Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C058001.123ON29629615890.0
TDEL0C06990singletonON29629615890.0
ZYRO0C18304g1.123ON29629311061e-153
SAKL0C03718g1.123ON28828710871e-150
Kpol_2000.251.123ON28928810791e-149
NDAI0A033801.123ON29729010621e-146
Suva_10.4491.123ON30029610631e-146
YLR348C (DIC1)1.123ON29829610491e-144
NCAS0A035401.123ON30228910491e-144
Smik_12.4371.123ON29829610481e-144
Skud_12.4341.123ON29829610351e-142
KNAG0B057301.123ON29629110251e-140
TPHA0B041301.123ON3163009871e-134
TBLA0A058001.123ON3042859671e-131
CAGL0G01166g1.123ON2952929621e-131
KAFR0A063401.123ON2982879261e-125
KLLA0B12826g2.451ON3192942962e-30
KAFR0D030702.451ON3212932962e-30
Suva_11.1042.451ON3242842761e-27
Smik_11.1182.451ON3242842733e-27
YKL120W (OAC1)2.451ON3242842724e-27
Skud_11.1092.451ON3242842715e-27
NDAI0K014602.451ON3232922716e-27
Kwal_26.76532.451ON3252862709e-27
SAKL0E03498g2.451ON3242862672e-26
NCAS0A044102.451ON3232902645e-26
Kpol_1018.1652.451ON3222842592e-25
Kpol_1072.348.644ON3013102583e-25
TDEL0A022702.451ON3222902575e-25
CAGL0K11616g2.451ON3202862576e-25
TPHA0G025102.451ON3212842542e-24
KLTH0D04928g2.451ON3252932498e-24
ZYRO0G02640g2.451ON3252812462e-23
KNAG0A063602.451ON3222872453e-23
KLLA0D07073g8.644ON2973002373e-22
Ecym_44947.133ON3942832404e-22
SAKL0H07326g8.644ON2972862354e-22
ZYRO0G17578g7.467ON3162822355e-22
SAKL0F14234g7.467ON3193062312e-21
YEL006W (YEA6)7.133ON3352962313e-21
Ecym_53932.227ON2962892284e-21
Smik_5.1077.133ON3382912304e-21
Skud_5.947.133ON3372922296e-21
YJR095W (SFC1)7.467ON3222902286e-21
KLTH0D10472g8.644ON2962872267e-21
Suva_5.807.133ON3373082279e-21
Kwal_26.86698.644ON2962892251e-20
TPHA0G017708.644ON3082992251e-20
Smik_10.3837.467ON3222902252e-20
Ecym_83298.644ON2982882242e-20
TDEL0C033107.467ON3193022242e-20
SAKL0E09086g2.227ON3103012242e-20
TDEL0A059008.644ON3012972233e-20
Skud_10.3177.467ON3222902224e-20
ACR109W8.644ON2993182214e-20
Ecym_24692.451ON3252812215e-20
Suva_12.1837.467ON3222902181e-19
AGL311C7.467ON3622932192e-19
NCAS0A110603.348ON3062872162e-19
Suva_16.3863.348ON3072892163e-19
YPR021C (AGC1)8.129ON9022782213e-19
Ecym_71587.467ON3233142145e-19
NCAS0H005707.467ON3342982145e-19
KAFR0G009307.467ON3173062146e-19
ZYRO0F06600g8.644ON2972872136e-19
NCAS0A131507.133ON3652972148e-19
Skud_16.3068.129ON9002782179e-19
KAFR0K011107.133ON3382862121e-18
KNAG0E035507.133ON3762892131e-18
TDEL0C044402.227ON3112942111e-18
KNAG0D013807.467ON3283152111e-18
NDAI0A078503.348ON3162832092e-18
KAFR0H025908.644ON3042952083e-18
KAFR0L008007.228ON3092852093e-18
Suva_16.345singletonON4202682113e-18
ZYRO0A07348g2.344ON3632522094e-18
TBLA0B10130singletonON3042882066e-18
KAFR0B048502.344ON3602912076e-18
ADL009W7.133ON3792882061e-17
YMR166C2.344ON3682422051e-17
Smik_16.2628.129ON9022782081e-17
NDAI0D005107.467ON3483122042e-17
NCAS0B013608.644ON3063052032e-17
TDEL0F031703.435ON3002932022e-17
CAGL0F07711g2.344ON3682332042e-17
ADL049W8.129ON9122762072e-17
Skud_16.3443.348ON3062912022e-17
SAKL0F05038g7.133ON3882972043e-17
KNAG0I008002.344ON3703002033e-17
CAGL0J02002g7.133ON3612892033e-17
NCAS0I011503.348ON3242792013e-17
KLLA0E02839g5.461ON2842802003e-17
TDEL0C049003.348ON3052792013e-17
KLTH0G05808g7.467ON3413162023e-17
YOR222W (ODC2)8.644ON3072932013e-17
KLLA0F04697g2.227ON3072952013e-17
KAFR0G018408.644ON3083092003e-17
TDEL0F010408.129ON8082652054e-17
TBLA0G026402.227ON3203092005e-17
CAGL0K12210g3.348ON3112851995e-17
ZYRO0A13156g8.552ON3863172015e-17
Kpol_1013.837.467ON3403101997e-17
Skud_15.3888.644ON3072931987e-17
Smik_6.3338.644ON3092971987e-17
TPHA0A036603.348ON3112781988e-17
KNAG0J015408.644ON3151671971e-16
Kwal_47.182167.467ON3333111971e-16
KLTH0F12804g7.133ON3803081981e-16
Skud_16.1468.644ON3092971961e-16
Smik_15.4078.644ON3072901961e-16
Kpol_312.27.133ON3933051981e-16
Suva_13.3462.344ON3672541981e-16
Suva_16.1768.644ON3092971961e-16
NDAI0B010607.133ON3942931972e-16
TBLA0B040208.644ON2982941952e-16
ZYRO0D09218g7.133ON3522881962e-16
KLTH0G09020g2.227ON3092981952e-16
Ecym_70458.552ON3683131953e-16
KAFR0D027503.348ON2952751933e-16
CAGL0M09020g7.467ON3483161943e-16
KLTH0E06996g8.129ON8822351965e-16
CAGL0D01606g3.348ON3052761916e-16
TBLA0D041607.228ON2992841916e-16
Kpol_1070.147.228ON3052851916e-16
Suva_8.2748.644ON3072901908e-16
TDEL0H029607.133ON3542931911e-15
Ecym_83868.129ON9112651931e-15
TBLA0B089702.451ON3332901901e-15
Smik_16.3003.348ON3072901891e-15
TPHA0M015503.348ON3062751881e-15
Kwal_23.35292.344ON3952611901e-15
Kwal_33.12988na 1ON3032821882e-15
KLLA0F03212g7.467ON3053041882e-15
Kpol_1039.82.227ON3163021882e-15
TDEL0G027402.344ON3612261892e-15
SAKL0E06248g2.344ON3572131892e-15
Skud_16.2978.115ON3262891882e-15
KAFR0B020408.129ON8972781912e-15
Kpol_1065.263.348ON3042781863e-15
Skud_13.3312.344ON3672131874e-15
TBLA0I007407.467ON3393221864e-15
CAGL0K02365g8.129ON9192781894e-15
TPHA0E015705.461ON3022831854e-15
Kwal_23.43545.53ON3431971865e-15
NCAS0E031207.228ON3052881846e-15
KLTH0E15224g3.348ON3032811846e-15
NDAI0A052403.348ON3012761846e-15
YPR058W (YMC1)3.348ON3072881846e-15
Smik_5.1807.228ON3002791837e-15
KNAG0B015603.348ON3112761837e-15
Skud_9.332.227ON3133031837e-15
NDAI0E043707.228ON3062901837e-15
Suva_9.552.227ON3133051838e-15
Smik_9.352.227ON3143001839e-15
SAKL0A00132gsingletonON3112651821e-14
NDAI0C014705.461ON3222711821e-14
NDAI0H032202.344ON2961761811e-14
Smik_13.2352.621ON3091921811e-14
Kwal_55.208687.133ON3803061831e-14
Kwal_47.173218.129ON8812351851e-14
Kwal_23.47312.227ON3142991811e-14
Kpol_1006.118.129ON9272341842e-14
Skud_5.1657.228ON2992831802e-14
YPL134C (ODC1)8.644ON3103071802e-14
KAFR0J017402.227ON2902811792e-14
Smik_13.3712.344ON3672251812e-14
TDEL0B055008.115ON2992991793e-14
YER053C (PIC2)7.228ON3002801793e-14
Kpol_376.103.348ON3042901793e-14
ZYRO0B00396gsingletonON3032761783e-14
TPHA0L007007.133ON4073091803e-14
TBLA0G027608.129ON9053201823e-14
KAFR0H010003.348ON3022921783e-14
Skud_4.1362.313ON3073171783e-14
CAGL0G08910g2.227ON2892851774e-14
TPHA0C020108.445ON3022801784e-14
NDAI0E014008.644ON3251591775e-14
NDAI0G046602.621ON3101821775e-14
TBLA0B024403.348ON3062661775e-14
TDEL0H021607.228ON3042881775e-14
KLTH0F00330gna 1ON3032731766e-14
TPHA0B013507.467ON3623541786e-14
Smik_9.1937.133ON3732891786e-14
YMR056C (AAC1)2.621ON3091921766e-14
NCAS0A082102.621ON3081931766e-14
Kwal_23.39653.435ON3072941766e-14
Skud_13.2122.621ON3091981767e-14
KLLA0D14036g7.133ON4313111787e-14
KNAG0L013907.228ON3082861767e-14
NCAS0C04400singletonON3163021768e-14
YIL006W (YIA6)7.133ON3732931778e-14
YGR096W (TPC1)3.435ON3143011759e-14
Suva_5.1587.228ON3002791759e-14
NDAI0A044205.461ON2902711749e-14
TPHA0G034602.525ON2982801741e-13
KLTH0B08712g5.53ON3441971751e-13
KAFR0B019808.115ON3232931741e-13
KLLA0D15015g3.435ON3172981742e-13
Smik_2.2443.348ON3293131742e-13
TPHA0D039803.435ON3302001732e-13
TBLA0B072502.344ON3213191732e-13
NDAI0A076703.316ON3041941722e-13
Kpol_1067.45.53ON3471931732e-13
NDAI0B024208.129ON9002021752e-13
Kwal_23.57577.228ON3072801723e-13
KNAG0D022308.129ON8951811753e-13
YPR011C8.115ON3262921713e-13
YBR104W (YMC2)3.348ON3293061713e-13
KAFR0C002103.316ON3071941704e-13
Kwal_27.114192.313ON2982951704e-13
YBL030C (PET9)3.316ON3181941704e-13
Kpol_1019.42.621ON3121981705e-13
KNAG0A078303.463ON3242861705e-13
NCAS0I013303.316ON3371941705e-13
TPHA0C011807.228ON3092891696e-13
Suva_2.893.316ON3181941696e-13
KLTH0F15400g5.461ON2782691677e-13
Smik_4.428.445ON3002801688e-13
KLLA0B08503g3.348ON3032781688e-13
KNAG0A024708.445ON3002791688e-13
Suva_13.2292.621ON3171981689e-13
KLLA0E13443g8.129ON9062741709e-13
NCAS0H021705.461ON3052931671e-12
Kpol_1043.202.344ON3692311681e-12
NCAS0B046208.129ON8852781701e-12
KNAG0H007503.348ON3082831671e-12
SAKL0B07524g3.348ON3052781671e-12
KAFR0B051702.621ON3051931671e-12
TBLA0A010007.133ON3752971681e-12
Smik_2.853.316ON3181941671e-12
Kwal_27.125993.348ON3042811671e-12
TBLA0A066303.348ON3153021671e-12
Skud_2.733.316ON3181941671e-12
KNAG0J023903.316ON3041941671e-12
TDEL0B029408.552ON3693021681e-12
Suva_4.508.445ON3002801661e-12
Kwal_47.192283.556ON2811301661e-12
KLTH0G00968g3.556ON3451301671e-12
KLTH0H00220gsingletonON3032781661e-12
Skud_2.2303.348ON3293061671e-12
Skud_2.4222.525ON2992971661e-12
ZYRO0D16698g7.228ON3052871661e-12
YIL134W (FLX1)2.227ON3112961661e-12
TBLA0H005508.445ON3012791661e-12
KLTH0F09790g2.344ON3572801671e-12
NCAS0D009102.344ON3732791671e-12
SAKL0G03146g5.461ON2782701651e-12
TDEL0G04780singletonON3062761661e-12
ZYRO0A02530g2.313ON2972691661e-12
AER184W3.316ON3051801661e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C06990
         (296 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C05800 Chr3 complement(1047254..1048144) [891 bp, 296 aa] {...   616   0.0  
TDEL0C06990 Chr3 complement(1271111..1272001) [891 bp, 296 aa] {...   616   0.0  
ZYRO0C18304g Chr3 complement(1433725..1434615) [891 bp, 296 aa] ...   430   e-153
SAKL0C03718g Chr3 (350498..351364) [867 bp, 288 aa] {ON} similar...   423   e-150
Kpol_2000.25 s2000 complement(47543..48412) [870 bp, 289 aa] {ON...   420   e-149
NDAI0A03380 Chr1 complement(770468..771361) [894 bp, 297 aa] {ON...   413   e-146
Suva_10.449 Chr10 complement(786544..787446) [903 bp, 300 aa] {O...   414   e-146
YLR348C Chr12 complement(826977..827873) [897 bp, 298 aa] {ON}  ...   408   e-144
NCAS0A03540 Chr1 complement(701962..702870) [909 bp, 302 aa] {ON...   408   e-144
Smik_12.437 Chr12 complement(765885..766781) [897 bp, 298 aa] {O...   408   e-144
Skud_12.434 Chr12 complement(767307..768203) [897 bp, 298 aa] {O...   403   e-142
KNAG0B05730 Chr2 complement(1124709..1125599) [891 bp, 296 aa] {...   399   e-140
TPHA0B04130 Chr2 complement(975513..976463) [951 bp, 316 aa] {ON...   384   e-134
TBLA0A05800 Chr1 (1434309..1435223) [915 bp, 304 aa] {ON} Anc_1....   377   e-131
CAGL0G01166g Chr7 complement(111298..112185) [888 bp, 295 aa] {O...   375   e-131
KAFR0A06340 Chr1 (1278830..1279726) [897 bp, 298 aa] {ON} Anc_1....   361   e-125
KLLA0B12826g Chr2 (1121106..1122065) [960 bp, 319 aa] {ON} simil...   118   2e-30
KAFR0D03070 Chr4 (606943..607908) [966 bp, 321 aa] {ON} Anc_2.45...   118   2e-30
Suva_11.104 Chr11 (203826..204800) [975 bp, 324 aa] {ON} YKL120W...   110   1e-27
Smik_11.118 Chr11 (202992..203966) [975 bp, 324 aa] {ON} YKL120W...   109   3e-27
YKL120W Chr11 (217344..218318) [975 bp, 324 aa] {ON}  OAC1Mitoch...   109   4e-27
Skud_11.109 Chr11 (204082..205056) [975 bp, 324 aa] {ON} YKL120W...   108   5e-27
NDAI0K01460 Chr11 (332950..333921) [972 bp, 323 aa] {ON} Anc_2.451    108   6e-27
Kwal_26.7653 s26 complement(459583..460560) [978 bp, 325 aa] {ON...   108   9e-27
SAKL0E03498g Chr5 complement(282321..283295) [975 bp, 324 aa] {O...   107   2e-26
NCAS0A04410 Chr1 (891313..892284) [972 bp, 323 aa] {ON} Anc_2.451     106   5e-26
Kpol_1018.165 s1018 (425354..426322) [969 bp, 322 aa] {ON} (4253...   104   2e-25
Kpol_1072.34 s1072 complement(76799..77704) [906 bp, 301 aa] {ON...   103   3e-25
TDEL0A02270 Chr1 (412289..413257) [969 bp, 322 aa] {ON} Anc_2.45...   103   5e-25
CAGL0K11616g Chr11 complement(1122663..1123625) [963 bp, 320 aa]...   103   6e-25
TPHA0G02510 Chr7 (519304..520269) [966 bp, 321 aa] {ON} Anc_2.45...   102   2e-24
KLTH0D04928g Chr4 complement(447820..448797) [978 bp, 325 aa] {O...   100   8e-24
ZYRO0G02640g Chr7 (205008..205985) [978 bp, 325 aa] {ON} similar...    99   2e-23
KNAG0A06360 Chr1 (970774..971742) [969 bp, 322 aa] {ON} Anc_2.45...    99   3e-23
KLLA0D07073g Chr4 (606857..607750) [894 bp, 297 aa] {ON} similar...    96   3e-22
Ecym_4494 Chr4 complement(994947..996131) [1185 bp, 394 aa] {ON}...    97   4e-22
SAKL0H07326g Chr8 complement(639197..640090) [894 bp, 297 aa] {O...    95   4e-22
ZYRO0G17578g Chr7 (1454173..1455123) [951 bp, 316 aa] {ON} highl...    95   5e-22
SAKL0F14234g Chr6 (1140131..1141090) [960 bp, 319 aa] {ON} highl...    94   2e-21
YEL006W Chr5 (144327..145334) [1008 bp, 335 aa] {ON}  YEA6Putati...    94   3e-21
Ecym_5393 Chr5 (798418..799308) [891 bp, 296 aa] {ON} similar to...    92   4e-21
Smik_5.107 Chr5 (148354..149370) [1017 bp, 338 aa] {ON} YEL006W ...    93   4e-21
Skud_5.94 Chr5 (140978..141991) [1014 bp, 337 aa] {ON} YEL006W (...    93   6e-21
YJR095W Chr10 (609773..610741) [969 bp, 322 aa] {ON}  SFC1Mitoch...    92   6e-21
KLTH0D10472g Chr4 (863427..864317) [891 bp, 296 aa] {ON} similar...    92   7e-21
Suva_5.80 Chr5 (119996..121009) [1014 bp, 337 aa] {ON} YEL006W (...    92   9e-21
Kwal_26.8669 s26 (890718..891608) [891 bp, 296 aa] {ON} YPL134C ...    91   1e-20
TPHA0G01770 Chr7 complement(366539..367465) [927 bp, 308 aa] {ON...    91   1e-20
Smik_10.383 Chr10 (598671..599639) [969 bp, 322 aa] {ON} YJR095W...    91   2e-20
Ecym_8329 Chr8 (666580..667476) [897 bp, 298 aa] {ON} similar to...    91   2e-20
TDEL0C03310 Chr3 (589960..590919) [960 bp, 319 aa] {ON} Anc_7.46...    91   2e-20
SAKL0E09086g Chr5 complement(754996..755928) [933 bp, 310 aa] {O...    91   2e-20
TDEL0A05900 Chr1 (1037786..1038691) [906 bp, 301 aa] {ON} Anc_8....    91   3e-20
Skud_10.317 Chr10 (567135..568103) [969 bp, 322 aa] {ON} YJR095W...    90   4e-20
ACR109W Chr3 (546745..547644) [900 bp, 299 aa] {ON} Syntenic hom...    90   4e-20
Ecym_2469 Chr2 complement(914652..915629) [978 bp, 325 aa] {ON} ...    90   5e-20
Suva_12.183 Chr12 (288186..289154) [969 bp, 322 aa] {ON} YJR095W...    89   1e-19
AGL311C Chr7 complement(119645..120733) [1089 bp, 362 aa] {ON} S...    89   2e-19
NCAS0A11060 Chr1 (2201278..2202198) [921 bp, 306 aa] {ON} Anc_3....    88   2e-19
Suva_16.386 Chr16 (680514..681437) [924 bp, 307 aa] {ON} YPR058W...    88   3e-19
YPR021C Chr16 complement(600649..603357) [2709 bp, 902 aa] {ON} ...    90   3e-19
Ecym_7158 Chr7 (330513..331484) [972 bp, 323 aa] {ON} similar to...    87   5e-19
NCAS0H00570 Chr8 complement(96997..98001) [1005 bp, 334 aa] {ON}...    87   5e-19
KAFR0G00930 Chr7 complement(216603..217556) [954 bp, 317 aa] {ON...    87   6e-19
ZYRO0F06600g Chr6 (544959..545852) [894 bp, 297 aa] {ON} similar...    87   6e-19
NCAS0A13150 Chr1 complement(2585310..2586407) [1098 bp, 365 aa] ...    87   8e-19
Skud_16.306 Chr16 complement(564985..567687) [2703 bp, 900 aa] {...    88   9e-19
KAFR0K01110 Chr11 (231847..232863) [1017 bp, 338 aa] {ON} Anc_7....    86   1e-18
KNAG0E03550 Chr5 (710651..711781) [1131 bp, 376 aa] {ON} Anc_7.1...    87   1e-18
TDEL0C04440 Chr3 (792021..792956) [936 bp, 311 aa] {ON} Anc_2.22...    86   1e-18
KNAG0D01380 Chr4 complement(231548..232534) [987 bp, 328 aa] {ON...    86   1e-18
NDAI0A07850 Chr1 (1805583..1806533) [951 bp, 316 aa] {ON}              85   2e-18
KAFR0H02590 Chr8 complement(495267..496181) [915 bp, 304 aa] {ON...    85   3e-18
KAFR0L00800 Chr12 complement(149629..150558) [930 bp, 309 aa] {O...    85   3e-18
Suva_16.345 Chr16 complement(605267..606529) [1263 bp, 420 aa] {...    86   3e-18
ZYRO0A07348g Chr1 (599958..601049) [1092 bp, 363 aa] {ON} simila...    85   4e-18
TBLA0B10130 Chr2 (2438249..2439163) [915 bp, 304 aa] {ON}              84   6e-18
KAFR0B04850 Chr2 (1008173..1009255) [1083 bp, 360 aa] {ON} Anc_2...    84   6e-18
ADL009W Chr4 (693076..694215) [1140 bp, 379 aa] {ON} Syntenic ho...    84   1e-17
YMR166C Chr13 complement(593367..594473) [1107 bp, 368 aa] {ON} ...    84   1e-17
Smik_16.262 Chr16 complement(476377..479085) [2709 bp, 902 aa] {...    85   1e-17
NDAI0D00510 Chr4 complement(105042..106088) [1047 bp, 348 aa] {O...    83   2e-17
NCAS0B01360 Chr2 (223374..224294) [921 bp, 306 aa] {ON} Anc_8.644      83   2e-17
TDEL0F03170 Chr6 (581231..582133) [903 bp, 300 aa] {ON} Anc_3.43...    82   2e-17
CAGL0F07711g Chr6 complement(751794..752900) [1107 bp, 368 aa] {...    83   2e-17
ADL049W Chr4 (598132..600870) [2739 bp, 912 aa] {ON} Syntenic ho...    84   2e-17
Skud_16.344 Chr16 (638589..639509) [921 bp, 306 aa] {ON} YPR058W...    82   2e-17
SAKL0F05038g Chr6 complement(400575..401741) [1167 bp, 388 aa] {...    83   3e-17
KNAG0I00800 Chr9 (143143..144255) [1113 bp, 370 aa] {ON} Anc_2.3...    83   3e-17
CAGL0J02002g Chr10 (200829..201914) [1086 bp, 361 aa] {ON} simil...    83   3e-17
NCAS0I01150 Chr9 complement(208557..209531) [975 bp, 324 aa] {ON...    82   3e-17
KLLA0E02839g Chr5 complement(261895..262749) [855 bp, 284 aa] {O...    82   3e-17
TDEL0C04900 Chr3 (885588..886505) [918 bp, 305 aa] {ON} Anc_3.34...    82   3e-17
KLTH0G05808g Chr7 complement(461330..462355) [1026 bp, 341 aa] {...    82   3e-17
YOR222W Chr15 (758330..759253) [924 bp, 307 aa] {ON}  ODC2Mitoch...    82   3e-17
KLLA0F04697g Chr6 complement(461126..462049) [924 bp, 307 aa] {O...    82   3e-17
KAFR0G01840 Chr7 (392115..393041) [927 bp, 308 aa] {ON} Anc_8.64...    82   3e-17
TDEL0F01040 Chr6 (185941..188367) [2427 bp, 808 aa] {ON} Anc_8.1...    84   4e-17
TBLA0G02640 Chr7 complement(699692..700654) [963 bp, 320 aa] {ON...    82   5e-17
CAGL0K12210g Chr11 (1194600..1195535) [936 bp, 311 aa] {ON} simi...    81   5e-17
ZYRO0A13156g Chr1 complement(1036035..1037195) [1161 bp, 386 aa]...    82   5e-17
Kpol_1013.83 s1013 complement(201961..202983) [1023 bp, 340 aa] ...    81   7e-17
Skud_15.388 Chr15 (697346..698269) [924 bp, 307 aa] {ON} YOR222W...    81   7e-17
Smik_6.333 Chr6 (524689..525618) [930 bp, 309 aa] {ON} YPL134C (...    81   7e-17
TPHA0A03660 Chr1 complement(801293..802228) [936 bp, 311 aa] {ON...    81   8e-17
KNAG0J01540 Chr10 (282285..283232) [948 bp, 315 aa] {ON} Anc_8.6...    80   1e-16
Kwal_47.18216 s47 (736491..737492) [1002 bp, 333 aa] {ON} YJR095...    80   1e-16
KLTH0F12804g Chr6 (1063271..1064413) [1143 bp, 380 aa] {ON} simi...    81   1e-16
Skud_16.146 Chr16 complement(270247..271176) [930 bp, 309 aa] {O...    80   1e-16
Smik_15.407 Chr15 (707967..708890) [924 bp, 307 aa] {ON} YOR222W...    80   1e-16
Kpol_312.2 s312 (5727..6908) [1182 bp, 393 aa] {ON} (5727..6908)...    81   1e-16
Suva_13.346 Chr13 complement(573436..574539) [1104 bp, 367 aa] {...    81   1e-16
Suva_16.176 Chr16 complement(308048..308977) [930 bp, 309 aa] {O...    80   1e-16
NDAI0B01060 Chr2 (250970..252154) [1185 bp, 394 aa] {ON} Anc_7.133     80   2e-16
TBLA0B04020 Chr2 complement(920523..921419) [897 bp, 298 aa] {ON...    80   2e-16
ZYRO0D09218g Chr4 (792744..793802) [1059 bp, 352 aa] {ON} simila...    80   2e-16
KLTH0G09020g Chr7 (736937..737866) [930 bp, 309 aa] {ON} similar...    80   2e-16
Ecym_7045 Chr7 complement(90632..91738) [1107 bp, 368 aa] {ON} s...    80   3e-16
KAFR0D02750 Chr4 complement(543629..544516) [888 bp, 295 aa] {ON...    79   3e-16
CAGL0M09020g Chr13 complement(896312..897358) [1047 bp, 348 aa] ...    79   3e-16
KLTH0E06996g Chr5 (644098..646746) [2649 bp, 882 aa] {ON} simila...    80   5e-16
CAGL0D01606g Chr4 complement(169066..169983) [918 bp, 305 aa] {O...    78   6e-16
TBLA0D04160 Chr4 (1031885..1032784) [900 bp, 299 aa] {ON} Anc_7....    78   6e-16
Kpol_1070.14 s1070 (37139..38056) [918 bp, 305 aa] {ON} (37139.....    78   6e-16
Suva_8.274 Chr8 (497296..498219) [924 bp, 307 aa] {ON} YOR222W (...    78   8e-16
TDEL0H02960 Chr8 (492274..493338) [1065 bp, 354 aa] {ON} Anc_7.1...    78   1e-15
Ecym_8386 Chr8 complement(786255..788990) [2736 bp, 911 aa] {ON}...    79   1e-15
TBLA0B08970 Chr2 complement(2124130..2125131) [1002 bp, 333 aa] ...    78   1e-15
Smik_16.300 Chr16 (550436..551359) [924 bp, 307 aa] {ON} YPR058W...    77   1e-15
TPHA0M01550 Chr13 (328262..329182) [921 bp, 306 aa] {ON} Anc_3.3...    77   1e-15
Kwal_23.3529 s23 (331232..332419) [1188 bp, 395 aa] {ON} YMR166C...    78   1e-15
Kwal_33.12988 s33 complement(28012..28923) [912 bp, 303 aa] {ON}...    77   2e-15
KLLA0F03212g Chr6 (302915..303832) [918 bp, 305 aa] {ON} similar...    77   2e-15
Kpol_1039.8 s1039 (20067..21017) [951 bp, 316 aa] {ON} (20067..2...    77   2e-15
TDEL0G02740 Chr7 (523615..524700) [1086 bp, 361 aa] {ON} Anc_2.3...    77   2e-15
SAKL0E06248g Chr5 complement(508609..509682) [1074 bp, 357 aa] {...    77   2e-15
Skud_16.297 Chr16 complement(547342..548322) [981 bp, 326 aa] {O...    77   2e-15
KAFR0B02040 Chr2 complement(399235..401928) [2694 bp, 897 aa] {O...    78   2e-15
Kpol_1065.26 s1065 complement(58774..59688) [915 bp, 304 aa] {ON...    76   3e-15
Skud_13.331 Chr13 complement(567690..568793) [1104 bp, 367 aa] {...    77   4e-15
TBLA0I00740 Chr9 complement(136063..137082) [1020 bp, 339 aa] {O...    76   4e-15
CAGL0K02365g Chr11 (213531..216290) [2760 bp, 919 aa] {ON} highl...    77   4e-15
TPHA0E01570 Chr5 (320205..321113) [909 bp, 302 aa] {ON} Anc_5.46...    76   4e-15
Kwal_23.4354 s23 (680149..681180) [1032 bp, 343 aa] {ON} YGR257C...    76   5e-15
