADLL 109

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score = 83.6 bits (205), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 84/170 (49%), Gaps = 19/170 (11%)

Query: 61  ELRCELKKVLSSLKVVTTXXXXXXXXXXXXRTTFQLSKTLSVVLSEFKKVEESNIQFHKS 120
           EL+ +L+ +L  L  +              R T+Q SK ++ +L  F+            
Sbjct: 46  ELQMQLQGILLFLTKLVGKNDLSVTLKNEARMTYQFSKIIASLLKSFE------------ 93

Query: 121 RDWDSERKETNLRCKVPNFEIVPLNTKQDYSTGKRH-----RGHRLPSEKVEKLELWFNQ 175
            D+  ERKE N      N E V     QD    ++      RGHR  S   E LE W+ +
Sbjct: 94  -DFFFERKEYNDPATSEN-EFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKK 151

Query: 176 NISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLL 225
           +  KPYL++R+L  L  +T LS +QI+NW+SNRRRK+KS  ++  I DLL
Sbjct: 152 HHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score = 82.4 bits (202), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K +RGHR   E V  LE WF +NI  PYL+ + L  L+  TSLS IQIKNW+SNRRRK+K
Sbjct: 104 KPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 163

Query: 214 SAGIADTISDLL 225
           +  IA  ++DLL
Sbjct: 164 TITIAPELADLL 175

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score = 82.4 bits (202), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K +RGHR   E V  LE WF +NI  PYL+ + L  L+  TSLS IQIKNW+SNRRRK+K
Sbjct: 104 KPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 163

Query: 214 SAGIADTISDLL 225
           +  IA  ++DLL
Sbjct: 164 TITIAPELADLL 175

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score = 83.2 bits (204), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K +RGHR   E V  LE WF +NI  PYL+ + L  L+  TSLS IQIKNW+SNRRRK+K
Sbjct: 147 KPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 206

Query: 214 SAGIADTISDLL 225
           +  IA  ++DLL
Sbjct: 207 TITIAPELADLL 218

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score = 82.8 bits (203), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K +RGHR   E V  LE WF +NI  PYL+ + L  L+  TSLS IQIKNW+SNRRRK+K
Sbjct: 129 KPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188

Query: 214 SAGIADTISDLL 225
           +  IA  ++DLL
Sbjct: 189 TITIAPELADLL 200

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score = 82.8 bits (203), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K +RGHR   E V  LE WF +NI  PYL+ + L  L+  TSLS IQIKNW+SNRRRK+K
Sbjct: 129 KPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188

Query: 214 SAGIADTISDLL 225
           +  IA  ++DLL
Sbjct: 189 TITIAPELADLL 200

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score = 82.8 bits (203), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K +RGHR   E V  LE WF +NI  PYL+ + L  L+  TSLS IQIKNW+SNRRRK+K
Sbjct: 129 KPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188

Query: 214 SAGIADTISDLL 225
           +  IA  ++DLL
Sbjct: 189 TITIAPELADLL 200

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score = 82.8 bits (203), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K +RGHR   E V  LE WF +NI  PYL+ + L  L+  TSLS IQIKNW+SNRRRK+K
Sbjct: 129 KPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188

Query: 214 SAGIADTISDLL 225
           +  IA  ++DLL
Sbjct: 189 TITIAPELADLL 200

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score = 77.4 bits (189), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 55/87 (63%)

Query: 139 FEIVPLNTKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSP 198
           F +V  +      TG  +RGHR   E V+ LE W+  +I +PYLN+++   L+ +T LS 
Sbjct: 116 FNVVTQDMMNLNRTGISYRGHRFSKENVKVLERWYTAHIDRPYLNRQSTEYLISKTGLSR 175

Query: 199 IQIKNWLSNRRRKKKSAGIADTISDLL 225
           +QIKNW+SNRRRK+KS  ++  +  LL
Sbjct: 176 VQIKNWVSNRRRKEKSVHVSPELIQLL 202

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score = 77.4 bits (189), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 92/197 (46%), Gaps = 20/197 (10%)

Query: 43  EADELFFKLSNGIGKPEFELRCE----------LKKVLSSLKVVTTXXXXXXXXXXXXRT 92
           EAD +  K+ N + K    + C           L KVL  LK++++            R 
Sbjct: 38  EAD-ILLKMRNELMKLHSSICCTNIENGEVNFILNKVLQGLKILSSDQVFSKPD----RV 92