NCAS0E03120 Chr5 complement(619240..620157) [918 bp, 305 aa] {ON...    75   6e-15
KLTH0E15224g Chr5 (1351301..1352212) [912 bp, 303 aa] {ON} highl...    75   6e-15
NDAI0A05240 Chr1 complement(1183362..1184267) [906 bp, 301 aa] {...    75   6e-15
YPR058W Chr16 (673751..674674) [924 bp, 307 aa] {ON}  YMC1Mitoch...    75   6e-15
Smik_5.180 Chr5 complement(262789..263691) [903 bp, 300 aa] {ON}...    75   7e-15
KNAG0B01560 Chr2 complement(288626..289561) [936 bp, 311 aa] {ON}      75   7e-15
Skud_9.33 Chr9 (74594..75535) [942 bp, 313 aa] {ON} YIL134W (REAL)     75   7e-15
NDAI0E04370 Chr5 (987903..988823) [921 bp, 306 aa] {ON} Anc_7.228      75   7e-15
Suva_9.55 Chr9 (92154..93095) [942 bp, 313 aa] {ON} YIL134W (REAL)     75   8e-15
Smik_9.35 Chr9 (75129..76073) [945 bp, 314 aa] {ON} YIL134W (REAL)     75   9e-15
SAKL0A00132g Chr1 complement(9038..9973) [936 bp, 311 aa] {ON} h...    75   1e-14
NDAI0C01470 Chr3 (309948..310916) [969 bp, 322 aa] {ON} Anc_5.461      75   1e-14
NDAI0H03220 Chr8 complement(770078..770968) [891 bp, 296 aa] {ON...    74   1e-14
Smik_13.235 Chr13 complement(371369..372298) [930 bp, 309 aa] {O...    74   1e-14
Kwal_55.20868 s55 (589891..591033) [1143 bp, 380 aa] {ON} YIL006...    75   1e-14
Kwal_47.17321 s47 (351236..353881) [2646 bp, 881 aa] {ON} YPR021...    76   1e-14
Kwal_23.4731 s23 (836781..837725) [945 bp, 314 aa] {ON} YIL134W ...    74   1e-14
Kpol_1006.11 s1006 complement(44933..47716) [2784 bp, 927 aa] {O...    75   2e-14
Skud_5.165 Chr5 complement(255149..256048) [900 bp, 299 aa] {ON}...    74   2e-14
YPL134C Chr16 complement(298571..299503) [933 bp, 310 aa] {ON}  ...    74   2e-14
KAFR0J01740 Chr10 complement(332870..333742) [873 bp, 290 aa] {O...    74   2e-14
Smik_13.371 Chr13 complement(577886..578989) [1104 bp, 367 aa] {...    74   2e-14
TDEL0B05500 Chr2 complement(977696..978595) [900 bp, 299 aa] {ON...    74   3e-14
YER053C Chr5 complement(258737..259639) [903 bp, 300 aa] {ON}  P...    74   3e-14
Kpol_376.10 s376 (16815..17729) [915 bp, 304 aa] {ON} (16815..17...    74   3e-14
ZYRO0B00396g Chr2 (24056..24967) [912 bp, 303 aa] {ON} similar t...    73   3e-14
TPHA0L00700 Chr12 (131597..132820) [1224 bp, 407 aa] {ON} Anc_7....    74   3e-14
TBLA0G02760 Chr7 complement(725291..728008) [2718 bp, 905 aa] {O...    75   3e-14
KAFR0H01000 Chr8 complement(182165..183073) [909 bp, 302 aa] {ON...    73   3e-14
Skud_4.136 Chr4 complement(242328..243251) [924 bp, 307 aa] {ON}...    73   3e-14
CAGL0G08910g Chr7 complement(853693..854562) [870 bp, 289 aa] {O...    73   4e-14
TPHA0C02010 Chr3 complement(451294..452202) [909 bp, 302 aa] {ON...    73   4e-14
NDAI0E01400 Chr5 complement(279960..280937) [978 bp, 325 aa] {ON...    73   5e-14
NDAI0G04660 Chr7 (1109224..1110156) [933 bp, 310 aa] {ON} Anc_2....    73   5e-14
TBLA0B02440 Chr2 complement(564793..565713) [921 bp, 306 aa] {ON...    73   5e-14
TDEL0H02160 Chr8 (367235..368149) [915 bp, 304 aa] {ON} Anc_7.22...    73   5e-14
KLTH0F00330g Chr6 complement(27980..28891) [912 bp, 303 aa] {ON}...    72   6e-14
TPHA0B01350 Chr2 complement(300788..301876) [1089 bp, 362 aa] {O...    73   6e-14
Smik_9.193 Chr9 (320132..321250) [1119 bp, 373 aa] {ON} YIL006W ...    73   6e-14
YMR056C Chr13 complement(387315..388244) [930 bp, 309 aa] {ON}  ...    72   6e-14
NCAS0A08210 Chr1 (1620689..1621615) [927 bp, 308 aa] {ON} Anc_2....    72   6e-14
Kwal_23.3965 s23 complement(504354..505277) [924 bp, 307 aa] {ON...    72   6e-14
Skud_13.212 Chr13 complement(361929..362858) [930 bp, 309 aa] {O...    72   7e-14
KLLA0D14036g Chr4 complement(1203522..1204817) [1296 bp, 431 aa]...    73   7e-14
KNAG0L01390 Chr12 complement(247217..248143) [927 bp, 308 aa] {O...    72   7e-14
NCAS0C04400 Chr3 complement(902138..903088) [951 bp, 316 aa] {ON}      72   8e-14
YIL006W Chr9 (344062..345183) [1122 bp, 373 aa] {ON}  YIA6Mitoch...    73   8e-14
YGR096W Chr7 (676621..677565) [945 bp, 314 aa] {ON}  TPC1Mitocho...    72   9e-14
Suva_5.158 Chr5 complement(234718..235620) [903 bp, 300 aa] {ON}...    72   9e-14
NDAI0A04420 Chr1 (1002320..1003192) [873 bp, 290 aa] {ON}              72   9e-14
TPHA0G03460 Chr7 complement(738514..739410) [897 bp, 298 aa] {ON...    72   1e-13
KLTH0B08712g Chr2 complement(706712..707746) [1035 bp, 344 aa] {...    72   1e-13
KAFR0B01980 Chr2 complement(383570..384541) [972 bp, 323 aa] {ON...    72   1e-13
KLLA0D15015g Chr4 (1267803..1268756) [954 bp, 317 aa] {ON} simil...    72   2e-13
Smik_2.244 Chr2 (434608..435597) [990 bp, 329 aa] {ON} YBR104W (...    72   2e-13
TPHA0D03980 Chr4 (836589..837581) [993 bp, 330 aa] {ON} Anc_3.43...    71   2e-13
TBLA0B07250 Chr2 (1718541..1719506) [966 bp, 321 aa] {ON} Anc_2....    71   2e-13
NDAI0A07670 Chr1 (1765057..1765971) [915 bp, 304 aa] {ON}              71   2e-13
Kpol_1067.4 s1067 complement(7468..8511) [1044 bp, 347 aa] {ON} ...    71   2e-13
NDAI0B02420 Chr2 complement(604848..607550) [2703 bp, 900 aa] {O...    72   2e-13
Kwal_23.5757 s23 complement(1307213..1308136) [924 bp, 307 aa] {...    71   3e-13
KNAG0D02230 Chr4 (382941..385628) [2688 bp, 895 aa] {ON} Anc_8.1...    72   3e-13
YPR011C Chr16 complement(583062..584042) [981 bp, 326 aa] {ON} P...    70   3e-13
YBR104W Chr2 (449667..450656) [990 bp, 329 aa] {ON}  YMC2Mitocho...    70   3e-13
KAFR0C00210 Chr3 complement(34033..34956) [924 bp, 307 aa] {ON} ...    70   4e-13
Kwal_27.11419 s27 (794064..794960) [897 bp, 298 aa] {ON} YDL119C...    70   4e-13
YBL030C Chr2 complement(163041..163997) [957 bp, 318 aa] {ON}  P...    70   4e-13
Kpol_1019.4 s1019 complement(8405..9343) [939 bp, 312 aa] {ON} c...    70   5e-13
KNAG0A07830 Chr1 (1244679..1245653) [975 bp, 324 aa] {ON} Anc_3....    70   5e-13
NCAS0I01330 Chr9 complement(239364..240377) [1014 bp, 337 aa] {O...    70   5e-13
TPHA0C01180 Chr3 (272119..273048) [930 bp, 309 aa] {ON} Anc_7.22...    70   6e-13
Suva_2.89 Chr2 complement(163097..164053) [957 bp, 318 aa] {ON} ...    70   6e-13
KLTH0F15400g Chr6 (1257203..1258039) [837 bp, 278 aa] {ON} simil...    69   7e-13
Smik_4.42 Chr4 complement(81864..82766) [903 bp, 300 aa] {ON} YD...    69   8e-13
KLLA0B08503g Chr2 complement(753498..754409) [912 bp, 303 aa] {O...    69   8e-13
KNAG0A02470 Chr1 complement(246025..246927) [903 bp, 300 aa] {ON...    69   8e-13
Suva_13.229 Chr13 complement(368562..369515) [954 bp, 317 aa] {O...    69   9e-13
KLLA0E13443g Chr5 complement(1184806..1187526) [2721 bp, 906 aa]...    70   9e-13
NCAS0H02170 Chr8 complement(423631..424548) [918 bp, 305 aa] {ON}      69   1e-12
Kpol_1043.20 s1043 complement(39128..40237) [1110 bp, 369 aa] {O...    69   1e-12
NCAS0B04620 Chr2 (842926..845583) [2658 bp, 885 aa] {ON}               70   1e-12
KNAG0H00750 Chr8 complement(118017..118943) [927 bp, 308 aa] {ON...    69   1e-12
SAKL0B07524g Chr2 (647326..648243) [918 bp, 305 aa] {ON} highly ...    69   1e-12
KAFR0B05170 Chr2 (1062776..1063693) [918 bp, 305 aa] {ON} Anc_2....    69   1e-12
TBLA0A01000 Chr1 (227434..228561) [1128 bp, 375 aa] {ON} Anc_7.1...    69   1e-12
Smik_2.85 Chr2 complement(156794..157747) [954 bp, 318 aa] {ON} ...    69   1e-12
Kwal_27.12599 s27 (1294737..1295651) [915 bp, 304 aa] {ON} YPR05...    69   1e-12
TBLA0A06630 Chr1 complement(1618156..1619103) [948 bp, 315 aa] {...    69   1e-12
Skud_2.73 Chr2 complement(146857..147813) [957 bp, 318 aa] {ON} ...    69   1e-12
KNAG0J02390 Chr10 (452558..453472) [915 bp, 304 aa] {ON} Anc_3.3...    69   1e-12
TDEL0B02940 Chr2 (526265..527374) [1110 bp, 369 aa] {ON} Anc_8.5...    69   1e-12
Suva_4.50 Chr4 complement(92059..92961) [903 bp, 300 aa] {ON} YD...    69   1e-12
Kwal_47.19228 s47 (1142985..1143830) [846 bp, 281 aa] {ON} YFR04...    69   1e-12
KLTH0G00968g Chr7 complement(70012..71049) [1038 bp, 345 aa] {ON...    69   1e-12
KLTH0H00220g Chr8 complement(18972..19883) [912 bp, 303 aa] {ON}...    69   1e-12
Skud_2.230 Chr2 (417863..418852) [990 bp, 329 aa] {ON} YBR104W (...    69   1e-12
Skud_2.422 Chr2 complement(752512..753411) [900 bp, 299 aa] {ON}...    69   1e-12
ZYRO0D16698g Chr4 complement(1382235..1383152) [918 bp, 305 aa] ...    69   1e-12
YIL134W Chr9 (97395..98330) [936 bp, 311 aa] {ON}  FLX1Protein r...    69   1e-12
TBLA0H00550 Chr8 complement(105982..106887) [906 bp, 301 aa] {ON...    69   1e-12
KLTH0F09790g Chr6 (847760..848833) [1074 bp, 357 aa] {ON} simila...    69   1e-12
NCAS0D00910 Chr4 (171719..172840) [1122 bp, 373 aa] {ON} Anc_2.344     69   1e-12
SAKL0G03146g Chr7 complement(260142..260978) [837 bp, 278 aa] {O...    68   1e-12
TDEL0G04780 Chr7 (873633..874553) [921 bp, 306 aa] {ON}                69   1e-12
ZYRO0A02530g Chr1 complement(199620..200513) [894 bp, 297 aa] {O...    69   1e-12
AER184W Chr5 (978781..979698) [918 bp, 305 aa] {ON} Syntenic hom...    69   1e-12
TDEL0E04810 Chr5 (899869..900777) [909 bp, 302 aa] {ON} Anc_5.149      68   2e-12
NDAI0A05420 Chr1 complement(1225552..1226499) [948 bp, 315 aa] {...    68   2e-12
SAKL0F08360g Chr6 complement(636693..637601) [909 bp, 302 aa] {O...    68   2e-12
Suva_4.350 Chr4 (618797..619786) [990 bp, 329 aa] {ON} YBR104W (...    68   2e-12
Suva_8.56 Chr8 (105293..106366) [1074 bp, 357 aa] {ON} YHR002W (...    69   2e-12
Suva_4.128 Chr4 complement(235146..236069) [924 bp, 307 aa] {ON}...    68   2e-12
YOR130C Chr15 complement(569929..570807) [879 bp, 292 aa] {ON}  ...    68   2e-12
CAGL0F04213g Chr6 (419473..420393) [921 bp, 306 aa] {ON} highly ...    68   2e-12
KNAG0K00310 Chr11 complement(50493..51362) [870 bp, 289 aa] {ON}       68   2e-12
KNAG0E01720 Chr5 (345595..346461) [867 bp, 288 aa] {ON} Anc_2.22...    68   2e-12
SAKL0H24442g Chr8 complement(2114736..2117444) [2709 bp, 902 aa]...    69   2e-12
TBLA0G03560 Chr7 (950502..951404) [903 bp, 300 aa] {ON} Anc_3.31...    68   3e-12
Kwal_27.12481 s27 (1234499..1235413) [915 bp, 304 aa] {ON} YBL03...    68   3e-12
Suva_9.201 Chr9 (330834..331994) [1161 bp, 386 aa] {ON} YIL006W ...    68   3e-12
Skud_8.47 Chr8 (90656..91729) [1074 bp, 357 aa] {ON} YHR002W (REAL)    68   3e-12
ZYRO0E02420g Chr5 (184575..187247) [2673 bp, 890 aa] {ON} simila...    69   3e-12
KAFR0F01990 Chr6 (388321..389223) [903 bp, 300 aa] {ON} Anc_1.21...    67   3e-12
Skud_2.211 Chr2 (384150..385073) [924 bp, 307 aa] {ON} YBR085W (...    67   3e-12
AFL196W Chr6 (66955..68040) [1086 bp, 361 aa] {ON} Syntenic homo...    68   3e-12
KLTH0E14476g Chr5 (1287603..1288517) [915 bp, 304 aa] {ON} highl...    67   4e-12
YDL198C Chr4 complement(103649..104551) [903 bp, 300 aa] {ON}  G...    67   4e-12
SAKL0F01078g Chr6 complement(95066..96055,96133..96168) [1026 bp...    67   4e-12
CAGL0L02079g Chr12 (245464..246357) [894 bp, 297 aa] {ON} highly...    67   4e-12
TBLA0I00640 Chr9 complement(116455..117348) [894 bp, 297 aa] {ON...    67   4e-12
SAKL0B06754g Chr2 (582675..583589) [915 bp, 304 aa] {ON} uniprot...    67   4e-12
KLLA0D09889g Chr4 complement(834904..835998) [1095 bp, 364 aa] {...    67   4e-12
ZYRO0A01188g Chr1 (84781..85716) [936 bp, 311 aa] {ON} similar t...    67   5e-12
KAFR0K02590 Chr11 complement(531081..532004) [924 bp, 307 aa] {O...    67   5e-12
ZYRO0B02376g Chr2 complement(194075..194959) [885 bp, 294 aa] {O...    67   5e-12
NCAS0B06590 Chr2 complement(1249072..1249998) [927 bp, 308 aa] {...    67   5e-12
Skud_4.59 Chr4 complement(100926..101828) [903 bp, 300 aa] {ON} ...    67   6e-12
Kpol_292.4 s292 complement(8539..9447) [909 bp, 302 aa] {ON} com...    67   6e-12
NCAS0F03930 Chr6 (788737..788754,788839..789885) [1065 bp, 354 a...    67   7e-12
KLTH0H08844g Chr8 (764341..765294) [954 bp, 317 aa] {ON} similar...    67   8e-12
KLLA0E18723g Chr5 (1663220..1664353) [1134 bp, 377 aa] {ON} high...    67   8e-12
TPHA0N01250 Chr14 (271623..272660) [1038 bp, 345 aa] {ON} Anc_3....    67   8e-12
Kwal_55.21338 s55 complement(787531..788502) [972 bp, 323 aa] {O...    66   8e-12
Skud_7.395 Chr7 (660811..661767) [957 bp, 318 aa] {ON} YGR096W (...    66   9e-12
KLLA0E09703g Chr5 complement(860245..861168) [924 bp, 307 aa] {O...    66   9e-12
KNAG0D02300 Chr4 (400376..401368) [993 bp, 330 aa] {ON} Anc_8.11...    66   9e-12
KLLA0E02817g Chr5 (260854..261768) [915 bp, 304 aa] {ON} weakly ...    66   9e-12
CAGL0D04774g Chr4 complement(467712..468680) [969 bp, 322 aa] {O...    66   9e-12
Suva_4.330 Chr4 (584849..585772) [924 bp, 307 aa] {ON} YBR085W (...    66   1e-11
CAGL0H10538g Chr8 (1027739..1028632) [894 bp, 297 aa] {ON} highl...    66   1e-11
NCAS0B02140 Chr2 (351300..352424) [1125 bp, 374 aa] {ON}               67   1e-11
CAGL0K10362g Chr11 complement(1009984..1010889) [906 bp, 301 aa]...    66   1e-11
TDEL0F00210 Chr6 (32743..33663) [921 bp, 306 aa] {ON} Anc_1.536 ...    66   1e-11
YBR085W Chr2 (415983..416906) [924 bp, 307 aa] {ON}  AAC3Mitocho...    66   1e-11
TPHA0D00980 Chr4 complement(197456..200197) [2742 bp, 913 aa] {O...    67   1e-11
Kwal_14.2210 s14 (658778..659725) [948 bp, 315 aa] {ON} YPR011C ...    66   1e-11
KAFR0D05130 Chr4 complement(1009136..1010041) [906 bp, 301 aa] {...    66   1e-11
Suva_16.334 Chr16 complement(587102..588079) [978 bp, 326 aa] {O...    66   1e-11
SAKL0H20482g Chr8 (1797755..1798726) [972 bp, 323 aa] {ON} highl...    65   2e-11
KNAG0A03630 Chr1 (470203..471318) [1116 bp, 371 aa] {ON} Anc_8.5...    66   2e-11
Smik_10.367 Chr10 complement(566125..567060) [936 bp, 311 aa] {O...    65   2e-11
Smik_15.308 Chr15 complement(531786..532661) [876 bp, 291 aa] {O...    65   2e-11
AGL047C Chr7 complement(616853..617803) [951 bp, 316 aa] {ON} No...    65   2e-11
TDEL0A03000 Chr1 complement(538281..539174) [894 bp, 297 aa] {ON...    65   2e-11
TDEL0F03480 Chr6 complement(644332..645282) [951 bp, 316 aa] {ON...    65   2e-11
KLLA0F17864g Chr6 complement(1634241..1635164) [924 bp, 307 aa] ...    65   2e-11
SAKL0H09812g Chr8 (843768..844880) [1113 bp, 370 aa] {ON} simila...    65   2e-11
KNAG0C04720 Chr3 (924406..925275) [870 bp, 289 aa] {ON}                65   2e-11
Smik_6.182 Chr6 (300048..300992) [945 bp, 314 aa] {ON} YGR096W (...    65   2e-11
Kpol_1018.190 s1018 complement(475632..476579) [948 bp, 315 aa] ...    65   2e-11
Kpol_1018.133 s1018 complement(353273..354166) [894 bp, 297 aa] ...    65   2e-11
Skud_2.318 Chr2 (574979..576112) [1134 bp, 377 aa] {ON} YBR192W ...    65   3e-11
CAGL0J01661g Chr10 (154646..155629) [984 bp, 327 aa] {ON} highly...    65   3e-11
KAFR0A06880 Chr1 (1391095..1391988) [894 bp, 297 aa] {ON} Anc_2....    65   3e-11
Klac_YGOB_Anc_8.115 Chr4 (366536..367099,367103..367471) [933 bp...    65   3e-11
Suva_4.551 Chr4 complement(955889..956788) [900 bp, 299 aa] {ON}...    65   3e-11
TBLA0B06440 Chr2 complement(1518800..1520038) [1239 bp, 412 aa] ...    65   3e-11
Ecym_4781 Chr4 complement(1521382..1522311) [930 bp, 309 aa] {ON...    65   3e-11
KLTH0F11902g Chr6 complement(1002844..1003758) [915 bp, 304 aa] ...    65   3e-11
Suva_4.446 Chr4 (777859..778992) [1134 bp, 377 aa] {ON} YBR192W ...    65   3e-11
TBLA0D03560 Chr4 (883524..884450) [927 bp, 308 aa] {ON} Anc_1.53...    65   3e-11
NCAS0A10880 Chr1 (2165561..2166487) [927 bp, 308 aa] {ON} Anc_3....    65   3e-11
TPHA0M01360 Chr13 (289522..290436) [915 bp, 304 aa] {ON} Anc_3.3...    64   3e-11
TDEL0A03250 Chr1 complement(579158..580051) [894 bp, 297 aa] {ON...    64   3e-11
KAFR0B04500 Chr2 complement(934820..935929) [1110 bp, 369 aa] {O...    65   3e-11
SAKL0A10670g Chr1 (937609..938538) [930 bp, 309 aa] {ON} similar...    64   4e-11
TBLA0B07140 Chr2 (1691695..1692588) [894 bp, 297 aa] {ON} Anc_2....    64   4e-11
Kpol_541.38 s541 complement(121522..122484) [963 bp, 320 aa] {ON...    64   4e-11
KLLA0E12365g Chr5 complement(1092303..1093220) [918 bp, 305 aa] ...    64   4e-11
YJR077C Chr10 complement(577255..578190) [936 bp, 311 aa] {ON}  ...    64   4e-11
Kpol_1043.32 s1043 (67831..68727) [897 bp, 298 aa] {ON} (67831.....    64   4e-11
ZYRO0B01826g Chr2 (147594..148691) [1098 bp, 365 aa] {ON} highly...    65   4e-11
Smik_8.51 Chr8 (87717..88790) [1074 bp, 357 aa] {ON} YHR002W (REAL)    64   5e-11
KLTH0E12782g Chr5 complement(1130877..1131995) [1119 bp, 372 aa]...    64   5e-11
TPHA0C03660 Chr3 (795739..796896) [1158 bp, 385 aa] {ON} Anc_2.3...    65   5e-11
KAFR0D03590 Chr4 complement(701308..702207) [900 bp, 299 aa] {ON...    64   5e-11
NCAS0A11860 Chr1 complement(2351868..2352746) [879 bp, 292 aa] {...    64   5e-11
NCAS0E03940 Chr5 complement(772432..773607) [1176 bp, 391 aa] {O...    64   6e-11
KLTH0A04070g Chr1 complement(340333..341373) [1041 bp, 346 aa] {...    64   6e-11
Kwal_26.7967 s26 complement(591405..592298) [894 bp, 297 aa] {ON...    64   6e-11
KAFR0J00760 Chr10 (140163..141680) [1518 bp, 505 aa] {ON} Anc_2....    64   6e-11
CAGL0J09790g Chr10 complement(959883..960785) [903 bp, 300 aa] {...    64   6e-11
Kwal_56.23011 s56 (365512..366423) [912 bp, 303 aa] {ON} YPR058W...    64   6e-11
CAGL0F00231g Chr6 (29705..30628) [924 bp, 307 aa] {ON} highly si...    64   7e-11
KNAG0B04110 Chr2 (783740..784651) [912 bp, 303 aa] {ON} Anc_5.46...    64   7e-11
KLTH0G08580g Chr7 (703446..704993) [1548 bp, 515 aa] {ON} simila...    64   7e-11
KNAG0C05860 Chr3 complement(1139824..1140888) [1065 bp, 354 aa] ...    64   7e-11
Smik_16.252 Chr16 complement(459130..460110) [981 bp, 326 aa] {O...    64   7e-11
Kpol_1050.95 s1050 complement(217878..218858) [981 bp, 326 aa] {...    64   8e-11
TDEL0B07140 Chr2 complement(1260240..1261148) [909 bp, 302 aa] {...    63   8e-11
TPHA0L01750 Chr12 complement(366445..367566) [1122 bp, 373 aa] {...    64   8e-11
Smik_2.223 Chr2 (399236..400159) [924 bp, 307 aa] {ON} YBR085W (...    63   8e-11
Suva_8.182 Chr8 complement(327682..328560) [879 bp, 292 aa] {ON}...    63   1e-10
Smik_2.433 Chr2 complement(769409..770308) [900 bp, 299 aa] {ON}...    63   1e-10
ZYRO0B00418g Chr2 (25486..26430) [945 bp, 314 aa] {ON} highly si...    63   1e-10
Kwal_27.11626 s27 (882293..883192) [900 bp, 299 aa] {ON} YDL198C...    63   1e-10
KLTH0B00858g Chr2 (75377..76294) [918 bp, 305 aa] {ON} highly si...    63   1e-10
NCAS0B06110 Chr2 (1157064..1157954) [891 bp, 296 aa] {ON} Anc_2....    63   1e-10
Kpol_269.4 s269 (9676..10578) [903 bp, 300 aa] {ON} (9676..10578...    63   1e-10
KNAG0B00110 Chr2 (5634..6557) [924 bp, 307 aa] {ON} Anc_1.536 YJ...    63   1e-10
KLTH0D06622g Chr4 complement(575930..576823) [894 bp, 297 aa] {O...    63   1e-10
NCAS0F00940 Chr6 complement(188723..189793) [1071 bp, 356 aa] {O...    63   1e-10
Kwal_23.2913 s23 (72876..73838) [963 bp, 320 aa] {ON} YOR100C (C...    63   1e-10
TDEL0G02430 Chr7 complement(465147..466040) [894 bp, 297 aa] {ON...    63   1e-10
SAKL0A09284g Chr1 complement(808041..808931) [891 bp, 296 aa] {O...    63   1e-10
Skud_10.301 Chr10 complement(534646..535581) [936 bp, 311 aa] {O...    63   1e-10
Kwal_33.15597 s33 complement(1177222..1178139) [918 bp, 305 aa] ...    63   1e-10
KNAG0A07000 Chr1 complement(1093296..1094192) [897 bp, 298 aa] {...    62   1e-10
Kwal_33.14050 s33 (500819..501763) [945 bp, 314 aa] {ON} YKR052C...    63   2e-10
NDAI0K01900 Chr11 (431262..432158) [897 bp, 298 aa] {ON} Anc_2.525     62   2e-10
AEL253W Chr5 (164665..165762) [1098 bp, 365 aa] {ON} Syntenic ho...    63   2e-10
TBLA0B04570 Chr2 (1056275..1057435) [1161 bp, 386 aa] {ON} Anc_8...    63   2e-10
SAKL0E06974g Chr5 (576030..576929) [900 bp, 299 aa] {ON} similar...    62   2e-10
Ecym_3621 Chr3 complement(1186987..1187907) [921 bp, 306 aa] {ON...    62   2e-10
YBR291C Chr2 complement(783673..784572) [900 bp, 299 aa] {ON}  C...    62   2e-10
TPHA0F03660 Chr6 complement(796023..796979) [957 bp, 318 aa] {ON...    62   2e-10
Kpol_460.15 s460 (28308..29162) [855 bp, 284 aa] {ON} (28308..29...    62   2e-10
SAKL0E09482g Chr5 complement(790392..791933) [1542 bp, 513 aa] {...    63   2e-10
Suva_12.167 Chr12 complement(255434..256369) [936 bp, 311 aa] {O...    62   2e-10
NDAI0E03390 Chr5 complement(722785..723687) [903 bp, 300 aa] {ON...    62   2e-10
Smik_4.118 Chr4 complement(223347..224270) [924 bp, 307 aa] {ON}...    62   2e-10
TDEL0B01910 Chr2 complement(338205..339107) [903 bp, 300 aa] {ON...    62   3e-10
YBR192W Chr2 (607652..608785) [1134 bp, 377 aa] {ON}  RIM2Mitoch...    62   3e-10
NCAS0C02650 Chr3 complement(493892..494794) [903 bp, 300 aa] {ON...    62   3e-10
Skud_9.171 Chr9 (314907..316070) [1164 bp, 387 aa] {ON} YIL006W ...    62   3e-10
NDAI0A03830 Chr1 complement(862352..863290) [939 bp, 312 aa] {ON...    62   3e-10
KLLA0E15445g Chr5 complement(1383230..1384210) [981 bp, 326 aa] ...    62   3e-10
Suva_14.345 Chr14 complement(605013..605867) [855 bp, 284 aa] {O...    61   3e-10
CAGL0K02915g Chr11 (259855..260883) [1029 bp, 342 aa] {ON} highl...    62   3e-10
TPHA0A04750 Chr1 (1077957..1078886) [930 bp, 309 aa] {ON} Anc_5....    62   3e-10
SAKL0A09306g Chr1 (809606..810646) [1041 bp, 346 aa] {ON} simila...    62   4e-10
ZYRO0C16082g Chr3 (1259382..1260299) [918 bp, 305 aa] {ON} simil...    62   4e-10
YHR002W Chr8 (108812..109885) [1074 bp, 357 aa] {ON}  LEU5Mitoch...    62   4e-10
Smik_2.332 Chr2 (593935..595068) [1134 bp, 377 aa] {ON} YBR192W ...    62   4e-10
TDEL0F01380 Chr6 (244598..245560) [963 bp, 320 aa] {ON} Anc_2.18...    62   4e-10
AGL065C Chr7 complement(585963..586970) [1008 bp, 335 aa] {ON} S...    62   4e-10
SAKL0A10450g Chr1 complement(913811..914734) [924 bp, 307 aa] {O...    61   4e-10
TDEL0D06240 Chr4 (1121126..1121137,1121212..1122195) [996 bp, 33...    61   4e-10
Suva_7.379 Chr7 (652291..653241) [951 bp, 316 aa] {ON} YGR096W (...    61   4e-10
KLLA0F13464g Chr6 (1246646..1247548) [903 bp, 300 aa] {ON} highl...    61   4e-10
Suva_12.12 Chr12 complement(16508..17368,17369..17431) [924 bp, ...    61   4e-10
Kwal_27.12081 s27 complement(1075335..1076444) [1110 bp, 369 aa]...    62   4e-10
CAGL0G03135g Chr7 (290834..291757) [924 bp, 307 aa] {ON} similar...    61   5e-10
TDEL0F02010 Chr6 complement(367934..368848) [915 bp, 304 aa] {ON...    61   5e-10
ZYRO0B01804g Chr2 complement(145944..146834) [891 bp, 296 aa] {O...    61   5e-10
Kpol_1062.9 s1062 (27219..28109) [891 bp, 296 aa] {ON} (27219..2...    61   5e-10
KAFR0H01710 Chr8 complement(316366..317271) [906 bp, 301 aa] {ON...    61   5e-10
TBLA0B07860 Chr2 complement(1862995..1863957) [963 bp, 320 aa] {...    61   6e-10
ZYRO0E09284g Chr5 (738556..738567,738660..739658) [1011 bp, 336 ...    61   6e-10
Ecym_7278 Chr7 complement(583334..584287) [954 bp, 317 aa] {ON} ...    61   6e-10
ZYRO0G11880g Chr7 complement(940728..941624) [897 bp, 298 aa] {O...    61   6e-10
ZYRO0G13068g Chr7 (1039069..1039992) [924 bp, 307 aa] {ON} highl...    61   6e-10
ZYRO0E01408g Chr5 (101663..102559) [897 bp, 298 aa] {ON} similar...    60   6e-10
Kwal_23.3042 s23 (131049..132677) [1629 bp, 542 aa] {ON} YNL083W...    61   6e-10
KLLA0E23629g Chr5 complement(2099965..2101071) [1107 bp, 368 aa]...    61   7e-10
KAFR0I00810 Chr9 (160066..161181) [1116 bp, 371 aa] {ON} Anc_8.5...    61   8e-10
Ecym_4629 Chr4 (1227427..1228278) [852 bp, 283 aa] {ON} similar ...    60   8e-10
NCAS0B06840 Chr2 complement(1303696..1304682) [987 bp, 328 aa] {...    60   8e-10
NDAI0H01430 Chr8 complement(349655..350746) [1092 bp, 363 aa] {O...    61   8e-10
Ecym_2585 Chr2 (1140540..1140599,1140659..1141648) [1050 bp, 349...    60   8e-10
Smik_7.365 Chr7 (602905..602976,602977..603834) [930 bp, 309 aa]...    60   8e-10
Kpol_1048.65 s1048 (186764..187624) [861 bp, 286 aa] {ON} (18676...    60   9e-10
YJL133W Chr10 (160619..161563) [945 bp, 314 aa] {ON}  MRS3Iron t...    60   9e-10
Kwal_33.15446 s33 (1111078..1111995) [918 bp, 305 aa] {ON} YPR05...    60   9e-10
KAFR0K01580 Chr11 (328735..329691) [957 bp, 318 aa] {ON} Anc_3.4...    60   1e-09
KLLA0E08911g Chr5 complement(791157..792041) [885 bp, 294 aa] {O...    60   1e-09
NDAI0B03890 Chr2 complement(977801..978820) [1020 bp, 339 aa] {O...    60   1e-09
NDAI0C05540 Chr3 complement(1284401..1285528) [1128 bp, 375 aa] ...    60   1e-09
Ecym_7441 Chr7 (905546..906457) [912 bp, 303 aa] {ON} similar to...    60   1e-09
YDL119C Chr4 complement(246689..247612) [924 bp, 307 aa] {ON} Pu...    60   1e-09
CAGL0B03883g Chr2 (383602..384522) [921 bp, 306 aa] {ON} weakly ...    60   1e-09
SAKL0H12562g Chr8 complement(1069635..1070531) [897 bp, 298 aa] ...    60   1e-09
ZYRO0E02728g Chr5 (210318..211271) [954 bp, 317 aa] {ON} similar...    60   1e-09
TPHA0C03540 Chr3 complement(767147..768049) [903 bp, 300 aa] {ON...    60   1e-09
AER366W Chr5 (1314627..1315508) [882 bp, 293 aa] {ON} Syntenic h...    59   2e-09
TBLA0C02280 Chr3 complement(538282..539319) [1038 bp, 345 aa] {O...    60   2e-09
KNAG0C01290 Chr3 (259851..260801) [951 bp, 316 aa] {ON} Anc_1.21...    60   2e-09
NCAS0A12390 Chr1 (2452135..2453079) [945 bp, 314 aa] {ON} Anc_1....    60   2e-09
Kpol_348.4 s348 complement(7361..8266) [906 bp, 301 aa] {ON} com...    59   2e-09
Smik_10.101 Chr10 (158315..159259) [945 bp, 314 aa] {ON} YJL133W...    59   2e-09
Ecym_7263 Chr7 (554293..555177) [885 bp, 294 aa] {ON} similar to...    59   2e-09
SAKL0F03674g Chr6 (290851..291885) [1035 bp, 344 aa] {ON} simila...    59   2e-09
NCAS0E01110 Chr5 complement(210507..211457) [951 bp, 316 aa] {ON...    59   2e-09
Skud_15.292 Chr15 complement(526144..527022) [879 bp, 292 aa] {O...    59   2e-09
TBLA0A02630 Chr1 (640356..641357) [1002 bp, 333 aa] {ON} Anc_5.4...    59   2e-09
YNL003C Chr14 complement(624975..625829) [855 bp, 284 aa] {ON}  ...    59   2e-09
KNAG0B01090 Chr2 complement(201176..202156) [981 bp, 326 aa] {ON...    59   2e-09
ZYRO0A09856g Chr1 (798939..799844) [906 bp, 301 aa] {ON} highly ...    59   2e-09
KLTH0F15422g Chr6 complement(1258131..1259156) [1026 bp, 341 aa]...    59   2e-09
Skud_14.324 Chr14 complement(591786..592640) [855 bp, 284 aa] {O...    59   2e-09
AFR253W Chr6 (892936..892983,893044..894030) [1035 bp, 344 aa] {...    59   3e-09
Kwal_55.21335 s55 (786553..787506) [954 bp, 317 aa] {ON} YOR130C...    59   3e-09
Ecym_5110 Chr5 complement(240616..241689) [1074 bp, 357 aa] {ON}...    59   3e-09
TPHA0G03470 Chr7 (740482..741519) [1038 bp, 345 aa] {ON} Anc_2.5...    59   3e-09
SAKL0G03124g Chr7 (259110..260081) [972 bp, 323 aa] {ON} weakly ...    59   4e-09
ZYRO0D07832g Chr4 (683498..684553) [1056 bp, 351 aa] {ON} simila...    59   4e-09
TDEL0A03240 Chr1 (578122..579105) [984 bp, 327 aa] {ON} Anc_5.460      59   4e-09
NCAS0A04840 Chr1 (968240..969133) [894 bp, 297 aa] {ON} Anc_2.525      59   4e-09
Kwal_0.232 s0 (114468..115292) [825 bp, 274 aa] {ON} YNL003C (PE...    58   4e-09
TBLA0B01430 Chr2 (311546..312523) [978 bp, 325 aa] {ON} Anc_2.18...    59   4e-09
TPHA0N01580 Chr14 complement(345779..346753) [975 bp, 324 aa] {O...    59   4e-09
KLTH0G07920g Chr7 (640089..641063) [975 bp, 324 aa] {ON} similar...    58   5e-09
KNAG0A05480 Chr1 complement(810657..811568) [912 bp, 303 aa] {ON...    58   5e-09
Smik_14.325 Chr14 complement(583201..584055) [855 bp, 284 aa] {O...    58   5e-09
AFR131C Chr6 complement(672996..674030) [1035 bp, 344 aa] {ON} S...    58   5e-09
NDAI0B06240 Chr2 (1512052..1512066,1512165..1513136) [987 bp, 32...    58   5e-09
AGR383W Chr7 (1437255..1438136) [882 bp, 293 aa] {ON} Syntenic h...    58   5e-09
KLTH0H12232g Chr8 (1042774..1043598) [825 bp, 274 aa] {ON} simil...    58   5e-09
KLTH0G11044g Chr7 complement(928161..929057) [897 bp, 298 aa] {O...    58   5e-09
SAKL0F06226g Chr6 (469718..470638) [921 bp, 306 aa] {ON} similar...    58   6e-09
CAGL0H03839g Chr8 (359987..360835) [849 bp, 282 aa] {ON} highly ...    57   7e-09
Ecym_5632 Chr5 complement(1281751..1282836) [1086 bp, 361 aa] {O...    58   7e-09
CAGL0J04114g Chr10 complement(386924..387835) [912 bp, 303 aa] {...    58   7e-09
TPHA0F01410 Chr6 complement(327058..328095) [1038 bp, 345 aa] {O...    58   8e-09
SAKL0G14234g Chr7 (1226299..1227336) [1038 bp, 345 aa] {ON} cons...    58   8e-09
TPHA0A05360 Chr1 complement(1212280..1213356) [1077 bp, 358 aa] ...    58   8e-09
Kpol_1060.37 s1060 complement(88810..89742) [933 bp, 310 aa] {ON...    57   8e-09
AFR146W Chr6 (702401..703246) [846 bp, 281 aa] {ON} Syntenic hom...    57   9e-09
KNAG0H03370 Chr8 complement(630092..631039) [948 bp, 315 aa] {ON...    57   9e-09
Skud_10.82 Chr10 (135644..136588) [945 bp, 314 aa] {ON} YJL133W ...    57   9e-09
AER450C Chr5 complement(1500683..1501609) [927 bp, 308 aa] {ON} ...    57   9e-09
Skud_6.136 Chr6 (237106..237168,237169..238026) [921 bp, 306 aa]...    57   1e-08
KLLA0C13431g Chr3 (1145919..1146905) [987 bp, 328 aa] {ON} simil...    57   1e-08
SAKL0H01804g Chr8 (182495..183583) [1089 bp, 362 aa] {ON} simila...    57   1e-08
Ecym_1298 Chr1 (605689..606507) [819 bp, 272 aa] {ON} similar to...    57   1e-08
Kpol_440.6 s440 (15656..16555) [900 bp, 299 aa] {ON} (15656..165...    57   1e-08
KAFR0A05350 Chr1 (1055459..1056349) [891 bp, 296 aa] {ON} Anc_3....    57   1e-08
KLTH0E10340g Chr5 (934782..935771) [990 bp, 329 aa] {ON} highly ...    57   1e-08
KLLA0B11319g Chr2 (988293..989360) [1068 bp, 355 aa] {ON} simila...    57   1e-08
Suva_6.213 Chr6 complement(388508..389452) [945 bp, 314 aa] {ON}...    57   2e-08
ZYRO0F12452g Chr6 (1012728..1013654) [927 bp, 308 aa] {ON} highl...    57   2e-08
Suva_7.555 Chr7 complement(960825..961925) [1101 bp, 366 aa] {ON...    57   2e-08
TBLA0D05670 Chr4 complement(1390922..1391908) [987 bp, 328 aa] {...    56   2e-08
AAL014C Chr1 complement(317388..318203) [816 bp, 271 aa] {ON} Sy...    56   2e-08
CAGL0C02013g Chr3 complement(209930..210919) [990 bp, 329 aa] {O...    56   2e-08
ZYRO0E01958g Chr5 complement(146255..147184) [930 bp, 309 aa] {O...    56   2e-08
CAGL0M05225g Chr13 (563163..564308) [1146 bp, 381 aa] {ON} highl...    56   2e-08
KLTH0F05786g Chr6 (506028..506951) [924 bp, 307 aa] {ON} highly ...    56   3e-08
ZYRO0E04840g Chr5 (365995..366834) [840 bp, 279 aa] {ON} similar...    55   3e-08
KLTH0F14102g Chr6 complement(1161801..1162781) [981 bp, 326 aa] ...    56   3e-08
NDAI0G00160 Chr7 (21194..22069) [876 bp, 291 aa] {ON} Anc_1.404        55   3e-08
SAKL0B05764g Chr2 (492867..493805) [939 bp, 312 aa] {ON} highly ...    55   3e-08
Ecym_4123 Chr4 complement(250884..251780) [897 bp, 298 aa] {ON} ...    55   4e-08
NDAI0B03400 Chr2 (865804..866736) [933 bp, 310 aa] {ON} Anc_2.313      55   4e-08
Kpol_1024.36 s1024 (100552..101673) [1122 bp, 373 aa] {ON} (1005...    56   4e-08
TDEL0B06020 Chr2 (1063824..1064672) [849 bp, 282 aa] {ON} Anc_1....    55   4e-08
KAFR0A01820 Chr1 (374940..376010) [1071 bp, 356 aa] {ON} Anc_2.5...    55   4e-08
NDAI0F02520 Chr6 complement(617625..619292) [1668 bp, 555 aa] {O...    56   4e-08
NDAI0B00880 Chr2 (204719..205837) [1119 bp, 372 aa] {ON} Anc_5.53      55   5e-08
KLLA0D04950g Chr4 (424550..425374) [825 bp, 274 aa] {ON} similar...    55   5e-08
KNAG0D02920 Chr4 (526681..526689,526801..527772) [981 bp, 326 aa...    55   5e-08
KLLA0B14454g Chr2 complement(1268709..1269626) [918 bp, 305 aa] ...    55   6e-08
NCAS0C00760 Chr3 complement(131089..132027) [939 bp, 312 aa] {ON...    55   6e-08
Kpol_448.18 s448 complement(46196..47089) [894 bp, 297 aa] {ON} ...    55   6e-08
TPHA0J02710 Chr10 (600526..601575) [1050 bp, 349 aa] {ON} Anc_5....    55   6e-08
ZYRO0C12518g Chr3 (990998..991909) [912 bp, 303 aa] {ON} similar...    55   7e-08
NCAS0A09800 Chr1 complement(1958223..1959212) [990 bp, 329 aa] {...    55   7e-08
NCAS0G04290 Chr7 complement(798297..799187) [891 bp, 296 aa] {ON}      55   7e-08
ABL023W Chr2 (355975..356904) [930 bp, 309 aa] {ON} Syntenic hom...    54   8e-08
TPHA0F01660 Chr6 complement(383110..384081) [972 bp, 323 aa] {ON...    54   8e-08
YPR128C Chr16 complement(791218..792204) [987 bp, 328 aa] {ON}  ...    54   9e-08
Skud_16.418 Chr16 complement(750769..751758) [990 bp, 329 aa] {O...    54   9e-08
KNAG0C02660 Chr3 (515334..516251) [918 bp, 305 aa] {ON}                54   1e-07
KNAG0M02620 Chr13 (484923..485867) [945 bp, 314 aa] {ON} Anc_2.6...    54   1e-07
CAGL0K08250g Chr11 complement(821014..821907) [894 bp, 297 aa] {...    54   1e-07
Smik_16.49 Chr16 (90150..91250) [1101 bp, 366 aa] {ON} YGR257C (...    54   1e-07
NCAS0G02770 Chr7 (501769..503349) [1581 bp, 526 aa] {ON} Anc_2.210     54   1e-07
TBLA0J02030 Chr10 (479870..481453) [1584 bp, 527 aa] {ON} Anc_2....    54   1e-07
NDAI0G01240 Chr7 complement(274097..275080) [984 bp, 327 aa] {ON...    54   1e-07
Kwal_55.21106 s55 complement(688203..689189) [987 bp, 328 aa] {O...    54   1e-07
KNAG0B05190 Chr2 (993001..994593) [1593 bp, 530 aa] {ON} Anc_2.2...    54   1e-07
KNAG0K00380 Chr11 (65728..66825) [1098 bp, 365 aa] {ON} Anc_5.53...    54   1e-07
KLLA0E18701g Chr5 complement(1661093..1662238) [1146 bp, 381 aa]...    54   2e-07
KLLA0A00979g Chr1 complement(92561..93592) [1032 bp, 343 aa] {ON...    54   2e-07
CAGL0L05742g Chr12 complement(632841..633758) [918 bp, 305 aa] {...    54   2e-07
TDEL0A03010 Chr1 (539739..540824) [1086 bp, 361 aa] {ON} Anc_2.5...    54   2e-07
KAFR0G00710 Chr7 (185875..186783) [909 bp, 302 aa] {ON} Anc_1.21...    53   2e-07
AGR191W Chr7 (1114968..1115864) [897 bp, 298 aa] {ON} Syntenic h...    53   2e-07
AAR036W Chr1 (406887..407840) [954 bp, 317 aa] {ON} Syntenic hom...    53   3e-07
KNAG0J00660 Chr10 complement(112567..113496) [930 bp, 309 aa] {O...    53   3e-07
Skud_7.591 Chr7 complement(980686..981792) [1107 bp, 368 aa] {ON...    53   3e-07
Kpol_348.5 s348 (9571..10662) [1092 bp, 363 aa] {ON} (9571..1066...    53   3e-07
ZYRO0D03212g Chr4 (259753..260658) [906 bp, 301 aa] {ON} similar...    53   3e-07
KLLA0F08547g Chr6 (796328..797254) [927 bp, 308 aa] {ON} highly ...    53   3e-07
Ecym_5377 Chr5 (768696..770348) [1653 bp, 550 aa] {ON} similar t...    53   3e-07
YGR257C Chr7 complement(1006205..1007305) [1101 bp, 366 aa] {ON}...    52   5e-07
ADL264C Chr4 complement(241530..242519) [990 bp, 329 aa] {ON} Sy...    52   5e-07
TDEL0H01010 Chr8 (175044..175955) [912 bp, 303 aa] {ON} Anc_1.21...    52   5e-07
Kwal_34.15907 s34 complement(109217..110155) [939 bp, 312 aa] {O...    52   6e-07
KAFR0J01960 Chr10 complement(377450..378382) [933 bp, 310 aa] {O...    52   6e-07
TPHA0B03710 Chr2 complement(874214..875128) [915 bp, 304 aa] {ON...    52   7e-07
KLTH0D06644g Chr4 (578225..579274) [1050 bp, 349 aa] {ON} simila...    52   7e-07
NCAS0B08060 Chr2 complement(1529511..1530416) [906 bp, 301 aa] {...    52   7e-07
CAGL0B04543g Chr2 (441599..442552) [954 bp, 317 aa] {ON} highly ...    52   8e-07
Kpol_1045.2 s1045 complement(1470..2399) [930 bp, 309 aa] {ON} c...    51   8e-07
NDAI0G06200 Chr7 complement(1538486..1539487) [1002 bp, 333 aa] ...    52   8e-07
Kpol_1020.37 s1020 complement(79930..81597) [1668 bp, 555 aa] {O...    52   9e-07
TDEL0G00770 Chr7 (159967..161037) [1071 bp, 356 aa] {ON} Anc_5.5...    52   9e-07
Ecym_5203 Chr5 (428139..429050) [912 bp, 303 aa] {ON} similar to...    51   9e-07
NDAI0B05380 Chr2 complement(1311707..1312618) [912 bp, 303 aa] {...    51   1e-06
KNAG0H01700 Chr8 (303319..304146) [828 bp, 275 aa] {ON} Anc_1.40...    51   1e-06
ACR260W Chr3 (823895..824830) [936 bp, 311 aa] {ON} Syntenic hom...    51   1e-06
YFR045W Chr6 (241998..242009,242082..242999) [930 bp, 309 aa] {O...    51   1e-06
Suva_16.455 Chr16 complement(793397..794386) [990 bp, 329 aa] {O...    51   1e-06
KLTH0B01804g Chr2 complement(143910..144818) [909 bp, 302 aa] {O...    51   1e-06
KLTH0H15246g Chr8 (1322967..1323902) [936 bp, 311 aa] {ON} highl...    51   1e-06
TPHA0F01510 Chr6 complement(347073..348911) [1839 bp, 612 aa] {O...    51   1e-06
TDEL0B01140 Chr2 complement(209741..210673) [933 bp, 310 aa] {ON...    51   1e-06
TPHA0B03080 Chr2 (700900..701817) [918 bp, 305 aa] {ON} Anc_1.21...    50   1e-06
TPHA0D04130 Chr4 complement(884607..885575) [969 bp, 322 aa] {ON...    50   2e-06
Smik_16.375 Chr16 complement(668495..669481) [987 bp, 328 aa] {O...    50   2e-06
TPHA0H00520 Chr8 (103738..104721) [984 bp, 327 aa] {ON} Anc_8.11...    50   2e-06
Suva_14.256 Chr14 (470075..471712) [1638 bp, 545 aa] {ON} YNL083...    51   2e-06
AER419W Chr5 (1442595..1444076) [1482 bp, 493 aa] {ON} Syntenic ...    50   2e-06
TPHA0I00670 Chr9 complement(139133..140059) [927 bp, 308 aa] {ON...    50   2e-06
Suva_8.154 Chr8 complement(270475..271458) [984 bp, 327 aa] {ON}...    50   3e-06
SAKL0C06512g Chr3 (608274..609182) [909 bp, 302 aa] {ON} similar...    50   3e-06
AFR147C Chr6 complement(703267..704214) [948 bp, 315 aa] {ON} NO...    50   3e-06
Ecym_7262 Chr7 complement(552261..553322) [1062 bp, 353 aa] {ON}...    50   4e-06
Ecym_1248 Chr1 complement(507771..508730) [960 bp, 319 aa] {ON} ...    49   4e-06
AGL064W Chr7 (587623..588513) [891 bp, 296 aa] {ON} Syntenic hom...    49   4e-06
YKR052C Chr11 complement(532550..533464) [915 bp, 304 aa] {ON}  ...    49   4e-06
KLLA0A09383g Chr1 complement(818752..819852) [1101 bp, 366 aa] {...    50   4e-06
Ecym_5351 Chr5 (711399..712313) [915 bp, 304 aa] {ON} similar to...    49   4e-06
CAGL0J05522g Chr10 complement(527054..528613) [1560 bp, 519 aa] ...    50   4e-06
Suva_13.426 Chr13 (733555..734490) [936 bp, 311 aa] {ON} YMR241W...    49   5e-06
NDAI0A04600 Chr1 (1034559..1035542) [984 bp, 327 aa] {ON} Anc_3....    49   6e-06
TBLA0E00280 Chr5 complement(48863..49833,50129..50156) [999 bp, ...    49   6e-06
YOR100C Chr15 complement(513295..514278) [984 bp, 327 aa] {ON}  ...    49   7e-06
NCAS0A11680 Chr1 complement(2325829..2326800) [972 bp, 323 aa] {...    49   8e-06
Kpol_2001.4 s2001 complement(14451..15434) [984 bp, 327 aa] {ON}...    49   8e-06
KAFR0B03530 Chr2 (734572..735495) [924 bp, 307 aa] {ON} Anc_8.78...    48   8e-06
Skud_14.247 Chr14 (461696..463330) [1635 bp, 544 aa] {ON} YNL083...    49   9e-06
NDAI0K00800 Chr11 complement(180233..181168) [936 bp, 311 aa] {O...    48   9e-06
Ecym_4445 Chr4 (911152..912318) [1167 bp, 388 aa] {ON} similar t...    49   1e-05
ZYRO0C06490g Chr3 complement(494518..495555) [1038 bp, 345 aa] {...    48   1e-05
AFR542W Chr6 (1408920..1409852) [933 bp, 310 aa] {ON} Syntenic h...    48   1e-05
Ecym_1486 Chr1 (1001231..1002172) [942 bp, 313 aa] {ON} similar ...    48   1e-05
SAKL0E10186g Chr5 complement(852843..853796) [954 bp, 317 aa] {O...    48   1e-05
Kwal_26.7972 s26 (593811..594887) [1077 bp, 358 aa] {ON} YHR002W...    48   1e-05
Ecym_4630 Chr4 complement(1228327..1229226) [900 bp, 299 aa] {ON...    48   1e-05
TBLA0B07890 Chr2 (1870424..1871662) [1239 bp, 412 aa] {ON} Anc_5...    48   2e-05
Skud_15.265 Chr15 complement(469607..470710) [1104 bp, 367 aa] {...    47   2e-05
Skud_13.412 Chr13 (726744..727682) [939 bp, 312 aa] {ON} YMR241W...    47   2e-05
Skud_11.288 Chr11 complement(514106..515020) [915 bp, 304 aa] {O...    47   3e-05
Smik_13.453 Chr13 (736364..737308) [945 bp, 314 aa] {ON} YMR241W...    47   3e-05
Kpol_1020.53 s1020 complement(126382..127353) [972 bp, 323 aa] {...    47   3e-05
YMR241W Chr13 (751961..752905) [945 bp, 314 aa] {ON}  YHM2Carrie...    47   3e-05
TBLA0D00730 Chr4 complement(194856..195785) [930 bp, 309 aa] {ON...    47   3e-05
KLLA0C11363g Chr3 complement(975442..976995) [1554 bp, 517 aa] {...    47   4e-05
SAKL0D08646g Chr4 complement(720371..721198) [828 bp, 275 aa] {O...    46   4e-05
KAFR0H03120 Chr8 complement(595433..596302) [870 bp, 289 aa] {ON...    46   5e-05
ZYRO0B02354g Chr2 (193051..193986) [936 bp, 311 aa] {ON} similar...    46   6e-05
Smik_11.314 Chr11 complement(522516..523430) [915 bp, 304 aa] {O...    45   1e-04
Smik_14.243 Chr14 (451674..453311) [1638 bp, 545 aa] {ON} YNL083...    45   1e-04
Ecym_3351 Chr3 complement(665793..666677) [885 bp, 294 aa] {ON} ...    45   1e-04
TDEL0C04260 Chr3 (762512..764107) [1596 bp, 531 aa] {ON} Anc_2.2...    45   1e-04
Suva_11.286 Chr11 complement(516275..517189) [915 bp, 304 aa] {O...    44   3e-04
ADR036C Chr4 complement(771095..772117) [1023 bp, 340 aa] {ON} S...    44   3e-04
KAFR0J00210 Chr10 complement(35894..36856,36914..36928) [978 bp,...    44   3e-04
TBLA0C01260 Chr3 (274360..275145) [786 bp, 261 aa] {ON} Anc_1.40...    42   6e-04
ZYRO0C15224g Chr3 complement(1183098..1184684) [1587 bp, 528 aa]...    43   8e-04
CAGL0F08305g Chr6 complement(827705..828829) [1125 bp, 374 aa] {...    42   8e-04
CAGL0K07436g Chr11 complement(735325..736248) [924 bp, 307 aa] {...    42   0.001
Smik_15.280 Chr15 complement(474318..475301) [984 bp, 327 aa] {O...    35   0.15 
NDAI0B04170 Chr2 complement(1052647..1053636) [990 bp, 329 aa] {...    34   0.32 
Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}...    33   0.87 
Suva_2.645 Chr2 complement(1152655..1154154) [1500 bp, 499 aa] {...    33   0.97 
Smik_4.748 Chr4 complement(1321088..1322590) [1503 bp, 500 aa] {...    33   1.1  
Kwal_56.23671 s56 (649753..651726) [1974 bp, 657 aa] {ON} YLR103...    33   1.2  
KAFR0D03050 Chr4 complement(602858..603301) [444 bp, 147 aa] {ON...    31   1.9  
Smik_4.67 Chr4 complement(126041..132478) [6438 bp, 2145 aa] {ON...    32   2.6  
TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}...    32   2.8  
Skud_4.86 Chr4 complement(145097..151534) [6438 bp, 2145 aa] {ON...    31   4.3  
YDL171C Chr4 complement(149203..155640) [6438 bp, 2145 aa] {ON} ...    31   4.8  
Suva_4.75 Chr4 complement(136935..143372) [6438 bp, 2145 aa] {ON...    31   5.1  