Query: 93  TFQLSKTLSVVLSEFKKVEESNIQFHKSRDWDSERKE--TNLRCKVPNFEIVPLNTKQDY 150
             Q    L+ ++      +E  I   K      E  E  +  +C +  F +V  +  ++ 
Sbjct: 93  VIQNISQLTAIIVRLVNKKEDIINLQKGLVDPKEIPEAISKEKCGII-FNVVTQDMMENG 151

Query: 151 STG--KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNR 208
             G    ++GHRLP + V+ LE W+  NI  PYLN   +R L+ ET  S  Q+KNW++N+
Sbjct: 152 RKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANK 211

Query: 209 RRKKKSAGIADTISDLL 225
           RRK K + I+  +SDLL
Sbjct: 212 RRKDKHSTISPELSDLL 228

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score = 77.4 bits (189), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 92/197 (46%), Gaps = 20/197 (10%)

Query: 43  EADELFFKLSNGIGKPEFELRCE----------LKKVLSSLKVVTTXXXXXXXXXXXXRT 92
           EAD +  K+ N + K    + C           L KVL  LK++++            R 
Sbjct: 38  EAD-ILLKMRNELMKLHSSICCTNIENGEVNFILNKVLQGLKILSSDQVFSKPD----RV 92

Query: 93  TFQLSKTLSVVLSEFKKVEESNIQFHKSRDWDSERKE--TNLRCKVPNFEIVPLNTKQDY 150
             Q    L+ ++      +E  I   K      E  E  +  +C +  F +V  +  ++ 
Sbjct: 93  VIQNISQLTAIIVRLVNKKEDIINLQKGLVDPKEIPEAISKEKCGII-FNVVTQDMMENG 151

Query: 151 STG--KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNR 208
             G    ++GHRLP + V+ LE W+  NI  PYLN   +R L+ ET  S  Q+KNW++N+
Sbjct: 152 RKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANK 211

Query: 209 RRKKKSAGIADTISDLL 225
           RRK K + I+  +SDLL
Sbjct: 212 RRKDKHSTISPELSDLL 228

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score = 71.2 bits (173), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 156 HRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK-S 214
           HRGHRLP   +  LE WF  N S PYL+   L+ L  ++SLS  Q+KNW+SNRRRK++ S
Sbjct: 169 HRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERHS 228

Query: 215 AGIADTISDLL 225
             I++ I+ LL
Sbjct: 229 LKISNNIASLL 239

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score = 68.9 bits (167), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 66/128 (51%), Gaps = 25/128 (19%)

Query: 91  RTTFQLSKTLSVVLSEFKKVEESNIQFHKSRDWDSERKETNLRCKVPNFEIVPLNTKQDY 150
           +TT++LS  LS       K+ E  I F      +   K+  L+  VPN            
Sbjct: 70  KTTYRLSTLLS-------KLREHEIVF------NVVTKDHLLKKGVPN------------ 104

Query: 151 STGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRR 210
                +RGHR   E V+ LE W+  +I  PYL+  + + L  +T+LS IQIKNW++NRRR
Sbjct: 105 HYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRR 164

Query: 211 KKKSAGIA 218
           K+KS  I+
Sbjct: 165 KQKSIYIS 172

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score = 68.6 bits (166), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (69%)

Query: 156 HRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSA 215
           +RGHR   E V+ LE W+  +I  PYL+  + + L  +T+LS IQIKNW++NRRRK+KS 
Sbjct: 110 YRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSI 169

Query: 216 GIA 218
            I+
Sbjct: 170 YIS 172

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (68%)

Query: 156 HRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           HRGHRLP   +  LE WF  N S PYL+   L+ L  ++SLS  Q+KNW+SNRRRK++
Sbjct: 169 HRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 10/132 (7%)

Query: 98  KTLSVVLSEFKKVEESNIQFHKSRDWDSERKETNLRCKVPNFEIVPLNT-KQDY---STG 153
           K+L V+L E  K+ E  I+F +       RK    R    NFE V +    QD    +  
Sbjct: 97  KSLLVLLKEKGKMRE--IEFSRKE----VRKINKYRQSSKNFESVNIKILTQDLMHSNNN 150

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           +  +G R P   ++ LE W++ N   PYL +  L  +   T+L+  QIKNWL+NRRRK K
Sbjct: 151 EFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDK 210