>TDEL0C05800 Chr3 complement(1047254..1048144) [891 bp, 296 aa] {ON}
           Anc_1.123 YLR348C
          Length = 296

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/296 (100%), Positives = 296/296 (100%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK 60
           MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK
Sbjct: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK 60

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG 120
           NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG
Sbjct: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG 120

Query: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180
           FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM
Sbjct: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180

Query: 181 TASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH 240
           TASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH
Sbjct: 181 TASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH 240

Query: 241 HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQHF 296
           HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQHF
Sbjct: 241 HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQHF 296

>TDEL0C06990 Chr3 complement(1271111..1272001) [891 bp, 296 aa] {ON}
           additional copy of DIC1 in X region of T. delbrueckii
           HML locus
          Length = 296

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/296 (100%), Positives = 296/296 (100%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK 60
           MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK
Sbjct: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK 60

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG 120
           NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG
Sbjct: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG 120

Query: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180
           FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM
Sbjct: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180

Query: 181 TASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH 240
           TASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH
Sbjct: 181 TASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH 240

Query: 241 HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQHF 296
           HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQHF
Sbjct: 241 HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQHF 296

>ZYRO0C18304g Chr3 complement(1433725..1434615) [891 bp, 296 aa]
           {ON} similar to uniprot|P87332 Saccharomyces cerevisiae
           YLR348C DIC1 Mitochondrial dicarboxylate carrier
           integral membrane protein catalyzes a
           dicarboxylate-phosphate exchange across the inner
           mitochondrial membrane transports cytoplasmic
           dicarboxylates into the mitochondrial matrix
          Length = 296

 Score =  430 bits (1106), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 202/293 (68%), Positives = 236/293 (80%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK 60
           MS +K  S  A +KYPWWYGGVGGIVAC+ THPLDLAKVRLQTA  PKPT+  M+ +IL 
Sbjct: 1   MSSSKPSSPTAPIKYPWWYGGVGGIVACVATHPLDLAKVRLQTAPLPKPTIIQMVNKILA 60

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG 120
           ++G  GLYSGLTASILRQCTYT ARFG Y+F+K N +  D+L  T  LLP SM+SGAIGG
Sbjct: 61  SEGIKGLYSGLTASILRQCTYTMARFGFYEFVKNNFIQPDQLTKTSILLPVSMLSGAIGG 120

Query: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180
           FVGNPADVVNIRMQND+      RR YKNA  G+TRI KEEG RKL TGLGPNLVRG LM
Sbjct: 121 FVGNPADVVNIRMQNDTQLPIEQRRGYKNAFSGITRIVKEEGFRKLFTGLGPNLVRGCLM 180

Query: 181 TASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH 240
           TASQ V+YDVCK+ +VT    D ++KKTHF ASLVA L+ATTICSPADVIKTRIMNAH+H
Sbjct: 181 TASQAVTYDVCKNYMVTKMQMDPTQKKTHFGASLVASLMATTICSPADVIKTRIMNAHKH 240

Query: 241 HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMH 293
           HE+ L  ++ +++ EGL F+FRGWLPSF RLGPNTI+IFL VEQL+K+ IG++
Sbjct: 241 HENALTGMTKAVQKEGLLFLFRGWLPSFVRLGPNTIIIFLTVEQLKKHNIGLN 293

>SAKL0C03718g Chr3 (350498..351364) [867 bp, 288 aa] {ON} similar to
           uniprot|P87332 Saccharomyces cerevisiae YLR348C DIC1
           Mitochondrial dicarboxylate carrier integral membrane
           protein catalyzes a dicarboxylate-phosphate exchange
           across the inner mitochondrial membrane transports
           cytoplasmic dicarboxylates into the mitochondrial matrix
          Length = 288

 Score =  423 bits (1087), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 198/287 (68%), Positives = 231/287 (80%), Gaps = 1/287 (0%)

Query: 7   ESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLG 66
            S+   VKYPWWYGG GGIVAC+ THPLDLAKVRLQTA  PKPTL  M  +IL+N+G  G
Sbjct: 2   SSAPEPVKYPWWYGGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPG 61

Query: 67  LYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPA 126
           LYSGLTA+ILRQCTYTTARFG YDF+KE  +P + LNS LYLLPCSM SGA+GG +GNPA
Sbjct: 62  LYSGLTAAILRQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGGLIGNPA 121

Query: 127 DVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
           DVVNIRMQNDS+    LRRNYKNA DG+ +I   EGV KL TG  PNLVRG+LMT+SQVV
Sbjct: 122 DVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVV 181

Query: 187 SYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH-HESTL 245
           +YD+ K+ LV   G D   K THF +SL+AGLVATT+CSPADVIKTR+MNAH+H H+S +
Sbjct: 182 TYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRVMNAHKHSHDSAV 241

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGM 292
           ++L  +++ EG  FMFRGWLPSF RLGPNTILIFL VEQLRK+ +GM
Sbjct: 242 RILLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQLRKHRVGM 288

>Kpol_2000.25 s2000 complement(47543..48412) [870 bp, 289 aa] {ON}
           complement(47543..48412) [870 nt, 290 aa]
          Length = 289

 Score =  420 bits (1079), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 192/288 (66%), Positives = 238/288 (82%), Gaps = 1/288 (0%)

Query: 6   SESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPL 65
           S+ S+  +KYPWWYGGVGGIVA + THPLDL+KVRLQT+  P+P+LF+M   IL+N+G +
Sbjct: 2   SKESSEPIKYPWWYGGVGGIVATMCTHPLDLSKVRLQTSPLPRPSLFTMFSTILRNEGVV 61

Query: 66  GLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNP 125
           GLYSGL+A+ILRQCTYTTARFGCYD +KE ++P DKLN   YLLP SM+SGAIGG VGNP
Sbjct: 62  GLYSGLSAAILRQCTYTTARFGCYDVLKEYVIPKDKLNDVSYLLPASMVSGAIGGLVGNP 121

Query: 126 ADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEE-GVRKLLTGLGPNLVRGVLMTASQ 184
           ADVVNIRMQND++ EPHLRRNYKNAIDG+ +I+K + G+ +L  GL PNL+RG+LMT+SQ
Sbjct: 122 ADVVNIRMQNDTSLEPHLRRNYKNAIDGLIKIYKYDGGIPRLYAGLSPNLIRGILMTSSQ 181

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHEST 244
           VV+YD+ K+ LVT    +  EKKTHFTASL+AG +ATT+CSPADV+KTRIMN H    S 
Sbjct: 182 VVTYDLFKNYLVTNLNMNPQEKKTHFTASLMAGFIATTVCSPADVMKTRIMNDHNPKHSA 241

Query: 245 LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGM 292
           +K L  +++NEG  FMFRGWLPSF RLGP T+LIFL VEQ++KY++GM
Sbjct: 242 MKTLILAVQNEGPQFMFRGWLPSFVRLGPFTVLIFLTVEQMKKYKVGM 289

>NDAI0A03380 Chr1 complement(770468..771361) [894 bp, 297 aa] {ON}
           Anc_1.123
          Length = 297

 Score =  413 bits (1062), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 196/290 (67%), Positives = 234/290 (80%), Gaps = 2/290 (0%)

Query: 8   SSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGL 67
           S+   +KYPWWYGG GG+ A ++THPLDLAKVRLQ A  PKPTL  M+  ILKN+  +GL
Sbjct: 2   STTKPIKYPWWYGGAGGVFATLMTHPLDLAKVRLQAAPMPKPTLRKMLTTILKNENVMGL 61

Query: 68  YSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPAD 127
           YSGL+A+ILRQCTYTT RFG YD +KEN++P ++LN+ LYLLPCSMISGA+GG  GN AD
Sbjct: 62  YSGLSAAILRQCTYTTVRFGAYDLMKENIVPVNQLNNMLYLLPCSMISGAVGGLAGNFAD 121

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEE-GVRKLLTGLGPNLVRGVLMTASQVV 186
           VVNIRMQNDSA + HLRRNYKNAIDGV +I+K E G + LLTG  PN+VRGVLMTASQVV
Sbjct: 122 VVNIRMQNDSALDNHLRRNYKNAIDGVYKIYKNEGGFKTLLTGWKPNMVRGVLMTASQVV 181

Query: 187 SYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAH-QHHESTL 245
           +YDV K+ L T  GFD  +  TH +ASL+AGLVATTICSPADVIKTRIMN H   +ES +
Sbjct: 182 TYDVFKNYLTTKLGFDPKKNSTHLSASLLAGLVATTICSPADVIKTRIMNGHGTSNESAI 241

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
           K+L+++IR EG GFMFRGWLPSF RLGP T+LIF  +EQL+K+ IGM + 
Sbjct: 242 KILTTAIRKEGPGFMFRGWLPSFTRLGPFTMLIFFAIEQLKKHRIGMPRE 291

>Suva_10.449 Chr10 complement(786544..787446) [903 bp, 300 aa] {ON}
           YLR348C (REAL)
          Length = 300

 Score =  414 bits (1063), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 192/296 (64%), Positives = 235/296 (79%), Gaps = 1/296 (0%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK 60
           MS     S++  +KYPWWYGGV GI A ++THPLDL+KVRLQ A  PKPTLF M++ IL 
Sbjct: 1   MSTNAKASADKNIKYPWWYGGVAGIFATMVTHPLDLSKVRLQAAPMPKPTLFKMLESILA 60

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG 120
           ++G LGLYSGL+A++LRQCTYTT RFG YD +KEN++P D++ +  YLLPCSM SGAIGG
Sbjct: 61  HEGVLGLYSGLSAAVLRQCTYTTVRFGAYDMLKENVIPRDQVTNMAYLLPCSMFSGAIGG 120

Query: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEE-GVRKLLTGLGPNLVRGVL 179
            +GN ADVVNIRMQNDSA EP  RRNYKNAIDGV RI++ E G++ L TG  PN+VRG+L
Sbjct: 121 LLGNFADVVNIRMQNDSALEPAKRRNYKNAIDGVYRIYRHEGGLKTLFTGWKPNMVRGIL 180

Query: 180 MTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQ 239
           MTASQVV+YDV K+ LVT F FD S+  TH TASL+AGLVATT+CSPADV+KTRIMN   
Sbjct: 181 MTASQVVTYDVFKNYLVTKFDFDESKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSG 240

Query: 240 HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
            H+  LK+L+ +IR EG  FMFRGWLPSF RLGP T+LIF  +EQL+K+++GM + 
Sbjct: 241 DHQPALKILADAIRKEGPSFMFRGWLPSFTRLGPFTVLIFFAIEQLKKHKVGMPKE 296

>YLR348C Chr12 complement(826977..827873) [897 bp, 298 aa] {ON}
           DIC1Mitochondrial dicarboxylate carrier, integral
           membrane protein, catalyzes a dicarboxylate-phosphate
           exchange across the inner mitochondrial membrane,
           transports cytoplasmic dicarboxylates into the
           mitochondrial matrix
          Length = 298

 Score =  408 bits (1049), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 231/296 (78%), Gaps = 1/296 (0%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK 60
           MS    ES+   +KYPWWYGG  GI A ++THPLDLAKVRLQ A  PKPTLF M++ IL 
Sbjct: 1   MSTNAKESAGKNIKYPWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILA 60

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG 120
           N+G +GLYSGL+A++LRQCTYTT RFG YD +KEN++P ++L +  YLLPCSM SGAIGG
Sbjct: 61  NEGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGG 120

Query: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEE-GVRKLLTGLGPNLVRGVL 179
             GN ADVVNIRMQNDSA E   RRNYKNAIDGV +I++ E G++ L TG  PN+VRG+L
Sbjct: 121 LAGNFADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGIL 180

Query: 180 MTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQ 239
           MTASQVV+YDV K+ LVT   FDAS+  TH TASL+AGLVATT+CSPADV+KTRIMN   
Sbjct: 181 MTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSG 240

Query: 240 HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
            H+  LK+L+ ++R EG  FMFRGWLPSF RLGP T+LIF  +EQL+K+ +GM + 
Sbjct: 241 DHQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKHRVGMPKE 296

>NCAS0A03540 Chr1 complement(701962..702870) [909 bp, 302 aa] {ON}
           Anc_1.123
          Length = 302

 Score =  408 bits (1049), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 231/289 (79%), Gaps = 2/289 (0%)

Query: 6   SESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPL 65
           ++S    +KYPWWYGG  GI AC++THPLDLAKVRLQ A  PKPTL  M+  IL+N+  +
Sbjct: 2   TDSPTKQIKYPWWYGGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRNENVM 61

Query: 66  GLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNP 125
           GLYSGL+A++LRQCTYTT RFG YD +KENL+P   +N  +YLLPCSM SGAIGG VGN 
Sbjct: 62  GLYSGLSAAVLRQCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNF 121

Query: 126 ADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEE-GVRKLLTGLGPNLVRGVLMTASQ 184
           ADVVNIRMQNDSA +P LRRNY+NAIDGV +I+  E G++ LLTG  PN+VRGVLMTASQ
Sbjct: 122 ADVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQ 181

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQ-HHES 243
           VV+YDV K+ LVT   FD  +  TH +ASL+AGLVATTICSPADVIKTRIMNAH+   ES
Sbjct: 182 VVTYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVATTICSPADVIKTRIMNAHKTESES 241