Query: 214 SAGIADTISDLL 225
              ++  I ++L
Sbjct: 211 ITEVSSDIRNIL 222

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%)

Query: 167 EKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLL 225
           ++LE WF  NI  PY N+  + +L   T+LS  QI+NW+SNRRRK +   I   +  +L
Sbjct: 48  KRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%)

Query: 160 RLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           + P      LE WF+ N S PYL ++ +  L   T+LS  QI+NW+SNRRRK K
Sbjct: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
           (HMRA2) - Regulatory protein MATa2p (no known function);
           sequence is the same as the last 119 residues of
           MATalpha2p [contig 123] FULL
          Length = 110

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%)

Query: 160 RLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           + P      LE WF+ N S PYL ++ +  L   T+LS  QI+NW+SNRRRK K
Sbjct: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
           ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%)

Query: 160 RLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           + P      LE WF+ N S PYL ++ +  L   T+LS  QI+NW+SNRRRK K
Sbjct: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%)

Query: 160 RLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           + P      LE WF+ N S PYL ++ +  L   T+LS  QI+NW+SNRRRK K
Sbjct: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%)

Query: 152 TGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRK 211
           T K+HR   LP E V+ L  W   +   PY + +  + L+ +T L+P+Q+ NW  N RR+
Sbjct: 129 TKKQHRRSNLPKETVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRR 188

Query: 212 K 212
           K
Sbjct: 189 K 189

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%)

Query: 152 TGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRK 211
           T K+HR   LP E V+ L  W   +   PY + +  + L+ +T L+P+Q+ NW  N RR+
Sbjct: 221 TKKQHRRSNLPKETVDILNEWLRDHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRR 280

Query: 212 K 212
           K
Sbjct: 281 K 281

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 154 KRHRGH----RLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRR 209
           KR++GH     LP   V  L  W  ++I+ PY   +  R L+ +T L+ +QI NW  N R
Sbjct: 190 KRNKGHGKRSNLPGATVHILNKWLLEHINNPYPTLQEKRELLAQTGLTKLQISNWFINAR 249

Query: 210 RKKKSAGIADT 220
           R+K  +G  DT
Sbjct: 250 RRKIFSGQNDT 260

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 151 STGKRHRGHR------LPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNW 204
           S+GK H+G R      LP E V+ L  W   ++  PY   +  R L+ +T L+ IQ+ NW
Sbjct: 68  SSGKNHKGSRSGRRSNLPKETVQILNRWLLDHLGNPYPTPQEKRDLLIKTGLTKIQLSNW 127

Query: 205 LSNRRRKK 212
             N RR+K
Sbjct: 128 FINVRRRK 135

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 5/83 (6%)

Query: 130 TNLRCKVPNFEIVPLNTKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRT 189
           T ++  +P+FE      KQ+  +G+R     LP E V+ L  W   +++ PY  Q+  R 
Sbjct: 132 TQVKRSIPDFEDSKSKRKQN--SGRRSN---LPKETVQILNTWLLNHLNNPYPTQQEKRE 186

Query: 190 LVHETSLSPIQIKNWLSNRRRKK 212
           L+ +T L+ IQ+ NW  N RR+K
Sbjct: 187 LLIKTGLTKIQLSNWFINVRRRK 209

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 11/76 (14%)

Query: 161 LPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKK-------- 212
           LP E VE L  W   +++ PY + +  R L+ +T LS +Q+ NW  N RR+K        
Sbjct: 109 LPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRRKVFSDYYQM 168

Query: 213 ---KSAGIADTISDLL 225
              + AG  D  +D +
Sbjct: 169 SRARRAGAPDEATDAV 184

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 154 KRHRGH----RLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRR 209
           K+H+ H     LP   V  L  W +++++ PY   +  R L+ +T L+ +QI NW  N R
Sbjct: 190 KKHKAHGKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINAR 249

Query: 210 RKKKSAGIADT 220
           R+K  +G  D 
Sbjct: 250 RRKIFSGQNDA 260

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 4/71 (5%)

Query: 154 KRHRGH----RLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRR 209
           K+H+ H     LP   V  L  W  ++I+ PY   +  R L+ +T L+ +QI NW  N R
Sbjct: 188 KKHKAHGKRTNLPKATVSILNKWLLEHINNPYPTVQEKRELLAKTGLTKLQISNWFINAR 247