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGM 292
            +K+L+S+I+ EG  FMFRGWLPSF RLGP T+LIF  +EQL+K+ +GM
Sbjct: 242 AIKILTSAIKKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKHRVGM 290

>Smik_12.437 Chr12 complement(765885..766781) [897 bp, 298 aa] {ON}
           YLR348C (REAL)
          Length = 298

 Score =  408 bits (1048), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 192/296 (64%), Positives = 230/296 (77%), Gaps = 1/296 (0%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK 60
           MS     S+   +KYPWWYGGV GI A ++THPLDLAKVRLQ A  PKPTLF M++ IL 
Sbjct: 1   MSTNVKGSAGKNIKYPWWYGGVAGIFATMVTHPLDLAKVRLQAAPMPKPTLFKMLENILA 60

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG 120
           N+G +GLYSGL+A++LRQCTYTT RFG YD +KEN++P ++L +  YLLPCSM SGAIGG
Sbjct: 61  NEGVMGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPEEQLTNMAYLLPCSMFSGAIGG 120

Query: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEE-GVRKLLTGLGPNLVRGVL 179
             GN ADVVNIRMQNDSA E   RRNYKNAIDGV RI++ E G + L TG  PN+VRG+L
Sbjct: 121 LAGNFADVVNIRMQNDSALEASKRRNYKNAIDGVYRIYRYEGGFKTLFTGWKPNVVRGIL 180

Query: 180 MTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQ 239
           MTASQVV+YDV K+ LVT   FDAS+  TH TASL+AGLVATT+CSPADV+KTRIMN   
Sbjct: 181 MTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSG 240

Query: 240 HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
            H+  LK+L+ +IR EG  FMFRGWLPSF RLGP T+LIF  +EQL+K+ +GM + 
Sbjct: 241 DHQPALKILADAIRKEGPSFMFRGWLPSFTRLGPLTMLIFFAIEQLKKHRVGMPKE 296

>Skud_12.434 Chr12 complement(767307..768203) [897 bp, 298 aa] {ON}
           YLR348C (REAL)
          Length = 298

 Score =  403 bits (1035), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 188/296 (63%), Positives = 229/296 (77%), Gaps = 1/296 (0%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK 60
           MS    + +   +KYPWWYGG  GI A ++THPLDLAKVRLQ A  PKPTLF M++ IL 
Sbjct: 1   MSTNAKQPAGKNIKYPWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFKMLESILA 60

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG 120
           N+G +GLYSGL+A++LRQCTYTT RFG YD +KE ++P D+L +  YLLPCSM SGAIGG
Sbjct: 61  NEGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKERVIPDDQLTNMAYLLPCSMFSGAIGG 120

Query: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEE-GVRKLLTGLGPNLVRGVL 179
             GN ADVVNIRMQNDSA E   RRNYKNA+DGV +I++ E G++ L TG  PN+VRG+L
Sbjct: 121 LAGNFADVVNIRMQNDSALEVAKRRNYKNAVDGVYKIYRYEGGLKTLFTGWRPNMVRGIL 180

Query: 180 MTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQ 239
           MTASQVV+YDV K+ LVT   FDAS+  TH TASL+AGLVATT+CSPADV+KTRIMN   
Sbjct: 181 MTASQVVTYDVFKNYLVTELNFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSG 240

Query: 240 HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
            H+  LK+L+ +IR EG  FMFRGWLPSF RLGP T+LIF  +EQL+K+ +GM + 
Sbjct: 241 DHQPALKILADAIRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKHRVGMPKE 296

>KNAG0B05730 Chr2 complement(1124709..1125599) [891 bp, 296 aa] {ON}
           Anc_1.123 YLR348C
          Length = 296

 Score =  399 bits (1025), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 185/291 (63%), Positives = 229/291 (78%), Gaps = 1/291 (0%)

Query: 6   SESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPL 65
           + +S   +KYPWWYGG  GI AC+ THPLDLAKVRLQ A  PKPTL  M+  ILKN+G L
Sbjct: 3   TTTSTKQIKYPWWYGGAAGIFACVNTHPLDLAKVRLQAAPLPKPTLGRMLTSILKNEGIL 62

Query: 66  GLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNP 125
           GLYSGL+A++LRQCTYTT RFG YD +KE+L+P  +L +  YLLPCSM SGA GG  GN 
Sbjct: 63  GLYSGLSAAVLRQCTYTTVRFGIYDMLKEHLIPKGQLTNMAYLLPCSMFSGAFGGLAGNF 122

Query: 126 ADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEE-GVRKLLTGLGPNLVRGVLMTASQ 184
           ADVVNIRMQNDSA EP LRRNYKNA DGV +I++ E G++ ++TG  PN+VRG+LMTASQ
Sbjct: 123 ADVVNIRMQNDSALEPSLRRNYKNAFDGVYKIYRYEGGLKTMMTGWKPNMVRGILMTASQ 182

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHEST 244
           VV+YDV K+ LVT   FD ++  TH +ASL+AGLVATT+CSPADVIKTRIMN    ++S 
Sbjct: 183 VVTYDVFKNYLVTKLQFDPTKNSTHLSASLLAGLVATTVCSPADVIKTRIMNGSGENKSA 242

Query: 245 LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
           +++L S++R EG  FMFRGWLPSF RLGP T+LIF  +EQL+K+++GM + 
Sbjct: 243 MQILVSAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKHKVGMKRE 293

>TPHA0B04130 Chr2 complement(975513..976463) [951 bp, 316 aa] {ON}
           Anc_1.123 YLR348C
          Length = 316

 Score =  384 bits (987), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 186/300 (62%), Positives = 229/300 (76%), Gaps = 21/300 (7%)

Query: 14  KYPWWYGGVGGIVACIITHPLDLAKVRLQTAA------RP------------KPTLFSMI 55
           KYPWWYGG GG+VA   THPLDL KVRLQTA       +P            KP +  M+
Sbjct: 4   KYPWWYGGCGGLVATFCTHPLDLTKVRLQTAPLGVDGRKPNMLRMMASVDGRKPNMLRMM 63

Query: 56  QRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMIS 115
             + +N+G +GLYSGL+A++LRQCTYTTARFGCYD +KE+++P ++LN+  YLLP SM+S
Sbjct: 64  ASVFRNEGLVGLYSGLSAAVLRQCTYTTARFGCYDLLKEHVIPQNQLNNIWYLLPSSMLS 123

Query: 116 GAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEE---GVRKLLTGLGP 172
           GAIGG VGNPADVVNIRMQND++     RRNY+NA+DG+ RI   E   GVR+L  G  P
Sbjct: 124 GAIGGLVGNPADVVNIRMQNDTSLPVAKRRNYRNALDGLYRIVLVEQNGGVRRLYAGWQP 183

Query: 173 NLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKT 232
           NL+RGVLMTASQVV+YD+ K+ LV+T     SEKKTHFTASL+AGLVATT+CSPADV+KT
Sbjct: 184 NLMRGVLMTASQVVTYDLFKNYLVSTLHMAPSEKKTHFTASLMAGLVATTVCSPADVMKT 243

Query: 233 RIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGM 292
           RIMN+H+HHE  L  L + IRNEG+GF+FRGW+PSF RL P T+LIFL VEQL+K+ +GM
Sbjct: 244 RIMNSHKHHEPVLASLLAEIRNEGIGFIFRGWVPSFVRLAPFTVLIFLTVEQLKKHRVGM 303

>TBLA0A05800 Chr1 (1434309..1435223) [915 bp, 304 aa] {ON} Anc_1.123
           YLR348C
          Length = 304

 Score =  377 bits (967), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 181/285 (63%), Positives = 224/285 (78%), Gaps = 5/285 (1%)

Query: 13  VKYPWWYGGVGGIVACIITHPLDLAKVRLQTA-ARPKPTLFSMIQRILKNDGPLGLYSGL 71
           +KYPWWYGGVGG+VAC+ THPLDLAKVRLQT+   P+P L SMI +I+ +DG L LY+GL
Sbjct: 16  IKYPWWYGGVGGMVACVTTHPLDLAKVRLQTSHIHPRPNLISMIGKIVAHDGFLTLYNGL 75

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNI 131
           +A++LRQCTYTT+RFGCY  IKENL+P+    +T YLLP SM+SGAIGG VGNP+D+VNI
Sbjct: 76  SAAMLRQCTYTTSRFGCYAIIKENLIPSKHQTNTSYLLPASMVSGAIGGLVGNPSDIVNI 135

Query: 132 RMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
           RMQND      LRR YKN  +G+ RI ++EG++ L  G  PNL+RGVLMT+SQVV+YDV 
Sbjct: 136 RMQNDRTLPQELRRGYKNCFEGLFRIVRDEGMKALFIGWKPNLIRGVLMTSSQVVTYDVF 195

Query: 192 KHNLVT-TFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH---HESTLKV 247
           K+ LV+     +  +K THFTASL+AGLVATTICSPADV+KTRIMNAH+     +S  ++
Sbjct: 196 KNYLVSGPAKLNPKKKTTHFTASLLAGLVATTICSPADVMKTRIMNAHKSEGAEKSATRI 255

Query: 248 LSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGM 292
           L  +I+ EG  FMFRGWLPSF RLGP TI+IFL VEQL+KY +GM
Sbjct: 256 LLDAIKKEGPTFMFRGWLPSFVRLGPFTIIIFLTVEQLKKYRVGM 300

>CAGL0G01166g Chr7 complement(111298..112185) [888 bp, 295 aa] {ON}
           highly similar to uniprot|Q06143 Saccharomyces
           cerevisiae YLR348c DIC1
          Length = 295

 Score =  375 bits (962), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 178/292 (60%), Positives = 222/292 (76%), Gaps = 5/292 (1%)

Query: 9   SNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLY 68
           S   VKYPWWYGG  GI A + THPLDL KVRLQ A  PKPT+  M++ ILKN+G +GLY
Sbjct: 2   SEKQVKYPWWYGGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLY 61

Query: 69  SGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADV 128
           +GL+AS+LRQCTYTTARFG YD +KE+++P DKL +  YLL  SM+SGA+GG  GN AD+
Sbjct: 62  AGLSASLLRQCTYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNFADL 121

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKL-LTGLGPNLVRGVLMTASQVVS 187
           +NIRMQNDSA     RRNYKNAIDG+ +I+K EG + L LTG  PN+VRGVLMTASQVV+
Sbjct: 122 INIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVT 181

Query: 188 YDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQ----HHES 243
           YD+ K+ LVT +  D  +  TH T+SL+AG VATT+CSPADVIKT +MNAH+    +H+S
Sbjct: 182 YDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVMNAHKKPGHNHDS 241

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
           + K+L  +I  EG  FMFRGW+PSF RL P T+LIF  +EQL+KY +GM + 
Sbjct: 242 SFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAMEQLKKYRVGMPKE 293

>KAFR0A06340 Chr1 (1278830..1279726) [897 bp, 298 aa] {ON} Anc_1.123
           YLR348C
          Length = 298

 Score =  361 bits (926), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 176/287 (61%), Positives = 218/287 (75%), Gaps = 6/287 (2%)

Query: 9   SNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLY 68
           S+  + YPWWYGG GGI A + THPLDLAKVRLQ A  PKPT+  MI +I++ND  LGLY
Sbjct: 14  SSQKITYPWWYGGAGGIFATVCTHPLDLAKVRLQAAPYPKPTIPGMISQIIRNDSFLGLY 73

Query: 69  SGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADV 128
           +GL+ASILRQCTYTTAR G Y+FIKEN+LP D +N   YLL  S++SGA+GG  GN ADV
Sbjct: 74  AGLSASILRQCTYTTARLGLYNFIKENVLPNDSMN---YLLLASIVSGAVGGLFGNFADV 130

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFK-EEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           VNIRMQNDSA   +LRRNYKN  DG+ +I K E G++    G  PN++RG+LMT+SQ V+
Sbjct: 131 VNIRMQNDSALPSNLRRNYKNVFDGIYKIVKYENGLKACFIGWKPNVLRGILMTSSQAVT 190

Query: 188 YDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQ--HHESTL 245
           YD  K  LV +F F  +   THF +SL AGLVATT+ SP DVIKT+IMNA +  H ++T 
Sbjct: 191 YDSTKLKLVNSFHFSDNSHWTHFLSSLFAGLVATTVSSPVDVIKTKIMNALEDSHGKNTF 250

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGM 292
           K+LS +IR EG  F+FRGWLPSF RLGP+T+LIFL +EQL+K++IGM
Sbjct: 251 KILSQAIRQEGPSFLFRGWLPSFTRLGPHTMLIFLTMEQLKKHKIGM 297

>KLLA0B12826g Chr2 (1121106..1122065) [960 bp, 319 aa] {ON} similar
           to uniprot|P32332 Saccharomyces cerevisiae YKL120W OAC1
           Mitochondrial inner membrane transporter transports
           oxaloacetate sulfate and thiosulfate member of the
           mitochondrial carrier family
          Length = 319

 Score =  118 bits (296), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 140/294 (47%), Gaps = 22/294 (7%)

Query: 23  GGIVACI---ITHPLDLAKVRLQ-------TAARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           GG+ ACI   +T+P D  K R+Q        AA+           I KN+G  GL  GL 
Sbjct: 27  GGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQKGLA 86

Query: 73  ASILRQCTYTTARFGCYDFIKENL-------LPADKLNSTLYLLPCSMISGAIGGFVGNP 125
           ++ L Q     +R G Y+ I+  L       + + K+      +     SG +G F+G+P
Sbjct: 87  SAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFIGSP 146

Query: 126 ADVVNIRMQNDSAHEPHL--RRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTAS 183
             +V  RMQ+ S +  H+  + +Y +A +G+  IF+ EG++ L  G+   ++R  + +A 
Sbjct: 147 LFLVKTRMQSYS-NAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGSAV 205

Query: 184 QVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH-HE 242
           Q+  Y++CK N +            H  +S +AG       +P DV+ TR+ N   + + 
Sbjct: 206 QLPIYNICK-NFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMNPWDVVLTRVYNQKGNLYS 264

Query: 243 STLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQHF 296
             +     ++RNEGL  +++G+     R+GP+T+L    +EQ  K    +   F
Sbjct: 265 GPIDCFIKTVRNEGLSALYKGFGAQILRIGPHTVLCLTFMEQTLKLVYSVESRF 318

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 76/167 (45%), Gaps = 17/167 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP--------KPTLFSMIQRILKNDGPLGLYSGL 71
           G   G+V   I  PL L K R+Q+ +            + F+ +  I +++G  GL+ G+
Sbjct: 133 GATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGV 192

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLN--STLYLLPCSMISGAIGGFVGNPADVV 129
            A++LR    +  +   Y+  K  LL  D +N  + L+LL  S I+G   G   NP DVV
Sbjct: 193 DAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLL-SSTIAGFGVGVAMNPWDVV 251

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
             R+ N   +       Y   ID   +  + EG+  L  G G  ++R
Sbjct: 252 LTRVYNQKGNL------YSGPIDCFIKTVRNEGLSALYKGFGAQILR 292

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 15/87 (17%)

Query: 192 KHNLVTTFGFDASEKKTHFTASLVAGL---VATTICSPADVIKTRIMNAHQHHESTLKVL 248
           KHN  T     A+ K + F + +  GL   +A T+ +P D +KTR+    + H +  KV 
Sbjct: 8   KHNQKT-----AAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVY 62

Query: 249 SSSI-------RNEGLGFMFRGWLPSF 268
           ++ I       +NEG+  + +G   ++
Sbjct: 63  TNPIQAFGVIFKNEGIAGLQKGLASAY 89

>KAFR0D03070 Chr4 (606943..607908) [966 bp, 321 aa] {ON} Anc_2.451
           YKL120W
          Length = 321

 Score =  118 bits (296), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 84/293 (28%), Positives = 140/293 (47%), Gaps = 32/293 (10%)

Query: 23  GGIVACI---ITHPLDLAKVRLQTAARPKPTL-----------FSMIQRILKNDGPLGLY 68
           GG+ ACI   +T+P+++ K RLQ        +               + I KN+G  GL 
Sbjct: 23  GGLAACIAVTVTNPIEMIKTRLQLQGELSSAVSAQANHIYRNPLQAFRVIFKNEGIRGLQ 82

Query: 69  SGLTASILRQCTYTTARFGCYDFIKENL-------LPADKLNSTLYLLPCSMISGAIGGF 121
            GL A+   Q     +R G Y+ I+++L       +   K+ +         ISGAIGG 
Sbjct: 83  KGLFAAYFYQIGLNGSRLGFYEPIRKSLNQFFYSSIEPHKVQNVTINATSGAISGAIGGV 142

Query: 122 VGNPADVVNIRMQNDS-----AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
           VG+P  +V  RMQ+ S       + H    Y     G+T IFKE G++ L  G+   ++R
Sbjct: 143 VGSPLYLVKTRMQSYSNIIKMGDQTH----YSGLWHGITAIFKENGIKGLFRGVDAAILR 198

Query: 177 GVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMN 236
             + +A+Q+ +Y+  K N              H  +S+VAG+V T I +P DV+ TRI N
Sbjct: 199 TSIGSAAQLPTYNATK-NFFIRNDIMRDGPGLHLASSMVAGIVVTIIMNPWDVVLTRIYN 257

Query: 237 AHQH-HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
              + ++  +  +  + + EG+  +++G+     R+ P+TI+    +EQ  K+
Sbjct: 258 QRDNRYKGPIDCMVKTAKVEGISALYKGFDAHLLRMAPHTIICLTAMEQTMKF 310

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 22  VGGIVACIITHPLDLAKVRL--QTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           V GIV  II +P D+   R+  Q   R K  +  M+ +  K +G   LY G  A +LR  
Sbjct: 236 VAGIVVTIIMNPWDVVLTRIYNQRDNRYKGPIDCMV-KTAKVEGISALYKGFDAHLLRMA 294

Query: 80  TYT 82
            +T
Sbjct: 295 PHT 297

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 12/77 (15%)

Query: 210 FTASLVAGLVATTICSPADVIKTRIM-----------NAHQHHESTLKVLSSSIRNEGLG 258
           FTA  +A  +A T+ +P ++IKTR+             A+  + + L+      +NEG+ 
Sbjct: 20  FTAGGLAACIAVTVTNPIEMIKTRLQLQGELSSAVSAQANHIYRNPLQAFRVIFKNEGIR 79

Query: 259 FMFRGWLPS-FARLGPN 274
            + +G   + F ++G N
Sbjct: 80  GLQKGLFAAYFYQIGLN 96

>Suva_11.104 Chr11 (203826..204800) [975 bp, 324 aa] {ON} YKL120W
           (REAL)
          Length = 324

 Score =  110 bits (276), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 140/284 (49%), Gaps = 20/284 (7%)

Query: 23  GGIVACI---ITHPLDLAKVRLQ-------TAARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           GG+ ACI   +T+P++L K+R+Q       +AA+        +  I KN+G  GL  GL 
Sbjct: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLN 88

Query: 73  ASILRQCTYTTARFGCYDFIKENL----LPAD---KLNSTLYLLPCSMISGAIGGFVGNP 125
           A+ + Q     +R G Y+ I+ +L     P     K+ S    +     SG IG  VG+P
Sbjct: 89  AAYIYQIGLNGSRLGFYEPIRTSLNQLFFPGQEPHKVQSVGVNVVSGATSGIIGAVVGSP 148

Query: 126 ADVVNIRMQNDSAH-EPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
             +V  R+Q+ S   +   + +Y    +G+  IFK EGV+ L  G+   ++R    ++ Q
Sbjct: 149 LFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQ 208

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH-HES 243
           +  Y+  K  LV            H TAS ++GL    + +P DVI TRI N   + ++ 
Sbjct: 209 LPIYNTAKGFLVKN-DIMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGNLYKG 267

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
            +  L  +++ EG+  +++G++    R+ P+TI+    +EQ  K
Sbjct: 268 PIDCLVKTVKIEGVSALYKGFVAQVFRIAPHTIMCLTFMEQTMK 311

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 74/166 (44%), Gaps = 15/166 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAAR----PKPTLFSMIQR----ILKNDGPLGLYSGL 71
           G   GI+  ++  PL L K RLQ+ +      + T ++ +      I K +G  GL+ G+
Sbjct: 135 GATSGIIGAVVGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGI 194

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL-LPCSMISGAIGGFVGNPADVVN 130
            A+ILR    ++ +   Y+  K  L+  D +     L L  S ISG     V NP DV+ 
Sbjct: 195 DAAILRTGAGSSVQLPIYNTAKGFLVKNDIMKDGPALHLTASTISGLGVAVVMNPWDVIL 254

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
            R+ N   +       YK  ID + +  K EGV  L  G    + R
Sbjct: 255 TRIYNQKGNL------YKGPIDCLVKTVKIEGVSALYKGFVAQVFR 294

>Smik_11.118 Chr11 (202992..203966) [975 bp, 324 aa] {ON} YKL120W
           (REAL)
          Length = 324

 Score =  109 bits (273), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 139/284 (48%), Gaps = 20/284 (7%)

Query: 23  GGIVACI---ITHPLDLAKVRLQ-------TAARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           GG+ ACI   +T+P++L K+R+Q       TAA+        +  I KN+G  GL  GL 
Sbjct: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSATAAKVYKNPIQGMAVIFKNEGIKGLQKGLN 88

Query: 73  ASILRQCTYTTARFGCYDFIKENL----LPAD---KLNSTLYLLPCSMISGAIGGFVGNP 125
           A+ + Q     +R G Y+ I+ +L     P     K+ S    +     SG IG  +G+P
Sbjct: 89  AAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSP 148

Query: 126 ADVVNIRMQNDSAH-EPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
             +V  R+Q+ S   +   + +Y    +G+  IFK EGV+ L  G+   ++R    ++ Q
Sbjct: 149 LFLVKTRLQSYSEFIKIGEQTHYSGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQ 208

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH-HES 243
           +  Y+  K+ LV            H TAS ++GL    + +P DVI TRI N     ++ 
Sbjct: 209 LPIYNTAKNFLVKN-DLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKG 267

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
            +  L  +++ EG+  +++G+     R+ P+TI+    +EQ  K
Sbjct: 268 PIDCLVKTVKIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 80/194 (41%), Gaps = 22/194 (11%)

Query: 122 VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMT 181
           V NP +++ IRMQ          + YKN I G+  IFK EG++ L  GL    +  + + 
Sbjct: 39  VTNPIELIKIRMQLQGEMSATAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLN 98

Query: 182 ASQVVSYDVCKHNLVTTFGFDASEKKTHFT-----ASLVAGLVATTICSPADVIKTRI-- 234
            S++  Y+  + +L   F  D    K         +   +G++   I SP  ++KTR+  
Sbjct: 99  GSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQS 158

Query: 235 ------MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGP---------NTILIF 279
                 +    H+      L +  + EG+  +FRG   +  R G          NT   F
Sbjct: 159 YSEFIKIGEQTHYSGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNF 218

Query: 280 LVVEQLRKYEIGMH 293
           LV   L K    +H
Sbjct: 219 LVKNDLMKDGPALH 232

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 74/168 (44%), Gaps = 15/168 (8%)

Query: 18  WYGGVGGIVACIITHPLDLAKVRLQTAAR----PKPTLFSMIQR----ILKNDGPLGLYS 69
           + G   GI+  +I  PL L K RLQ+ +      + T +S +      I K +G  GL+ 
Sbjct: 133 FSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYSGVWNGLVTIFKTEGVKGLFR 192

Query: 70  GLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL-LPCSMISGAIGGFVGNPADV 128
           G+ A+ILR    ++ +   Y+  K  L+  D +     L L  S ISG     V NP DV
Sbjct: 193 GIDAAILRTGAGSSVQLPIYNTAKNFLVKNDLMKDGPALHLTASTISGLGVAVVMNPWDV 252

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
           +  R+ N           YK  ID + +  K EGV  L  G    + R
Sbjct: 253 ILTRIYNQKGDL------YKGPIDCLVKTVKIEGVTALYKGFAAQVFR 294

>YKL120W Chr11 (217344..218318) [975 bp, 324 aa] {ON}
           OAC1Mitochondrial inner membrane transporter, transports
           oxaloacetate, sulfate, thiosulfate, and isopropylmalate;
           member of the mitochondrial carrier family
          Length = 324

 Score =  109 bits (272), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 139/284 (48%), Gaps = 20/284 (7%)

Query: 23  GGIVACI---ITHPLDLAKVRLQ-------TAARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           GG+ ACI   +T+P++L K+R+Q       +AA+        +  I KN+G  GL  GL 
Sbjct: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLN 88

Query: 73  ASILRQCTYTTARFGCYDFIKENL----LPAD---KLNSTLYLLPCSMISGAIGGFVGNP 125
           A+ + Q     +R G Y+ I+ +L     P     K+ S    +     SG IG  +G+P
Sbjct: 89  AAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSP 148

Query: 126 ADVVNIRMQNDSAH-EPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
             +V  R+Q+ S   +   + +Y    +G+  IFK EGV+ L  G+   ++R    ++ Q
Sbjct: 149 LFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQ 208

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH-HES 243
           +  Y+  K+ LV            H TAS ++GL    + +P DVI TRI N     ++ 
Sbjct: 209 LPIYNTAKNILVKN-DLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKG 267

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
            +  L  ++R EG+  +++G+     R+ P+TI+    +EQ  K
Sbjct: 268 PIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 74/168 (44%), Gaps = 15/168 (8%)