Query: 210 RKKKSAGIADT 220
           R+K  +G  D 
Sbjct: 248 RRKIFSGQNDA 258

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 9/79 (11%)

Query: 136 VPNFEIVPLNTKQDYSTGKRHRGHR--LPSEKVEKLELWFNQNISKPYLNQRALRTLVHE 193
           +P+FE       +  S  K++ G R  LP E V+ L  W   +++ PY  Q+  R L+ +
Sbjct: 137 IPDFE-------EPKSKKKQNSGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIK 189

Query: 194 TSLSPIQIKNWLSNRRRKK 212
           T L+ IQ+ NW  N RR+K
Sbjct: 190 TGLTKIQLSNWFINVRRRK 208

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 151 STGKRHRGHR--LPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNR 208
           S  K++ G R  LP E V+ L  W   +++ PY  Q+  R L+ +T L+ IQ+ NW  N 
Sbjct: 143 SKKKQNSGRRSNLPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINV 202

Query: 209 RRKK 212
           RR+K
Sbjct: 203 RRRK 206

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 154 KRHRGH----RLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRR 209
           KR +GH     LP   V  L  W  ++I  PY   +  R L+ +T L+ +QI NW  N R
Sbjct: 188 KRLKGHGKRSNLPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINAR 247

Query: 210 RKKKSAGIADTISDLLFTKKNSKTD 234
           R+K  AG  D   + L  K NS  D
Sbjct: 248 RRKIFAGHNDV--NNLKKKFNSSAD 270

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 161 LPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKK 212
           LP E +  L  W  +N+  PY   +  R L+ +T L+P+Q+ NW  N RR+K
Sbjct: 256 LPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRRK 307

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 154 KRHRGHR--LPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRK 211
           K++ G R  LP E V+ L  W   +++ PY  Q+  R L+ +T L+ IQ+ NW  N RR+
Sbjct: 160 KQNSGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 219

Query: 212 K 212
           K
Sbjct: 220 K 220

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 140 EIVPLNTKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPI 199
           E  P++   D  +  R     LP E ++ L  W   ++  PY   +  R L+ +T L+ I
Sbjct: 57  ESSPISNSMD--SKSRQSRSNLPKETIQILNAWLLNHLHNPYPTSQEKRDLLIKTGLTKI 114

Query: 200 QIKNWLSNRRRKKKSAGIAD 219
           Q+ NW  N RR+K   G  D
Sbjct: 115 QLSNWFINVRRRKIFNGYYD 134

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKK 212
           K  R   LP + ++ L  W   +I  PY  Q+  R L+ +T L+ IQ+ NW  N RR+K
Sbjct: 75  KSKRRSNLPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFINVRRRK 133

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 142 VPLNTK--QDYSTGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPI 199
           +PLN K  Q       +R   LP E V+ L  W   ++  PY   +  R L+ +T L+ +
Sbjct: 112 LPLNRKNFQKKQVSHNNRRSNLPKEMVQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKV 171

Query: 200 QIKNWLSNRRRKK 212
           Q+ NW  N RR+K
Sbjct: 172 QLSNWFINVRRRK 184

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 161 LPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKK 212
           LP E V+ L  W   ++  PY + +  R L+ +T L+P+Q+ NW  N RR+K
Sbjct: 213 LPKETVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNWFINVRRRK 264

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 145 NTKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNW 204
           N     S G+R     LP E V+ L  W   ++  PY   +  R L+ +T L+ IQ+ NW
Sbjct: 123 NNSGGISNGRRSN---LPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNW 179

Query: 205 LSNRRRKK 212
             N RR+K
Sbjct: 180 FINVRRRK 187

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 51/105 (48%), Gaps = 4/105 (3%)

Query: 135 KVPNFEIVPLNTKQDYS---TGKRH-RGHRLPSEKVEKLELWFNQNISKPYLNQRALRTL 190
           K P+ E  P+N   D     T  +H R   LP E +  L  W   ++  PY   +  R L
Sbjct: 240 KQPSPENKPVNVSSDVVEELTSLQHGRRSNLPKETIRILNSWLLNHLQNPYPTSQEKRDL 299

Query: 191 VHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLLFTKKNSKTDT 235
           + +T L+ +Q+ NW  N RR+K      +   ++  ++ +S+T+T
Sbjct: 300 LIKTGLTKVQLSNWFINVRRRKIFHDYYEMAQNMKSSQDDSETET 344