Query: 18  WYGGVGGIVACIITHPLDLAKVRLQTAAR----PKPTLFSMIQR----ILKNDGPLGLYS 69
           + G   GI+  +I  PL L K RLQ+ +      + T ++ +      I K +G  GL+ 
Sbjct: 133 FSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFR 192

Query: 70  GLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL-LPCSMISGAIGGFVGNPADV 128
           G+ A+ILR    ++ +   Y+  K  L+  D +     L L  S ISG     V NP DV
Sbjct: 193 GIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDV 252

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
           +  R+ N           YK  ID + +  + EGV  L  G    + R
Sbjct: 253 ILTRIYNQKGDL------YKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294

>Skud_11.109 Chr11 (204082..205056) [975 bp, 324 aa] {ON} YKL120W
           (REAL)
          Length = 324

 Score =  108 bits (271), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 138/284 (48%), Gaps = 20/284 (7%)

Query: 23  GGIVACI---ITHPLDLAKVRLQ-------TAARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           GG+ ACI   +T+P++L K+R+Q       +AA+        +  I KN+G  GL  GL 
Sbjct: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLN 88

Query: 73  ASILRQCTYTTARFGCYDFIKENL----LPAD---KLNSTLYLLPCSMISGAIGGFVGNP 125
           A+ + Q     +R G Y+ I+ +L     P     K+ S    +     SG IG  VG+P
Sbjct: 89  AAYIYQIGLNGSRLGFYEPIRSSLNQLFFPGQESHKVQSVGVNVFSGAASGIIGAVVGSP 148

Query: 126 ADVVNIRMQNDSAH-EPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
             +V  R+Q+ S   +   + +Y    +G+  IFK EGV+ L  G+   ++R    ++ Q
Sbjct: 149 LFLVKTRLQSYSEFIKIGEQTHYSGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQ 208

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH-HES 243
           +  Y+  K  LV            H TAS ++GL    + +P DVI TRI N     ++ 
Sbjct: 209 LPIYNTAKSILVKN-DLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKG 267

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
            +  L  +++ EG+  +++G+     R+ P+TI+    +EQ  K
Sbjct: 268 PIDCLVKTVKIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 73/166 (43%), Gaps = 15/166 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAAR----PKPTLFSMIQR----ILKNDGPLGLYSGL 71
           G   GI+  ++  PL L K RLQ+ +      + T +S +      I K +G  GL+ G+
Sbjct: 135 GAASGIIGAVVGSPLFLVKTRLQSYSEFIKIGEQTHYSGVWNGLVTIFKTEGVKGLFRGI 194

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL-LPCSMISGAIGGFVGNPADVVN 130
            A+ILR    ++ +   Y+  K  L+  D +     L L  S ISG     V NP DV+ 
Sbjct: 195 DAAILRTGAGSSVQLPIYNTAKSILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVIL 254

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
            R+ N           YK  ID + +  K EGV  L  G    + R
Sbjct: 255 TRIYNQKGDL------YKGPIDCLVKTVKIEGVTALYKGFAAQVFR 294

>NDAI0K01460 Chr11 (332950..333921) [972 bp, 323 aa] {ON} Anc_2.451
          Length = 323

 Score =  108 bits (271), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 139/292 (47%), Gaps = 36/292 (12%)

Query: 23  GGIVACI---ITHPLDLAKVRLQTAARPKPTLFSMIQRI-----------LKNDGPLGLY 68
           GG+ ACI   +T+P++L K+R+Q        + ++ QRI            KN+G  GL 
Sbjct: 28  GGLAACIAVTVTNPIELVKIRMQLQGE----MSALTQRIYKNPIQGMGVIFKNEGIRGLQ 83

Query: 69  SGLTASILRQCTYTTARFGCYDFIKENL-------LPADKLNSTLYLLPCSMISGAIGGF 121
            GL A+ + Q     +R G Y+ I+  L       + + K+ +    +     SG IG  
Sbjct: 84  KGLVAAYIYQIGLNGSRLGFYEPIRSTLNSFFFPDVESHKVQNVGVNVVSGAASGIIGAV 143

Query: 122 VGNPADVVNIRMQNDS-----AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
           +G+P  +V  RMQ+ S       + H    Y    +G++ IFK EG++ L  G+   ++R
Sbjct: 144 IGSPLFLVKTRMQSYSDVIKIGEQTH----YTGVWNGLSTIFKNEGLKGLFRGIDAAILR 199

Query: 177 GVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMN 236
               ++ Q+  Y+  K+ LV            H TAS ++GL    + +P DVI TRI N
Sbjct: 200 TGAGSSVQLPIYNTAKNFLVKN-DIMKDGPALHLTASTISGLGVGVVMNPWDVILTRIYN 258

Query: 237 AHQH-HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
                ++  L  L  ++R EG+  +++G+     R+ P+TI+    +EQ  K
Sbjct: 259 QKGDLYKGPLDCLIKTVRIEGITALYKGFEAQLFRIAPHTIMCLTFMEQTMK 310

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 74/166 (44%), Gaps = 15/166 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILKNDGPLGLYSGL 71
           G   GI+  +I  PL L K R+Q+ +             +++ +  I KN+G  GL+ G+
Sbjct: 134 GAASGIIGAVIGSPLFLVKTRMQSYSDVIKIGEQTHYTGVWNGLSTIFKNEGLKGLFRGI 193

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL-LPCSMISGAIGGFVGNPADVVN 130
            A+ILR    ++ +   Y+  K  L+  D +     L L  S ISG   G V NP DV+ 
Sbjct: 194 DAAILRTGAGSSVQLPIYNTAKNFLVKNDIMKDGPALHLTASTISGLGVGVVMNPWDVIL 253

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
            R+ N           YK  +D + +  + EG+  L  G    L R
Sbjct: 254 TRIYNQKGDL------YKGPLDCLIKTVRIEGITALYKGFEAQLFR 293

>Kwal_26.7653 s26 complement(459583..460560) [978 bp, 325 aa] {ON}
           YKL120W (OAC1) - 1:1 [contig 55] FULL
          Length = 325

 Score =  108 bits (270), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 142/286 (49%), Gaps = 24/286 (8%)

Query: 23  GGIVACI---ITHPLDLAKVRLQ-------TAARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           GG+ ACI   +T+P++L K R+Q        A R        ++ I KN+G  GL  GL+
Sbjct: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLS 90

Query: 73  ASILRQCTYTTARFGCYDFIK----ENLLPA---DKLNSTLYLLPCSMISGAIGGFVGNP 125
            + + Q     +R G Y+ I+    +   PA    K+ +    +     SG IG  +G+P
Sbjct: 91  CAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSP 150

Query: 126 ADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
             ++  RMQ+ S A +   + +Y +  +G++ I++ EG + L  G+   ++R    ++ Q
Sbjct: 151 LFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQ 210

Query: 185 VVSYDVCKHNLVTTFGFDASEKKT--HFTASLVAGLVATTICSPADVIKTRIMNAHQH-H 241
           +  Y+  KH L+     D  ++ T  H  AS V+G     + +P DVI TR+ N   + +
Sbjct: 211 LPIYNTAKHFLLK---HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLY 267

Query: 242 ESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           +  L     ++R EG+G +++G+     R+ P+TIL    +EQ  K
Sbjct: 268 KGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMK 313

 Score = 64.3 bits (155), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 92/217 (42%), Gaps = 23/217 (10%)

Query: 99  ADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIF 158
           A K++ T   +   M +  I   V NP ++V  RMQ         +R YKN +  +  IF
Sbjct: 19  AQKVSKTGSFIAGGM-AACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIF 77

Query: 159 KEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLV--- 215
           K EG+R L  GL    +  + +  S++  Y+  +  L  TF       K    A  V   
Sbjct: 78  KNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSG 137

Query: 216 --AGLVATTICSPADVIKTRIM---NAHQ-----HHESTLKVLSSSIRNEGLGFMFRGWL 265
             +G++   + SP  +IKTR+    NA Q     H+ S    LSS  R EG   ++RG  
Sbjct: 138 ATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVD 197

Query: 266 PSFARLGP---------NTILIFLVVEQLRKYEIGMH 293
            +  R G          NT   FL+   L K   G+H
Sbjct: 198 AAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH 234

>SAKL0E03498g Chr5 complement(282321..283295) [975 bp, 324 aa] {ON}
           highly similar to uniprot|P32332 Saccharomyces
           cerevisiae YKL120W OAC1 Mitochondrial inner membrane
           transporter transports oxaloacetate sulfate and
           thiosulfate member of the mitochondrial carrier family
          Length = 324

 Score =  107 bits (267), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 141/286 (49%), Gaps = 24/286 (8%)

Query: 23  GGIVACI---ITHPLDLAKVRLQ-------TAARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           GG+ ACI   +T+P +L K R+Q       T  R     F  +  I KN+G  GL  GL 
Sbjct: 30  GGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQRGLV 89

Query: 73  ASILRQCTYTTARFGCYDFIK----ENLLPAD---KLNSTLYLLPCSMISGAIGGFVGNP 125
           ++ + Q     +R G Y+ I+    +   P     KL +    +     SG IG  VG+P
Sbjct: 90  SAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGAIVGSP 149

Query: 126 ADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
             +V  RMQ+ S A +   + +Y +  +G+  IFK+EGV  L  G+   ++R    ++ Q
Sbjct: 150 LFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGSSVQ 209

Query: 185 VVSYDVCKHNLVTTFGFDASEKKT--HFTASLVAGLVATTICSPADVIKTRIMNAHQH-H 241
           +  Y+  K+ L+     D  ++ T  H  +S V GL    + +P DV+ TR+ N   + +
Sbjct: 210 LPIYNTTKNFLLQN---DIMKEGTALHLLSSTVTGLGVGIVMNPWDVVLTRVYNQKGNTY 266

Query: 242 ESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           +  +  +  +I+ EG+G +++G+     R+ P+TIL    +EQ  K
Sbjct: 267 KGPIDCMFKTIKIEGIGALYKGFGAQLFRIAPHTILCLTFMEQTMK 312

 Score = 69.3 bits (168), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 79/167 (47%), Gaps = 17/167 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP--------KPTLFSMIQRILKNDGPLGLYSGL 71
           G   GI+  I+  PL L K R+Q+ +            ++ + +  I K +G LGL+ G+
Sbjct: 136 GATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGV 195

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPAD--KLNSTLYLLPCSMISGAIGGFVGNPADVV 129
            A+ILR    ++ +   Y+  K  LL  D  K  + L+LL  S ++G   G V NP DVV
Sbjct: 196 DAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHLL-SSTVTGLGVGIVMNPWDVV 254

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
             R+ N   +       YK  ID + +  K EG+  L  G G  L R
Sbjct: 255 LTRVYNQKGN------TYKGPIDCMFKTIKIEGIGALYKGFGAQLFR 295

 Score = 57.8 bits (138), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 83/194 (42%), Gaps = 22/194 (11%)

Query: 122 VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMT 181
           V NP ++V  RMQ         +R Y+N    +  IFK EGV+ L  GL    V  + + 
Sbjct: 40  VTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLN 99

Query: 182 ASQVVSYDVCKHNLVTTFGFDASEKK-----THFTASLVAGLVATTICSPADVIKTRI-- 234
            S++  Y+  +  L  TF  ++   K      + TA   +G++   + SP  ++KTR+  
Sbjct: 100 GSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQS 159

Query: 235 ------MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGP---------NTILIF 279
                 +    H+ S    L++  + EG+  +FRG   +  R G          NT   F
Sbjct: 160 YSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNF 219

Query: 280 LVVEQLRKYEIGMH 293
           L+   + K    +H
Sbjct: 220 LLQNDIMKEGTALH 233

>NCAS0A04410 Chr1 (891313..892284) [972 bp, 323 aa] {ON} Anc_2.451
          Length = 323

 Score =  106 bits (264), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 140/290 (48%), Gaps = 32/290 (11%)

Query: 23  GGIVACI---ITHPLDLAKVRLQT----AARPKPTLFSMIQR---ILKNDGPLGLYSGLT 72
           GG+ ACI    T+P++L K+R+Q     AA  +    + IQ    I +N+G  GL  GL 
Sbjct: 28  GGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQKGLV 87

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL-------------LPCSMISGAIG 119
           A+ + Q     +R G Y+ I+      + LNST Y              +     SG IG
Sbjct: 88  AAYIYQIGLNGSRLGFYEPIR------NALNSTFYPNEESHKIQKVSINVAAGASSGIIG 141

Query: 120 GFVGNPADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGV 178
             +G+P  +V  RMQ+ S A +   + +Y+N  +G++ I + EG + L  G+   ++R  
Sbjct: 142 AVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTG 201

Query: 179 LMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAH 238
             ++ Q+  Y+  K N +            H TAS ++GL    + +P DVI TRI N  
Sbjct: 202 AGSSVQLPIYNTAK-NFLLKNDLMKDGPGLHLTASTISGLGVAVVMNPWDVILTRIYNQK 260

Query: 239 QH-HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
            + ++  +     ++R EG+  +++G+     R+ P+TI+    +EQ  K
Sbjct: 261 GNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIICLTFMEQTMK 310

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 90/208 (43%), Gaps = 26/208 (12%)

Query: 112 SMISGAIGGFVG----NPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
           S I+G +   +     NP ++V IRMQ         ++ Y+N I G+  IF+ EG+R L 
Sbjct: 24  SFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQ 83

Query: 168 TGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH-----FTASLVAGLVATT 222
            GL    +  + +  S++  Y+  ++ L +TF  +    K         A   +G++   
Sbjct: 84  KGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGIIGAV 143

Query: 223 ICSPADVIKTRI--------MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGP- 273
           I SP  ++KTR+        +    H+ +    LS+  R EG   +FRG   +  R G  
Sbjct: 144 IGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAG 203

Query: 274 --------NTILIFLVVEQLRKYEIGMH 293
                   NT   FL+   L K   G+H
Sbjct: 204 SSVQLPIYNTAKNFLLKNDLMKDGPGLH 231

>Kpol_1018.165 s1018 (425354..426322) [969 bp, 322 aa] {ON}
           (425354..426322) [969 nt, 323 aa]
          Length = 322

 Score =  104 bits (259), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 138/284 (48%), Gaps = 20/284 (7%)

Query: 23  GGIVACI---ITHPLDLAKVRLQT----AARPKPTLFSMIQR---ILKNDGPLGLYSGLT 72
           GGI ACI    T+P++L K+R+Q     AA  +    + IQ    I +N+G + L  GL 
Sbjct: 27  GGIAACIAVTFTNPIELVKIRMQLQGELAAVGEGIYKNPIQGVGVIFRNEGIMALQKGLN 86

Query: 73  ASILRQCTYTTARFGCYDFIK----ENLLPAD---KLNSTLYLLPCSMISGAIGGFVGNP 125
           A+ + Q     +R G Y+ I+      L P     K  S    +     SG IG  +G+P
Sbjct: 87  AAYIYQIALNGSRLGFYEPIRTASNRALFPGQDPHKKQSVAVNVFSGASSGIIGAVIGSP 146

Query: 126 ADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
             +V  R+Q+ S A +   + +Y+   DG+  I++ EG+R L  G+   ++R    ++ Q
Sbjct: 147 LFLVKTRLQSYSEAFKIGEQTHYRGVWDGLKTIYRSEGIRGLYRGIDAAILRTGAGSSVQ 206

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH-HES 243
           +  Y+  K+ L+            H TAS ++G+    + +P DVI TRI N     ++ 
Sbjct: 207 LPIYNTAKNFLLKNR-LMKDGPLLHLTASTISGMGVAVVMNPWDVILTRIYNQKGDLYKG 265

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
            +     ++R EG+  +++G+     R+ P+TIL    +EQ  K
Sbjct: 266 PIDCFIKTVRIEGVSALYKGFEAQIFRIAPHTILCLTFMEQTMK 309

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 74/167 (44%), Gaps = 17/167 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILKNDGPLGLYSGL 71
           G   GI+  +I  PL L K RLQ+ +             ++  ++ I +++G  GLY G+
Sbjct: 133 GASSGIIGAVIGSPLFLVKTRLQSYSEAFKIGEQTHYRGVWDGLKTIYRSEGIRGLYRGI 192

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKL--NSTLYLLPCSMISGAIGGFVGNPADVV 129
            A+ILR    ++ +   Y+  K N L  ++L  +  L  L  S ISG     V NP DV+
Sbjct: 193 DAAILRTGAGSSVQLPIYNTAK-NFLLKNRLMKDGPLLHLTASTISGMGVAVVMNPWDVI 251

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
             R+ N           YK  ID   +  + EGV  L  G    + R
Sbjct: 252 LTRIYNQKGDL------YKGPIDCFIKTVRIEGVSALYKGFEAQIFR 292

>Kpol_1072.34 s1072 complement(76799..77704) [906 bp, 301 aa] {ON}
           complement(76799..77704) [906 nt, 302 aa]
          Length = 301

 Score =  103 bits (258), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 140/310 (45%), Gaps = 34/310 (10%)

Query: 9   SNAVVKYPWWY----GGVGGIVACIITHPLDLAKVRLQTAA-RPKPT----------LFS 53
           SN  V  P+ Y    G V GI   ++ +PLD+ K R+Q    +P  T          +  
Sbjct: 2   SNKEVDLPFVYKFIAGAVAGISEILVMYPLDVVKTRMQLQVNKPSATGTTAVVQYNGVVD 61

Query: 54  MIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLP---ADKLNSTLYLLP 110
            I +I+KN+G   LY G+++ IL +      +F C DF     +      KL   L +L 
Sbjct: 62  CISKIVKNEGFSRLYKGISSPILMEAPKRATKFACNDFFSSYYMKQFQEKKLTQNLSILS 121

Query: 111 CSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGL 170
            +  +G +  FV  P ++V IR+Q+       +  +YK  ID V +I + EG+  +  GL
Sbjct: 122 GAS-AGLVESFVVVPFELVKIRLQD-------VNSSYKGPIDVVAKIIRNEGLFAMYNGL 173

Query: 171 GPNLVR-GVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADV 229
              + R GV       V + V   NL+          +    A  + G V + + +P DV
Sbjct: 174 EATMWRHGVWNAGYFGVIFQV--RNLLPKPKSKNQSIRNDLIAGTIGGTVGSLLNTPFDV 231

Query: 230 IKTRIMNAH-----QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQ 284
           +K+RI N       + +  +L  + +  + EG   +++G++P   RLGP   ++ +V   
Sbjct: 232 VKSRIQNTKVTDTVKKYNWSLPSILTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTG 291

Query: 285 LRKYEIGMHQ 294
           +  +   MHQ
Sbjct: 292 VMDFFKKMHQ 301

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 7/79 (8%)

Query: 5   KSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQ------TAARPKPTLFSMIQRI 58
           K +S N  ++     G +GG V  ++  P D+ K R+Q      T  +   +L S++  I
Sbjct: 200 KPKSKNQSIRNDLIAGTIGGTVGSLLNTPFDVVKSRIQNTKVTDTVKKYNWSLPSILT-I 258

Query: 59  LKNDGPLGLYSGLTASILR 77
            K +G   LY G    +LR
Sbjct: 259 YKEEGFRALYKGFVPKVLR 277

>TDEL0A02270 Chr1 (412289..413257) [969 bp, 322 aa] {ON} Anc_2.451
           YKL120W
          Length = 322

 Score =  103 bits (257), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 140/290 (48%), Gaps = 32/290 (11%)

Query: 23  GGIVACI---ITHPLDLAKVRLQTAARPKPTLFSMIQR-----------ILKNDGPLGLY 68
           GG+ ACI   +T+P++L K+R+Q        L S +QR           I KN+G  GL 
Sbjct: 28  GGLAACIAVTVTNPIELVKIRMQLQGE----LSSSLQRTYKNPVQGMGVIFKNEGIRGLQ 83

Query: 69  SGLTASILRQCTYTTARFGCYD----FIKENLLPAD---KLNSTLYLLPCSMISGAIGGF 121
            GL A+ + Q     +R G Y+     + +   P +   K+ +    +     SG IG  
Sbjct: 84  KGLVAAYIYQICLNGSRLGFYEPLRGVMNKTFYPEEEPHKVQNVTINVVSGAASGIIGAV 143

Query: 122 VGNPADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180
           +G+P  +V  R+Q+ S   +   + +Y    +G+  IF++EG   L  G+   ++R    
Sbjct: 144 LGSPLFLVKTRLQSYSDVVKIGEQTHYTGVWNGLKTIFQKEGFMGLYRGVDAAILRTGAG 203

Query: 181 TASQVVSYDVCKHNLVTTFGFDASEKKT--HFTASLVAGLVATTICSPADVIKTRIMNAH 238
           ++ Q+  Y+  KH L+     D  +  T  H TAS ++GL    + +P DVI TRI N  
Sbjct: 204 SSVQLPIYNTAKHFLLN---HDIMKDGTGLHLTASTISGLGVAVVMNPWDVILTRIYNQK 260

Query: 239 QH-HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
              ++  L     ++R EG+  +++G+     R+ P+TI+   ++EQ  K
Sbjct: 261 GDLYKGPLDCFIKTVRIEGVSALYKGFEAQVFRIAPHTIICLTMMEQTMK 310

 Score = 63.9 bits (154), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 82/194 (42%), Gaps = 22/194 (11%)

Query: 122 VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMT 181
           V NP ++V IRMQ        L+R YKN + G+  IFK EG+R L  GL    +  + + 
Sbjct: 38  VTNPIELVKIRMQLQGELSSSLQRTYKNPVQGMGVIFKNEGIRGLQKGLVAAYIYQICLN 97

Query: 182 ASQVVSYDVCKHNLVTTFGFDASEKKTH-----FTASLVAGLVATTICSPADVIKTRI-- 234
            S++  Y+  +  +  TF  +    K         +   +G++   + SP  ++KTR+  
Sbjct: 98  GSRLGFYEPLRGVMNKTFYPEEEPHKVQNVTINVVSGAASGIIGAVLGSPLFLVKTRLQS 157

Query: 235 ------MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGP---------NTILIF 279
                 +    H+      L +  + EG   ++RG   +  R G          NT   F
Sbjct: 158 YSDVVKIGEQTHYTGVWNGLKTIFQKEGFMGLYRGVDAAILRTGAGSSVQLPIYNTAKHF 217

Query: 280 LVVEQLRKYEIGMH 293
           L+   + K   G+H
Sbjct: 218 LLNHDIMKDGTGLH 231

 Score = 57.8 bits (138), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 74/166 (44%), Gaps = 15/166 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILKNDGPLGLYSGL 71
           G   GI+  ++  PL L K RLQ+ +             +++ ++ I + +G +GLY G+
Sbjct: 134 GAASGIIGAVLGSPLFLVKTRLQSYSDVVKIGEQTHYTGVWNGLKTIFQKEGFMGLYRGV 193

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKL-NSTLYLLPCSMISGAIGGFVGNPADVVN 130
            A+ILR    ++ +   Y+  K  LL  D + + T   L  S ISG     V NP DV+ 
Sbjct: 194 DAAILRTGAGSSVQLPIYNTAKHFLLNHDIMKDGTGLHLTASTISGLGVAVVMNPWDVIL 253

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
            R+ N           YK  +D   +  + EGV  L  G    + R
Sbjct: 254 TRIYNQKGDL------YKGPLDCFIKTVRIEGVSALYKGFEAQVFR 293

>CAGL0K11616g Chr11 complement(1122663..1123625) [963 bp, 320 aa]
           {ON} highly similar to uniprot|P32332 Saccharomyces
           cerevisiae YKL120w
          Length = 320

 Score =  103 bits (257), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 140/286 (48%), Gaps = 24/286 (8%)

Query: 23  GGIVACI---ITHPLDLAKVRLQTAA-------RPKPTLFSMIQRILKNDGPLGLYSGLT 72
           GG+ ACI   +T+P+++ K+R+Q          R     F  +  + +N+G  GL  GL 
Sbjct: 25  GGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLV 84

Query: 73  ASILRQCTYTTARFGCYDFIK----ENLLP---ADKLNSTLYLLPCSMISGAIGGFVGNP 125
           A+ + Q     +R G Y+ I+    +   P   + K+ S    +     SG IG  +G+P
Sbjct: 85  AAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSP 144

Query: 126 ADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
             +V  R+Q+ S A +   + +Y    +G+  I+  EGV+ L  G+   ++R    ++ Q
Sbjct: 145 LFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQ 204

Query: 185 VVSYDVCKHNLVTTFGFDASEK--KTHFTASLVAGLVATTICSPADVIKTRIMNAHQH-H 241
           +  Y+  K+ L+     D  E     H TAS ++GL    + +P DVI TRI N     +
Sbjct: 205 LPIYNTAKNFLLRN---DIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLY 261

Query: 242 ESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           +  +  L  +++ EG+  +++G+     R+GP+TIL    +EQ  K
Sbjct: 262 KGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMK 307

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 72/166 (43%), Gaps = 15/166 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILKNDGPLGLYSGL 71
           G   GI+  ++  PL L K RLQ+ +             +++ ++ I   +G  GL+ G+
Sbjct: 131 GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGI 190

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL-LPCSMISGAIGGFVGNPADVVN 130
            A+ILR    ++ +   Y+  K  LL  D +     L L  S ISG     V NP DV+ 
Sbjct: 191 DAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVIL 250

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
            R+ N           YK  ID + +  K EG+  L  G    + R
Sbjct: 251 TRIYNQKGDL------YKGPIDCLVKTVKIEGITALYKGFEAQVFR 290

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 210 FTASLVAGLVATTICSPADVIKTR------IMNAHQH-HESTLKVLSSSIRNEGLGFMFR 262
           FTA  +A  +A T+ +P +V+K R      +M A+Q  + +  + +    RNEG+  + +
Sbjct: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81

Query: 263 GWLPSF 268
           G + ++
Sbjct: 82  GLVAAY 87

>TPHA0G02510 Chr7 (519304..520269) [966 bp, 321 aa] {ON} Anc_2.451
           YKL120W
          Length = 321

 Score =  102 bits (254), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 134/284 (47%), Gaps = 20/284 (7%)

Query: 23  GGIVACI---ITHPLDLAKVRLQTAARPKPT-------LFSMIQRILKNDGPLGLYSGLT 72
           GG+ ACI    T+P+++ K+R+Q                F  I  + +N+G + L  GL 
Sbjct: 26  GGLAACIAVTFTNPIEVIKIRMQLQGELASVGQGIYKNPFQGIGVVFRNEGFMALQKGLN 85

Query: 73  ASILRQCTYTTARFGCYDFIK----ENLLPA--DKLNSTLYL-LPCSMISGAIGGFVGNP 125
           A+ + Q     +R G Y+ I+    +   P     L   + + +     SG IG  +G+P
Sbjct: 86  AAYIYQIALNGSRLGFYEPIRYALNKTFFPGVDSHLKQNVAVNVAAGATSGIIGAVIGSP 145

Query: 126 ADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
             +V  R+Q+ S A +   +  Y    +G+  I+K EG R L  G+   ++R    ++ Q
Sbjct: 146 LFLVKTRLQSYSEAFKVGEQTRYTGVWNGLKAIYKTEGFRGLYRGVDAAILRTGAGSSVQ 205

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAH-QHHES 243
           +  Y+  K  L+ +          H TAS ++GL    + +P DVI TRI N     ++ 
Sbjct: 206 LPIYNTTKSVLIKS-DLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQRGNKYKG 264

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
            +  L  +++ EGL  +++G+     R+GP+TI+    +EQ  K
Sbjct: 265 PIDCLVKTVKIEGLSALYKGFEAQVFRIGPHTIMCLTFMEQTMK 308

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 76/166 (45%), Gaps = 15/166 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILKNDGPLGLYSGL 71
           G   GI+  +I  PL L K RLQ+ +             +++ ++ I K +G  GLY G+
Sbjct: 132 GATSGIIGAVIGSPLFLVKTRLQSYSEAFKVGEQTRYTGVWNGLKAIYKTEGFRGLYRGV 191

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL-LPCSMISGAIGGFVGNPADVVN 130
            A+ILR    ++ +   Y+  K  L+ +D +     L L  S ISG     V NP DV+ 
Sbjct: 192 DAAILRTGAGSSVQLPIYNTTKSVLIKSDLMKDGPALHLTASTISGLGVAVVMNPWDVIL 251

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
            R+ N   ++      YK  ID + +  K EG+  L  G    + R
Sbjct: 252 TRIYNQRGNK------YKGPIDCLVKTVKIEGLSALYKGFEAQVFR 291

>KLTH0D04928g Chr4 complement(447820..448797) [978 bp, 325 aa] {ON}
           highly similar to uniprot|P32332 Saccharomyces
           cerevisiae YKL120W OAC1 Mitochondrial inner membrane
           transporter transports oxaloacetate sulfate and
           thiosulfate member of the mitochondrial carrier family
          Length = 325

 Score =  100 bits (249), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 146/293 (49%), Gaps = 36/293 (12%)

Query: 23  GGIVACI---ITHPLDLAKVRLQ-------TAARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           GG+ ACI   +T+P++L K R+Q        + R     +  ++ I KN+G  GL  GL+
Sbjct: 31  GGLAACIAVTVTNPIELVKTRMQLQGEMSAESQRIYKNPWQSLKIIFKNEGIRGLQKGLS 90

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL---------LPCSMISGA----IG 119
            + + Q     +R G Y+ I+        LN T Y          +  +++SGA    IG
Sbjct: 91  CAYIYQIGLNGSRLGFYEPIR------SLLNKTFYPNQDPHKVQNVAVNVVSGASSGIIG 144

Query: 120 GFVGNPADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGV 178
             +G+P  ++  RMQ  S A +   + +Y +  +G++ I++ EG++ L  G+   ++R  
Sbjct: 145 AIMGSPLFLIKTRMQAYSNAIQIGQQTHYTSIWNGLSSIYRAEGLKGLYRGVDAAILRTG 204

Query: 179 LMTASQVVSYDVCKHNLVTTFGFDASEKKT--HFTASLVAGLVATTICSPADVIKTRIMN 236
             ++ Q+  Y+  K  L+     D  ++ T  H  AS ++G+    + +P DVI TR+ N
Sbjct: 205 AGSSVQLPIYNTAKRFLLN---HDIMKEGTGLHLVASTLSGIGVGVVMNPWDVILTRVYN 261

Query: 237 AHQH-HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
              + ++  +  L  ++R EG+  +++G+     R+ P+TIL    +EQ  K+
Sbjct: 262 QKGNLYKGPIDCLIKTVRIEGVSALYKGFEAQLFRIAPHTILCLTFMEQTMKF 314

 Score = 63.9 bits (154), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 93/221 (42%), Gaps = 26/221 (11%)

Query: 99  ADKLNSTLYLLPCSMISGAIGGFVG----NPADVVNIRMQNDSAHEPHLRRNYKNAIDGV 154
           ADK  +       S I+G +   +     NP ++V  RMQ         +R YKN    +
Sbjct: 14  ADKPAAQKVTKTGSFIAGGLAACIAVTVTNPIELVKTRMQLQGEMSAESQRIYKNPWQSL 73

Query: 155 TRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASL 214
             IFK EG+R L  GL    +  + +  S++  Y+  +  L  TF  +    K    A  
Sbjct: 74  KIIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSLLNKTFYPNQDPHKVQNVAVN 133

Query: 215 V-----AGLVATTICSPADVIKTRIM---NAHQ-----HHESTLKVLSSSIRNEGLGFMF 261
           V     +G++   + SP  +IKTR+    NA Q     H+ S    LSS  R EGL  ++
Sbjct: 134 VVSGASSGIIGAIMGSPLFLIKTRMQAYSNAIQIGQQTHYTSIWNGLSSIYRAEGLKGLY 193

Query: 262 RGWLPSFARLGP---------NTILIFLVVEQLRKYEIGMH 293
           RG   +  R G          NT   FL+   + K   G+H
Sbjct: 194 RGVDAAILRTGAGSSVQLPIYNTAKRFLLNHDIMKEGTGLH 234

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 74/166 (44%), Gaps = 15/166 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP--------KPTLFSMIQRILKNDGPLGLYSGL 71
           G   GI+  I+  PL L K R+Q  +            ++++ +  I + +G  GLY G+
Sbjct: 137 GASSGIIGAIMGSPLFLIKTRMQAYSNAIQIGQQTHYTSIWNGLSSIYRAEGLKGLYRGV 196

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL-LPCSMISGAIGGFVGNPADVVN 130
            A+ILR    ++ +   Y+  K  LL  D +     L L  S +SG   G V NP DV+ 
Sbjct: 197 DAAILRTGAGSSVQLPIYNTAKRFLLNHDIMKEGTGLHLVASTLSGIGVGVVMNPWDVIL 256

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
            R+ N   +       YK  ID + +  + EGV  L  G    L R
Sbjct: 257 TRVYNQKGNL------YKGPIDCLIKTVRIEGVSALYKGFEAQLFR 296

>ZYRO0G02640g Chr7 (205008..205985) [978 bp, 325 aa] {ON} similar to
           uniprot|P32332 Saccharomyces cerevisiae YKL120W OAC1
           Mitochondrial inner membrane transporter transports
           oxaloacetate sulfate and thiosulfate member of the
           mitochondrial carrier family
          Length = 325

 Score = 99.4 bits (246), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 133/281 (47%), Gaps = 17/281 (6%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQR-------ILKNDGPLGLYSGLT 72
           GG+   VA  +T+P++L K R+Q       T   + +        I +N+G + L  GL 
Sbjct: 32  GGLAACVAVTVTNPIELVKTRMQLQGEMSATNQQVYKNPIQAMVIIFRNEGFVSLQKGLL 91

Query: 73  ASILRQCTYTTARFGCYD----FIKENLLPAD---KLNSTLYLLPCSMISGAIGGFVGNP 125
           A+ + Q     +R G Y+    F+ +   P +   K+ +    + C   +G  G  +G+P
Sbjct: 92  AAYVYQIALNGSRLGLYEPSRGFVNKIFYPDEEPHKVQNPAINVFCGAAAGVFGAVLGSP 151

Query: 126 ADVVNIRMQNDSAHEPHLRRNYKNAI-DGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
             +V  R+Q+ S+      +   N + DG+  +++ EG++ L  G+   ++R  + +A Q
Sbjct: 152 LYMVKTRLQSYSSTVSIGEQTRYNGVWDGLKTVYRGEGIKGLFRGIEAAMLRTGVGSAVQ 211

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH-HES 243
           +  Y+V K   +            H TAS VAG+      +P DVI TRI N     ++ 
Sbjct: 212 LPIYNVVK-GFIKDNDLMREGTSLHLTASTVAGIGVGIAMNPWDVILTRIYNQKGDLYKG 270

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQ 284
            +     +++ EG G +++G+     R+ P+TIL   ++E+
Sbjct: 271 PIDCFIKTVKIEGPGALYKGFQAQLFRIAPHTILCLTMMEK 311

>KNAG0A06360 Chr1 (970774..971742) [969 bp, 322 aa] {ON} Anc_2.451
           YKL120W
          Length = 322

 Score = 99.0 bits (245), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 140/287 (48%), Gaps = 24/287 (8%)

Query: 23  GGIVAC---IITHPLDLAKVRLQT----AARPKPTLFSMIQRI---LKNDGPLGLYSGLT 72
           GGI AC    +T+P++L K+R+Q     AA  +    + IQ I    KN+G      GL 
Sbjct: 27  GGIAACCAVTVTNPIELVKIRMQLQGELAAVGQGIYKNPIQGISVIYKNEGFKACQKGLV 86

Query: 73  ASILRQCTYTTARFGCYDFIKENL----LPAD---KLNSTLYLLPCSMISGAIGGFVGNP 125
           ++   Q     +R G Y+ I+  L     PA    K+ +    +     SG IG  +G+P
Sbjct: 87  SAYFYQIALNGSRLGFYEPIRLTLNRTFFPAQESHKVQNVGINMFSGASSGVIGAIIGSP 146

Query: 126 ADVVNIRMQN-DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
             +V  RMQ+  S+     +  Y    +G++ IF+E GVR L  G+   ++R    ++ Q
Sbjct: 147 LFLVKTRMQSYSSSIALGDQTKYTGVWNGLSTIFREGGVRGLFKGVDAAILRTGAGSSVQ 206

Query: 185 VVSYDVCKHNLVTTFGFDASEK--KTHFTASLVAGLVATTICSPADVIKTRIMNAHQH-H 241
           +  Y+  K+ L+     D  E     H TAS ++G+    + +P DVI TRI N   + +
Sbjct: 207 LPIYNTAKNILLRN---DLMENGPALHLTASTISGMGVAVVMNPWDVILTRIYNQKTNKY 263

Query: 242 ESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
           +  +  L  +++ EG+  +++G+     R+ P+TI+   ++EQ   +
Sbjct: 264 KGPIDCLVKTVKIEGITALYKGFEAQVFRIAPHTIICLTLLEQTMNF 310

>KLLA0D07073g Chr4 (606857..607750) [894 bp, 297 aa] {ON} similar to
           uniprot|Q03028 Saccharomyces cerevisiae YPL134C ODC1
           Mitochondrial inner membrane transporter exports
           2-oxoadipate and 2-oxoglutarate from the mitochondrial
           matrix to the cytosol for use in lysine and glutamate
           biosynthesis and in lysine catabolism
          Length = 297

 Score = 95.9 bits (237), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 142/300 (47%), Gaps = 33/300 (11%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAK--VRLQTAARPKPT---LFSMIQRILKNDGPLGLYS 69
           Y +  G V G+   ++ +PLD+ K  ++LQ +    P    +F  +++I   +GP  LY 
Sbjct: 11  YQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYK 70

Query: 70  GLTASILRQCTYTTARFGCYDF---IKENLLPADKLNSTLYLLPCSMISGAIGG----FV 122
           G+++ IL +      +F C D    I ++L  A+KL       P S++SGA  G    FV
Sbjct: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ-----PLSILSGASAGICESFV 125

Query: 123 GNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR-GVLMT 181
             P ++V IR+Q+ S+        + + I  V  I ++EG+  +  GL   + R G+   
Sbjct: 126 VVPFELVKIRLQDVSS-------KFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNA 178

Query: 182 ASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAH--- 238
               + + V    L+      + + +    A  V G +++ + +P DV+K+R+ N     
Sbjct: 179 GYFGIIFQV--RALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP 236

Query: 239 ---QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
              + +  +   L++  + EG   +++G++P   RLGP   ++ +V   +  +   +H+ 
Sbjct: 237 GVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTVHEK 296

>Ecym_4494 Chr4 complement(994947..996131) [1185 bp, 394 aa] {ON}
           similar to Ashbya gossypii ADL009W
          Length = 394

 Score = 97.1 bits (240), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 132/283 (46%), Gaps = 17/283 (6%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ-----TAARPKPTLFSMIQRILKNDGPLGLYSGLTAS 74
           G + G ++ II  PLD+AK RLQ     + +R    +   + RI+K++   GLY GL   
Sbjct: 105 GALAGFISGIIVCPLDVAKTRLQAQGLLSNSRYYSGILGTLSRIVKDESYRGLYKGLVPI 164

Query: 75  ILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ 134
           +L         F  Y+  K+   PA  +N  +     ++ +GAI   + NP  VV  R+ 
Sbjct: 165 VLGYFPTWMIYFSIYERCKKRY-PAVFMNDFMANSASALTAGAITTALTNPIWVVKTRLM 223

Query: 135 NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCK-- 192
             S ++ +    Y   +D   ++++ EG++   +GL P+L  G+   A     Y+  K  
Sbjct: 224 IQS-NKKYFSVYYNGTLDAFRKMYRLEGLKVFYSGLVPSLF-GLFHVAIHFPVYEQLKCW 281

Query: 193 --HNLVTTFGFDASEKKTHF----TASLVAGLVATTICSPADVIKTRI-MNAHQHHESTL 245
             +N  TT   D      H      AS ++ +VA+TI  P ++++TR+ + A   H   L
Sbjct: 282 LHYNAPTTGDLDQLGHNLHLGRLIVASCISKMVASTITYPHEILRTRMQIRATGLHSGVL 341

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
            ++S    NEG    + G+  + AR  P + +  +  E  RKY
Sbjct: 342 SMISKLYVNEGFIGFYSGFTTNIARTLPTSAVTLVSFEYFRKY 384

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 79/184 (42%), Gaps = 18/184 (9%)

Query: 114 ISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTG 169
           +SGA+ GF+      P DV   R+Q          R Y   +  ++RI K+E  R L  G
Sbjct: 103 LSGALAGFISGIIVCPLDVAKTRLQAQGLLSNS--RYYSGILGTLSRIVKDESYRGLYKG 160

Query: 170 LGPNLVRGVLMTASQVVS-YDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPAD 228
           L P +V G   T     S Y+ CK      F  D         ++L AG + T + +P  
Sbjct: 161 LVP-IVLGYFPTWMIYFSIYERCKKRYPAVFMNDFMANS---ASALTAGAITTALTNPIW 216

Query: 229 VIKTRIMNAHQ------HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVV 282
           V+KTR+M          ++  TL       R EGL   + G +PS   L  +  + F V 
Sbjct: 217 VVKTRLMIQSNKKYFSVYYNGTLDAFRKMYRLEGLKVFYSGLVPSLFGLF-HVAIHFPVY 275

Query: 283 EQLR 286
           EQL+
Sbjct: 276 EQLK 279

>SAKL0H07326g Chr8 complement(639197..640090) [894 bp, 297 aa] {ON}
           similar to uniprot|Q99297 Saccharomyces cerevisiae
           YOR222W ODC2 Mitochondrial inner membrane transporter
           exports 2-oxoadipate and 2-oxoglutarate from the
           mitochondrial matrix to the cytosol for use in lysine
           and glutamate biosynthesis and in lysine catabolism
          Length = 297

 Score = 95.1 bits (235), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 133/286 (46%), Gaps = 33/286 (11%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVR--LQTAARPKPT---LFSMIQRILKNDGPLGLYS 69
           Y +  G V GI   ++ +PLD+ K R  LQ A    P    +   +++I+  +G   LY 
Sbjct: 11  YQFAAGAVAGISEILVMYPLDVVKTRMQLQVAGGSGPQYSGVVDCLKQIVAKEGASRLYK 70

Query: 70  GLTASILRQCTYTTARFGCYDF---IKENLLPADKLNSTLYLLPCSMISGAIGG----FV 122
           G+++ +L +      +F C D    I ++L   +KL       P S++SGA  G    FV
Sbjct: 71  GISSPVLMEAPKRATKFACNDEFQKIYKDLFGVEKLTQ-----PLSILSGASAGCVEAFV 125

Query: 123 GNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR-GVLMT 181
             P ++V IR+Q+ S+       +YK  +D V +I  +EG   L  GL   L R GV   
Sbjct: 126 VVPFELVKIRLQDVSS-------SYKGPVDVVRQIIAKEGTLALYNGLESTLWRHGVWNA 178

Query: 182 ASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAH--- 238
               + + V   +L+      A + +    A  + G + + + +P DV+K+RI N     
Sbjct: 179 GYFGIIFQV--RSLLPKAQSKAQQTRNDLIAGTIGGTIGSMMSTPFDVVKSRIQNTAVVA 236

Query: 239 ---QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
              + +  +   L    + EG   +++G++P   RLGP   ++ +V
Sbjct: 237 GTVRKYNWSWPSLFVINKEEGFKALYKGFVPKVLRLGPGGGILLVV 282

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 71/176 (40%), Gaps = 6/176 (3%)

Query: 115 SGAIGG----FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGL 170
           +GA+ G     V  P DVV  RMQ   A        Y   +D + +I  +EG  +L  G+
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVAGGSG--PQYSGVVDCLKQIVAKEGASRLYKGI 72

Query: 171 GPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVI 230
              ++      A++    D  +      FG +   +     +   AG V   +  P +++
Sbjct: 73  SSPVLMEAPKRATKFACNDEFQKIYKDLFGVEKLTQPLSILSGASAGCVEAFVVVPFELV 132

Query: 231 KTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
           K R+ +    ++  + V+   I  EG   ++ G   +  R G      F ++ Q+R
Sbjct: 133 KIRLQDVSSSYKGPVDVVRQIIAKEGTLALYNGLESTLWRHGVWNAGYFGIIFQVR 188

>ZYRO0G17578g Chr7 (1454173..1455123) [951 bp, 316 aa] {ON} highly
           similar to uniprot|P33303 Saccharomyces cerevisiae
           YJR095W SFC1 Mitochondrial succinate-fumarate
           transporter transports succinate into and fumarate out
           of the mitochondrion required for ethanol and acetate
           utilization
          Length = 316

 Score = 95.1 bits (235), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 118/282 (41%), Gaps = 13/282 (4%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ----TAARPKPTLFSMIQRILKNDGPLGLYSGLTASI 75
           GG  G+   +  HPLD  KVR+Q    TA    P        I  N+G + LY GL A +
Sbjct: 16  GGTAGLFEALCCHPLDTIKVRMQIYRRTATFKPPGFLKTGVSIFSNEGFIALYRGLGAVV 75

Query: 76  LRQCTYTTARFGCYDFIKENLLPADKLN-STLYLLPCSMISGAIGG-FVGNPADVVNIRM 133
           +        RF  Y++ +  L   +    ST       + +G      V NP +VV IR+
Sbjct: 76  IGIIPKMAIRFSSYEYYRGLLANRETGRVSTANTFIAGLGAGVTEAVMVVNPMEVVKIRL 135

Query: 134 QND--SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
           Q+      +P+    Y+NA+     I KEEG+  L  G+     R      +   +Y   
Sbjct: 136 QSQHLKPQDPNTPAKYRNAVQACYTIVKEEGLPALYRGVSLTAARQATNQGANFTAYSKM 195

Query: 192 KHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH-HESTLKVLSS 250
           +  L    G D           LV+G +     +P D IKTR+     +  +S  K +S 
Sbjct: 196 REALQRWHGSDTVPNWQTSCIGLVSGAIGPFFNAPLDTIKTRLQKEGGNVSKSGWKRISE 255

Query: 251 S----IRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
                IR EG+  +++G  P   R+ P   + F V E +R++
Sbjct: 256 IGVQLIREEGVRALYKGITPRVMRVAPGQAVTFTVYEFVRRH 297

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 95/197 (48%), Gaps = 13/197 (6%)

Query: 21  GVGGIVACIITHPLDLAKVRLQTA-ARPK----PTLF-SMIQ---RILKNDGPLGLYSGL 71
           G G   A ++ +P+++ K+RLQ+   +P+    P  + + +Q    I+K +G   LY G+
Sbjct: 115 GAGVTEAVMVVNPMEVVKIRLQSQHLKPQDPNTPAKYRNAVQACYTIVKEEGLPALYRGV 174

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTL-YLLPC-SMISGAIGGFVGNPADVV 129
           + +  RQ T   A F  Y  ++E L      ++   +   C  ++SGAIG F   P D +
Sbjct: 175 SLTAARQATNQGANFTAYSKMREALQRWHGSDTVPNWQTSCIGLVSGAIGPFFNAPLDTI 234

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
             R+Q +  +    +  +K   +   ++ +EEGVR L  G+ P ++R     A     Y+
Sbjct: 235 KTRLQKEGGNVS--KSGWKRISEIGVQLIREEGVRALYKGITPRVMRVAPGQAVTFTVYE 292

Query: 190 VCKHNLVTTFGFDASEK 206
             + +L  +  F  SEK
Sbjct: 293 FVRRHLEGSGIFKKSEK 309

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 5/82 (6%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQT-AARPKPTLFSMIQRI----LKNDGPLGLYSGLTAS 74
           G V G +      PLD  K RLQ        + +  I  I    ++ +G   LY G+T  
Sbjct: 217 GLVSGAIGPFFNAPLDTIKTRLQKEGGNVSKSGWKRISEIGVQLIREEGVRALYKGITPR 276

Query: 75  ILRQCTYTTARFGCYDFIKENL 96
           ++R        F  Y+F++ +L
Sbjct: 277 VMRVAPGQAVTFTVYEFVRRHL 298

>SAKL0F14234g Chr6 (1140131..1141090) [960 bp, 319 aa] {ON} highly
           similar to uniprot|P33303 Saccharomyces cerevisiae
           YJR095W SFC1 Mitochondrial succinate-fumarate
           transporter transports succinate into and fumarate out
           of the mitochondrion required for ethanol and acetate
           utilization
          Length = 319

 Score = 93.6 bits (231), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 88/306 (28%), Positives = 126/306 (41%), Gaps = 30/306 (9%)

Query: 4   TKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARP-----KPTLFSMIQR- 57
           +K +SSN  V      GG  G+   +  HPLD  KVR+Q   R      KP  F    R 
Sbjct: 3   SKKKSSNPAVN--LIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRN 60

Query: 58  ILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGA 117
           I   +G L LY GL A ++        RF  Y+F +  L  ADK   ++     + ++G 
Sbjct: 61  IYTEEGLLALYKGLGAVVIGIIPKMAIRFSSYEFYRSAL--ADKQTGSVST-GNTFLAGV 117

Query: 118 IGG-----FVGNPADVVNIRMQNDSAH-EPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
             G      V NP +VV IR+Q    H E      Y+NA+     I KEEG+  L  G+ 
Sbjct: 118 GAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVS 177

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIK 231
               R      +    Y   K  L      DA          L++G +     +P D IK
Sbjct: 178 LTAARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIK 237

Query: 232 TRIMNAHQHHESTLKVLSSS---------IRNEGLGFMFRGWLPSFARLGPNTILIFLVV 282
           TR+    Q  +ST  +   S         I+ EG   +++G  P   R+ P   + F V 
Sbjct: 238 TRL----QKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVY 293

Query: 283 EQLRKY 288
           E +R++
Sbjct: 294 EFVREH 299

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 15/93 (16%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILKNDG 63
           P W     G + G +      PLD  K RLQ   + K T        + ++ ++++K +G
Sbjct: 211 PSWETSCIGLISGAIGPFSNAPLDTIKTRLQ---KDKSTANMSGWSRIVTIGKQLIKEEG 267

Query: 64  PLGLYSGLTASILRQCTYTTARFGCYDFIKENL 96
              LY G+T  ++R        F  Y+F++E+L
Sbjct: 268 FRALYKGITPRVMRVAPGQAVTFTVYEFVREHL 300