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 139 FEIVPLNTKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSP 198
           F  +   T    S GKR     LP + V+ L  W   ++  PY   +    L+  T LS 
Sbjct: 141 FSTINTQTTSKTSIGKRSN---LPKQSVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSK 197

Query: 199 IQIKNWLSNRRRKK 212
           IQ+ NW  N RR+K
Sbjct: 198 IQLSNWFINVRRRK 211

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%)

Query: 161 LPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIAD 219
           LP E V+ L  W   +I+ PY   +    L  +T L+ IQ+ NW  N RR+K  A   D
Sbjct: 168 LPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRRKVFADYYD 226

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 152 TGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRK 211
           TGKR     LP E V+ L  W   ++  PY        L+ +T L+ IQ+ NW  N RR+
Sbjct: 269 TGKRSN---LPKETVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVRRR 325

Query: 212 K 212
           K
Sbjct: 326 K 326

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 161 LPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKK 212
           LP E V+ L  W   +++ PY + +  R L+ +T LS +Q+ NW  N RR+K
Sbjct: 125 LPKETVDILNNWLLAHLNYPYPSPQEKRELLIKTGLSKVQLSNWFINVRRRK 176

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 161 LPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKK 212
           LP   VE L  W  ++++ PY N +  + L+  T L+ +Q+ NW  N RR+K
Sbjct: 187 LPRGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRRK 238

>AFR643C Chr6 complement(1608340..1608648) [309 bp, 102 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR097W
           (HMRA1)
          Length = 102

 Score = 37.0 bits (84), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K+ R   LP E  E LE  F +   K + N +  R +  +  L+PIQI+ W +N+R + K
Sbjct: 40  KQRRRTVLPKETKEFLESVFER---KRWPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSK 96

Query: 214 SAG 216
           + G
Sbjct: 97  TRG 99

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 151 STGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRR 210
             GKR     LP   V+ L  W   ++  PY   +  + L+ +T L+ IQ+ NW  N RR
Sbjct: 156 GAGKRSN---LPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLTKIQLSNWFINVRR 212

Query: 211 KKKSAGIADTIS 222
           +K  +   D ++
Sbjct: 213 RKIFSDYYDIVN 224

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%)

Query: 159 HRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKK 212
           + LP + V  L  W   ++  PY   +  R L+ +T LS IQ+ NW  N RR+K
Sbjct: 181 YNLPKDTVLILNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFINVRRRK 234

>ADL394C Chr4 complement(18058..18366) [309 bp, 102 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCR097W
           (HMRA1)
          Length = 102

 Score = 36.2 bits (82), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 154 KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           K+ R   LP E  E LE  F +   K   N +  R +  +  L+PIQI+ W +N+R + K
Sbjct: 40  KQRRRTVLPKETKEFLESVFER---KRCPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSK 96

Query: 214 SAG 216
           + G
Sbjct: 97  TRG 99

>AER456W Chr5 (1512285..1512285,1512359..1512531) [174 bp, 57 aa]
           {ON} Non-syntenic homolog of Saccharomyces cerevisiae
           YCR097W (HMRA1); 1-intron
          Length = 57

 Score = 34.7 bits (78), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 161 LPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAG 216
           LP E  E LE  F +   K   N +  R +  +  L+PIQI+ W +N+R + K+ G
Sbjct: 2   LPKETKEFLESVFER---KRCPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSKTRG 54

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 144 LNTKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKN 203
           +N ++   +G+R     LP   V+ L  W   +++ PY   +  + L+ +T L+ IQ+ N
Sbjct: 298 MNMRRKKGSGRRSS---LPITTVQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLSN 354

Query: 204 WLSNRRRKK 212
           W  N RR+K
Sbjct: 355 WFINVRRRK 363

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 37.4 bits (85), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%)

Query: 161 LPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKK 212
           LP E V+ L  W   ++  PY        L+ +T L+ IQ+ NW  N RR+K
Sbjct: 246 LPRETVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFINVRRRK 297

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 36.6 bits (83), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 146 TKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWL 205
           +K +Y   KR     LP E V+ L  W   ++  PY   +    L+  T L+ IQ+ NW 
Sbjct: 170 SKLNYMVSKRSN---LPKETVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWF 226

Query: 206 SNRRRKK 212
            N RR+K
Sbjct: 227 INVRRRK 233

>Kpol_2002.48 s2002
           complement(103569..103598,103652..103813,103869..103949)
           [273 bp, 90 aa] {ON}
           complement(103569..103598,103652..103813,103869..103949)
           [273 nt, 91 aa]
          Length = 90

 Score = 32.0 bits (71), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 140 EIVPLNTKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPI 199
           +I+ LN   + S+   HR   LP E    LE  F +   K  LN +    +  +  L+P+
Sbjct: 22  DILSLNIYNESSSD--HRKKFLPKEARLFLERVFEK---KQSLNSKERDAIAKKCGLTPL 76

Query: 200 QIKNWLSNRRRKKK 213
           Q++ W  N+R + K
Sbjct: 77  QVRVWFINKRMRSK 90

>Kpol_408.2 s408 complement(1157..1186,1240..1401,1457..1537) [273
           bp, 90 aa] {ON}
           complement(1157..1186,1240..1401,1457..1537) [273 nt, 91
           aa]
          Length = 90

 Score = 32.0 bits (71), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 140 EIVPLNTKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPI 199
           +I+ LN   + S+   HR   LP E    LE  F +   K  LN +    +  +  L+P+
Sbjct: 22  DILSLNIYNESSSD--HRKKFLPKEARLFLERVFEK---KQSLNSKERDAIAKKCGLTPL 76

Query: 200 QIKNWLSNRRRKKK 213
           Q++ W  N+R + K
Sbjct: 77  QVRVWFINKRMRSK 90

>Kpol_1058.2 s1058 (4720..4800,4856..5017,5071..5100) [273 bp, 90
           aa] {ON} (4720..4800,4856..5017,5071..5100) [273 nt, 91
           aa]
          Length = 90

 Score = 32.0 bits (71), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 140 EIVPLNTKQDYSTGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPI 199
           +I+ LN   + S+   HR   LP E    LE  F +   K  LN +    +  +  L+P+
Sbjct: 22  DILSLNIYNESSSD--HRKKFLPKEARLFLERVFEK---KQSLNSKERDAIAKKCGLTPL 76

Query: 200 QIKNWLSNRRRKKK 213
           Q++ W  N+R + K
Sbjct: 77  QVRVWFINKRMRSK 90

>TPHA0E04055 Chr5 (848518..848580,848636..848797,848896..848925)
           [255 bp, 84 aa] {ON} silenced copy of a1 at HMLalpha
           locus
          Length = 84

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 156 HRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           HR   LP E    LE  F +   K  LN +    +  +  L+P+Q++ W  N+R + K
Sbjct: 30  HRKKFLPKEARLFLERVFEK---KQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84

>TPHA0E03595 Chr5 (764541..764603,764659..764820,764919..764948)
           [255 bp, 84 aa] {ON} MATa1 gene at MAT locus
          Length = 84

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 156 HRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           HR   LP E    LE  F +   K  LN +    +  +  L+P+Q++ W  N+R + K
Sbjct: 30  HRKKFLPKEARLFLERVFEK---KQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84

>TBLA0G01060 Chr7
           complement(267271..267300,267367..267663,267722..267919)
           [525 bp, 174 aa] {ON}  silenced copy of mating-type a1
           gene at HMR locus
          Length = 174

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 160 RLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213
           +LP E  E LE  F +  +   LN +    +  +  +SPIQ++ W  N+R + K
Sbjct: 124 QLPKEAKEFLERVFKKQHT---LNSKEREAVAKQCGISPIQVRVWFINKRMRSK 174

>CAGL0K09680g Chr11 (949389..949853) [465 bp, 154 aa] {ON} similar
           to uniprot|P53913 Saccharomyces cerevisiae YNL133c
          Length = 154

 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 95  QLSKTLSVVLSEFKKVEESNIQ----FHKSRDWDSERKETNLRCKVPN 138
           QLSK  +    E +K  E  IQ    FHK +D++ E+K   L  + P+
Sbjct: 70  QLSKEETRYFKELEKNREQEIQRLTQFHKDKDYEYEKKRQQLLSRSPD 117

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,991,918
Number of extensions: 850755
Number of successful extensions: 2664
Number of sequences better than 10.0: 81
Number of HSP's gapped: 2718
Number of HSP's successfully gapped: 81
Length of query: 237
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 131
Effective length of database: 41,326,803
Effective search space: 5413811193
Effective search space used: 5413811193
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)