>YEL006W Chr5 (144327..145334) [1008 bp, 335 aa] {ON}  YEA6Putative
           mitochondrial NAD+ transporter, member of the
           mitochondrial carrier subfamily (see also YIA6); has
           putative human ortholog
          Length = 335

 Score = 93.6 bits (231), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 132/296 (44%), Gaps = 38/296 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILKNDGPLGLYSGL 71
           G + G ++ ++  P D+AK RLQ       T         F     I K++G  GLY GL
Sbjct: 45  GALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGL 104

Query: 72  TASILRQCTYTTARFGCYDFIKE---NLLPADKLNSTLYLLPCSMISGAIGGFVGNPADV 128
             ++L         F  YDF ++   ++ P     S       ++ +GAI     NP  V
Sbjct: 105 QPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSN---ASSAITAGAISTVATNPIWV 161

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY 188
           V  R+   +    +   +YK  ID   +I ++EG + L  GL P L+ G+L  A Q   Y
Sbjct: 162 VKTRLMLQTGIGKY-STHYKGTIDTFRKIIQQEGAKALYAGLVPALL-GMLNVAIQFPLY 219

Query: 189 DVCKHNLVTTFGF-DASEKKTHFT---------ASLVAGLVATTICSPADVIKTRIM--- 235
           +    NL   FG+ ++++  T  T         AS+++ +VA+T+  P ++++TR+    
Sbjct: 220 E----NLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKS 275

Query: 236 ---NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
              N  Q H   L ++  + R EG    + G+  +  R  P  ++  +  E  +KY
Sbjct: 276 DLPNTVQRH--LLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKKY 329

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 87/191 (45%), Gaps = 18/191 (9%)

Query: 23  GGIVACIITHPLDLAKVRL--QTAARPKPTLF----SMIQRILKNDGPLGLYSGLTASIL 76
            G ++ + T+P+ + K RL  QT      T +       ++I++ +G   LY+GL  ++L
Sbjct: 148 AGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL 207

Query: 77  RQCTYTTARFGCYDFIK------ENLLPADKLNSTLY--LLPCSMISGAIGGFVGNPADV 128
                   +F  Y+ +K      E+   +  + S+ +  L+  SM+S  +   V  P ++
Sbjct: 208 GMLN-VAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEI 266

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY 188
           +  RMQ  S     ++R+    +  +   +++EG     +G   NLVR V      +VS+
Sbjct: 267 LRTRMQLKSDLPNTVQRHL---LPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSF 323

Query: 189 DVCKHNLVTTF 199
           +  K  L T F
Sbjct: 324 EYSKKYLTTFF 334

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 46/102 (45%), Gaps = 9/102 (8%)

Query: 202 DASEKKTHFTASLVAGLVATTICSPADVIKTRIM--------NAHQHHESTLKVLSSSIR 253
           +A  +    + +L   L A  +C P DV KTR+         +  QH++      ++  +
Sbjct: 35  NADPRVAAISGALSGALSAMLVC-PFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFK 93

Query: 254 NEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
           +EG   +++G  P+     P  ++ F V +  RKY + +  H
Sbjct: 94  DEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPH 135

>Ecym_5393 Chr5 (798418..799308) [891 bp, 296 aa] {ON} similar to
           Ashbya gossypii AER366W
          Length = 296

 Score = 92.4 bits (228), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 132/289 (45%), Gaps = 32/289 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAAR--PKPTLFSMIQRILKNDGPL-GLYSGLTASIL 76
           G   G++A II+HPLDL KVRLQ + R  P+ T   ++  +L+N   +  +Y GL  S+L
Sbjct: 15  GLSAGLLATIISHPLDLVKVRLQLSVRHTPRVTYSQVLNDMLRNTYWVREIYRGLGISLL 74

Query: 77  RQCTYTTARFGCYDFIKENL--------------LPADKLNSTLYLLPCSMISGAIGGFV 122
                    FG Y F K+                L   KL++ +Y L  +  SG     +
Sbjct: 75  GNSLAWAIYFGLYRFAKDVAISNVSVSSSASDSELKDRKLSAPVY-LAAAGFSGTFTALL 133

Query: 123 GNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTA 182
            NP  V+  R+ + +   P     YK+ IDG +++  EEG+     GL P+L  GV   A
Sbjct: 134 TNPIWVIKTRIMSTTTSGP-----YKSTIDGASKLLCEEGILAFWKGLLPSLF-GVSQGA 187

Query: 183 SQVVSYDVCKHNLVTTFGFDASEKKTH----FTASLVAGLVATTICSPADVIKTRIMNAH 238
                YD  K   + +  +D  E+K       T S ++ +++ +   P  ++K+ + +  
Sbjct: 188 IYFTVYDTLKFQYLHS-SYDKHERKLSALELITVSCISKMISLSAVYPLQLLKSNLQDFK 246

Query: 239 QHHESTLKVLSSSI-RNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
               S +  L S I + EG+   ++G   +  R  P + + F V E ++
Sbjct: 247 A--TSDIMTLGSLIYQKEGIAGFYKGVFANLLRSIPASCITFFVYENVK 293

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 77/186 (41%), Gaps = 22/186 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ--TAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
            G  G    ++T+P+ + K R+   T + P  +      ++L  +G L  + GL  S+  
Sbjct: 123 AGFSGTFTALLTNPIWVIKTRIMSTTTSGPYKSTIDGASKLLCEEGILAFWKGLLPSLF- 181

Query: 78  QCTYTTARFGCYDFIKENLLPA-----DKLNSTLYLLPCSMISGAIGGFVGNPADVVNIR 132
             +     F  YD +K   L +     ++  S L L+  S IS  I      P  ++   
Sbjct: 182 GVSQGAIYFTVYDTLKFQYLHSSYDKHERKLSALELITVSCISKMISLSAVYPLQLLKSN 241

Query: 133 MQNDSAHEPHLRRNYKNAIDGVTR---IFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
           +Q+           +K   D +T    I+++EG+     G+  NL+R +  +      Y+
Sbjct: 242 LQD-----------FKATSDIMTLGSLIYQKEGIAGFYKGVFANLLRSIPASCITFFVYE 290

Query: 190 VCKHNL 195
             KH++
Sbjct: 291 NVKHSI 296

>Smik_5.107 Chr5 (148354..149370) [1017 bp, 338 aa] {ON} YEL006W
           (REAL)
          Length = 338

 Score = 93.2 bits (230), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 129/291 (44%), Gaps = 28/291 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILKNDGPLGLYSGL 71
           G + G ++ ++  P D+AK RLQ       +         F     I K++G  GLY GL
Sbjct: 45  GALSGALSAMLVCPFDVAKTRLQAQGLQNMSHQSQHYTGFFGTFATIFKDEGAAGLYKGL 104

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCS--MISGAIGGFVGNPADVV 129
             ++L         F  YDF ++     D    +L+L   S  + +GAI     NP  VV
Sbjct: 105 QPTVLGYIPTLMIYFSVYDFCRK--YSVDIFPHSLFLSNASSAITAGAISTIATNPIWVV 162

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
             R+   +    +   +YK  ID   +I ++EG++ L  GL P L+ G+L  A Q   Y+
Sbjct: 163 KTRLMLQTGIGEY-STHYKGTIDTFKKIVQQEGIKALYAGLVPALL-GMLNVAVQFPLYE 220

Query: 190 VCKHNLVTTFGFDASEKKTH------FTASLVAGLVATTICSPADVIKTRIM------NA 237
             K     +   D S   T         AS+++ +VA+T+  P ++++TR+       N 
Sbjct: 221 NLKIRFKYSESTDLSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSDLPNT 280

Query: 238 HQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
            Q H   L ++  + + EG    + G+  +  R  P+ ++  +  E  +KY
Sbjct: 281 VQRH--LLPLIKITYKQEGFAGFYSGFATNLVRTVPSAVVTLVSFEYSKKY 329

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 83/191 (43%), Gaps = 18/191 (9%)

Query: 23  GGIVACIITHPLDLAKVRL--QTAARPKPTLF----SMIQRILKNDGPLGLYSGLTASIL 76
            G ++ I T+P+ + K RL  QT      T +       ++I++ +G   LY+GL  ++L
Sbjct: 148 AGAISTIATNPIWVVKTRLMLQTGIGEYSTHYKGTIDTFKKIVQQEGIKALYAGLVPALL 207

Query: 77  RQCTYTTARFGCYDFIKENL-------LPADKLNSTLY-LLPCSMISGAIGGFVGNPADV 128
                   +F  Y+ +K          L  D  +S    L+  SM+S  +   V  P ++
Sbjct: 208 GMLN-VAVQFPLYENLKIRFKYSESTDLSTDVTSSNFQKLILASMLSKMVASTVTYPHEI 266

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY 188
           +  RMQ  S     ++R+    +  +   +K+EG     +G   NLVR V      +VS+
Sbjct: 267 LRTRMQLKSDLPNTVQRHL---LPLIKITYKQEGFAGFYSGFATNLVRTVPSAVVTLVSF 323

Query: 189 DVCKHNLVTTF 199
           +  K  L   F
Sbjct: 324 EYSKKYLAAFF 334

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 45/102 (44%), Gaps = 9/102 (8%)

Query: 202 DASEKKTHFTASLVAGLVATTICSPADVIKTRIM--------NAHQHHESTLKVLSSSIR 253
           +A  +    + +L   L A  +C P DV KTR+         +  QH+       ++  +
Sbjct: 35  NADPRIAAISGALSGALSAMLVC-PFDVAKTRLQAQGLQNMSHQSQHYTGFFGTFATIFK 93

Query: 254 NEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
           +EG   +++G  P+     P  ++ F V +  RKY + +  H
Sbjct: 94  DEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPH 135

>Skud_5.94 Chr5 (140978..141991) [1014 bp, 337 aa] {ON} YEL006W
           (REAL)
          Length = 337

 Score = 92.8 bits (229), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 131/292 (44%), Gaps = 30/292 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTA--------ARPKPTLFSMIQRILKNDGPLGLYSGL 71
           G + G ++ ++  P D+AK RLQ          ++     F     I K++G  GLY GL
Sbjct: 45  GALSGALSAMLVCPFDVAKTRLQAQGLQNMSHQSQHYKGFFGTFATIFKDEGAAGLYKGL 104

Query: 72  TASILRQCTYTTARFGCYDFIKE---NLLPADKLNSTLYLLPCSMISGAIGGFVGNPADV 128
             ++L         F  YDF ++   ++ P     S       ++ +GAI     NP  V
Sbjct: 105 QPTVLGYIPTLMIYFSIYDFSRKYSVDIFPHSPFLSN---ASSAITAGAISTVATNPIWV 161

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY 188
           V  R+   +    +   +YK  ID   +I ++EGV+ L  GL P L+ G+L  A Q   Y
Sbjct: 162 VKTRLMLQTGIGEY-STHYKGTIDTFKKIIQQEGVKALYAGLVPALL-GMLNVAIQFPLY 219

Query: 189 DVCKHNLVTTFGFDASEKKTH------FTASLVAGLVATTICSPADVIKTRIM------N 236
           +  K  L  +   D S   T         AS+++ +VA+T+  P ++++TR+       +
Sbjct: 220 ENLKIRLKYSESTDLSTDVTSSNFQRLILASMLSKMVASTVTYPHEILRTRMQLKSDLPD 279

Query: 237 AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
           A Q H   L ++  + + EG    + G+  +  R  P+ ++  +  E  +KY
Sbjct: 280 AVQRH--LLPLIKITYKQEGFAGFYSGFATNLVRTVPSAVVTLVSFEYSKKY 329

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 84/191 (43%), Gaps = 18/191 (9%)

Query: 23  GGIVACIITHPLDLAKVRL--QTAARPKPTLF----SMIQRILKNDGPLGLYSGLTASIL 76
            G ++ + T+P+ + K RL  QT      T +       ++I++ +G   LY+GL  ++L
Sbjct: 148 AGAISTVATNPIWVVKTRLMLQTGIGEYSTHYKGTIDTFKKIIQQEGVKALYAGLVPALL 207

Query: 77  RQCTYTTARFGCYDFIKENL-------LPADKLNSTLY-LLPCSMISGAIGGFVGNPADV 128
                   +F  Y+ +K  L       L  D  +S    L+  SM+S  +   V  P ++
Sbjct: 208 GMLN-VAIQFPLYENLKIRLKYSESTDLSTDVTSSNFQRLILASMLSKMVASTVTYPHEI 266

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY 188
           +  RMQ  S     ++R+    +  +   +K+EG     +G   NLVR V      +VS+
Sbjct: 267 LRTRMQLKSDLPDAVQRHL---LPLIKITYKQEGFAGFYSGFATNLVRTVPSAVVTLVSF 323

Query: 189 DVCKHNLVTTF 199
           +  K  L   F
Sbjct: 324 EYSKKYLSAFF 334

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 43/92 (46%), Gaps = 8/92 (8%)

Query: 212 ASLVAGLVATTICSPADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRG 263
           A  ++G ++  +  P DV KTR+         +  QH++      ++  ++EG   +++G
Sbjct: 44  AGALSGALSAMLVCPFDVAKTRLQAQGLQNMSHQSQHYKGFFGTFATIFKDEGAAGLYKG 103

Query: 264 WLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
             P+     P  ++ F + +  RKY + +  H
Sbjct: 104 LQPTVLGYIPTLMIYFSIYDFSRKYSVDIFPH 135

>YJR095W Chr10 (609773..610741) [969 bp, 322 aa] {ON}
           SFC1Mitochondrial succinate-fumarate transporter,
           transports succinate into and fumarate out of the
           mitochondrion; required for ethanol and acetate
           utilization
          Length = 322

 Score = 92.4 bits (228), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 118/290 (40%), Gaps = 24/290 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP------KPTLFSMIQR-ILKNDGPLGLYSGLT 72
           GG  G+   +  HPLD  KVR+Q   R       KP  F    R I + +G L LY GL 
Sbjct: 17  GGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLG 76

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNPAD 127
           A ++        RF  Y+F +  L+  +   S +     + ++G   G      V NP +
Sbjct: 77  AVVIGIIPKMAIRFSSYEFYRTLLVNKE---SGIVSTGNTFVAGVGAGITEAVLVVNPME 133

Query: 128 VVNIRMQND--SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQV 185
           VV IR+Q    +  EP+    Y NAI     I KEEGV  L  G+     R      +  
Sbjct: 134 VVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANF 193

Query: 186 VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI-------MNAH 238
             Y   K  L      D           L++G +     +P D IKTR+       +   
Sbjct: 194 TVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQ 253

Query: 239 QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
              +  + + +  ++ EG   +++G  P   R+ P   + F V E +R++
Sbjct: 254 SGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREH 303

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 80/183 (43%), Gaps = 15/183 (8%)

Query: 124 NPADVVNIRMQ--NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMT 181
           +P D + +RMQ     A   H++      I     I+++EG   L  GLG  ++  +   
Sbjct: 29  HPLDTIKVRMQIYRRVAGIEHVKP--PGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKM 86

Query: 182 ASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLV-ATTICSPADVIKTRIM----- 235
           A +  SY+  +  LV       S   T F A + AG+  A  + +P +V+K R+      
Sbjct: 87  AIRFSSYEFYRTLLVNKESGIVSTGNT-FVAGVGAGITEAVLVVNPMEVVKIRLQAQHLT 145

Query: 236 ----NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIG 291
               NA   + + +    + ++ EG+  ++RG   + AR   N    F V  +L+++   
Sbjct: 146 PSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQN 205

Query: 292 MHQ 294
            HQ
Sbjct: 206 YHQ 208

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 11/92 (11%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRI-------LKNDGP 64
           P W     G + G +      PLD  K RLQ          S +++I       LK +G 
Sbjct: 213 PSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGF 272

Query: 65  LGLYSGLTASILRQCTYTTARFGCYDFIKENL 96
             LY G+T  ++R        F  Y++++E+L
Sbjct: 273 RALYKGITPRVMRVAPGQAVTFTVYEYVREHL 304

>KLTH0D10472g Chr4 (863427..864317) [891 bp, 296 aa] {ON} similar to
           uniprot|Q99297 Saccharomyces cerevisiae YOR222W ODC2
           Mitochondrial inner membrane transporter exports
           2-oxoadipate and 2-oxoglutarate from the mitochondrial
           matrix to the cytosol for use in lysine and glutamate
           biosynthesis and in lysine catabolism
          Length = 296

 Score = 91.7 bits (226), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 134/287 (46%), Gaps = 35/287 (12%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVR--LQTAARPKPT---LFSMIQRILKNDGPLGLYS 69
           Y +  G V GI   ++ +PLD+ K R  LQ A    P    + + +++I+  +G   LY 
Sbjct: 11  YQFAAGAVAGISEILVMYPLDVVKTRMQLQVAGGVGPQYNGVVNCLKQIVAKEGASRLYK 70

Query: 70  GLTASILRQCTYTTARFGCYDF---IKENLLPADKLNSTLYLLPCSMISGAIGG----FV 122
           G+++ +L +      +F C D    I +     +KL  +L     S++SGA  G    FV
Sbjct: 71  GISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL-----SILSGASAGCCEAFV 125

Query: 123 GNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR-GVLMT 181
             P ++V IR+Q+ S+        Y   +D V RI  +EGV  +  GL   L R GV   
Sbjct: 126 VVPFELVKIRLQDVSS-------KYNGPVDVVKRIIAQEGVLAMYNGLESTLWRHGVWNA 178

Query: 182 ASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMN----- 236
               + + V   +L+      + +      A  + G + + + +P DV+K+R+ N     
Sbjct: 179 GYFGIIFQV--RSLLPQAQSKSQQTGNDLIAGTIGGTIGSLMSTPFDVVKSRVQNTAVVA 236

Query: 237 --AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
             A +++ S   +  +  R EG   +++G++P   RLGP   ++ +V
Sbjct: 237 GQARKYNWSWPSIF-TIYREEGFSALYKGFVPKVLRLGPGGGILLVV 282

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 71/176 (40%), Gaps = 6/176 (3%)

Query: 115 SGAIGG----FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGL 170
           +GA+ G     V  P DVV  RMQ   A    +   Y   ++ + +I  +EG  +L  G+
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVAG--GVGPQYNGVVNCLKQIVAKEGASRLYKGI 72

Query: 171 GPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVI 230
              ++      A++    D  +      FG +   +     +   AG     +  P +++
Sbjct: 73  SSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELV 132

Query: 231 KTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
           K R+ +    +   + V+   I  EG+  M+ G   +  R G      F ++ Q+R
Sbjct: 133 KIRLQDVSSKYNGPVDVVKRIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVR 188

>Suva_5.80 Chr5 (119996..121009) [1014 bp, 337 aa] {ON} YEL006W
           (REAL)
          Length = 337

 Score = 92.0 bits (227), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 138/308 (44%), Gaps = 30/308 (9%)

Query: 4   TKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTA--------ARPKPTLFSMI 55
           T+S   N   +     G + G+++ I+  P D+AK RLQ          ++     F   
Sbjct: 29  TESPRKNVDPRVTAIAGALSGVLSGILVCPFDVAKTRLQAQGLQNISHQSQHYKGFFGTF 88

Query: 56  QRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKE---NLLPADKLNSTLYLLPCS 112
             I +++G  GLY GL  +IL         F  YDF ++   ++ P     S       +
Sbjct: 89  ATIFRDEGAAGLYKGLQPTILGYIPTLMIYFSVYDFSRKYSVDIFPHSPFLSNA---SSA 145

Query: 113 MISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGP 172
           + +GAI     NP  VV  R+   +    +   +YK  ID   +I ++EGV+ L  GL P
Sbjct: 146 ITAGAISTVATNPIWVVKTRLMLQTGIGEY-STHYKGTIDTFKKIIQQEGVKALYAGLVP 204

Query: 173 NLVRGVLMTASQVVSYDVCKHNLVTTFGFD------ASEKKTHFTASLVAGLVATTICSP 226
            L+ G+L  A Q   Y+  K  L  +   D      +S  +    AS+++ +VA+T+  P
Sbjct: 205 ALL-GMLNVAIQFPLYENLKIRLKYSESTDLPTDLTSSNFQKLILASMLSKMVASTVTYP 263

Query: 227 ADVIKTRIM------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFL 280
            ++++TR+       +A Q H   L ++  + + EG    + G+  +  R  P+ ++  +
Sbjct: 264 HEILRTRMQLKSDLPDAVQRH--LLPLIRITYKQEGFAGFYSGFATNLVRTVPSAVVTLV 321

Query: 281 VVEQLRKY 288
             E  +KY
Sbjct: 322 SFEYSKKY 329

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 86/192 (44%), Gaps = 20/192 (10%)

Query: 23  GGIVACIITHPLDLAKVRL--QTAARPKPTLF----SMIQRILKNDGPLGLYSGLTASIL 76
            G ++ + T+P+ + K RL  QT      T +       ++I++ +G   LY+GL  ++L
Sbjct: 148 AGAISTVATNPIWVVKTRLMLQTGIGEYSTHYKGTIDTFKKIIQQEGVKALYAGLVPALL 207

Query: 77  RQCTYTTARFGCYDFIKENL-------LPADKLNSTLY-LLPCSMISGAIGGFVGNPADV 128
                   +F  Y+ +K  L       LP D  +S    L+  SM+S  +   V  P ++
Sbjct: 208 GMLN-VAIQFPLYENLKIRLKYSESTDLPTDLTSSNFQKLILASMLSKMVASTVTYPHEI 266

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRI-FKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           +  RMQ  S     ++R+    I    RI +K+EG     +G   NLVR V      +VS
Sbjct: 267 LRTRMQLKSDLPDAVQRHLLPLI----RITYKQEGFAGFYSGFATNLVRTVPSAVVTLVS 322

Query: 188 YDVCKHNLVTTF 199
           ++  K  L   F
Sbjct: 323 FEYSKKYLSNLF 334

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 44/92 (47%), Gaps = 8/92 (8%)

Query: 212 ASLVAGLVATTICSPADVIKTR--------IMNAHQHHESTLKVLSSSIRNEGLGFMFRG 263
           A  ++G+++  +  P DV KTR        I +  QH++      ++  R+EG   +++G
Sbjct: 44  AGALSGVLSGILVCPFDVAKTRLQAQGLQNISHQSQHYKGFFGTFATIFRDEGAAGLYKG 103

Query: 264 WLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
             P+     P  ++ F V +  RKY + +  H
Sbjct: 104 LQPTILGYIPTLMIYFSVYDFSRKYSVDIFPH 135

>Kwal_26.8669 s26 (890718..891608) [891 bp, 296 aa] {ON} YPL134C
           (ODC1) -  [contig 67] FULL
          Length = 296

 Score = 91.3 bits (225), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 135/289 (46%), Gaps = 37/289 (12%)

Query: 16  PWWY----GGVGGIVACIITHPLDLAKVRLQTAAR----PK-PTLFSMIQRILKNDGPLG 66
           P++Y    G V GI   ++ +PLD+ K R+Q        P+   +   I++I+  +G   
Sbjct: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR 67

Query: 67  LYSGLTASILRQCTYTTARFGCYDF---IKENLLPADKLNSTLYLLPCSMISGAIGG--- 120
           LY G+++ +L +      +F C D    I +     +KL  +L     S++SGA  G   
Sbjct: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL-----SILSGASAGCCE 122

Query: 121 -FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR-GV 178
            FV  P ++V IR+Q+ S+       +YK  ID V +I  +EGV  +  GL   L R GV
Sbjct: 123 AFVVVPFELVKIRLQDVSS-------SYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGV 175

Query: 179 LMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMN-- 236
                  + + V    L+      + + +    A  + G + + + +P DV+K+RI N  
Sbjct: 176 WNAGYFGIIFQV--RALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTA 233

Query: 237 ----AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
                 + +  +   + +  + EG   +++G++P   RLGP   ++ +V
Sbjct: 234 VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVV 282

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 73/176 (41%), Gaps = 6/176 (3%)

Query: 115 SGAIGG----FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGL 170
           +GA+ G     V  P DVV  RMQ   +    L   YK  +D + +I  +EG  +L  G+
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSG--GLGPQYKGVVDCIKQIVAKEGASRLYKGI 72

Query: 171 GPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVI 230
              ++      A++    D  +      FG +   +     +   AG     +  P +++
Sbjct: 73  SSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELV 132

Query: 231 KTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
           K R+ +    ++  + V+   I  EG+  M+ G   +  R G      F ++ Q+R
Sbjct: 133 KIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVR 188

>TPHA0G01770 Chr7 complement(366539..367465) [927 bp, 308 aa] {ON}
           Anc_8.644 YOR222W
          Length = 308

 Score = 91.3 bits (225), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 133/299 (44%), Gaps = 47/299 (15%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQ------------TAARPKPTLFSMIQRILKND 62
           Y +  G V G+   ++ +PLD+ K R+Q            TA      +   I +I+KN+
Sbjct: 13  YTFIAGAVAGVSEILVMYPLDVVKTRMQLQVSKTAPSALKTATVQYNGVIDCIAKIVKNE 72

Query: 63  GPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-- 120
           G   LY G+T+ IL +      +F   DF K   L   +          S++SGA  G  
Sbjct: 73  GASRLYKGITSPILMEAPKRATKFAGNDFFKAFYL--REFQQERLTQKISVLSGASAGLL 130

Query: 121 --FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR-G 177
             FV  P +++ IR+Q+       +   YK+ ID +++I K EG+  +  GL   + R G
Sbjct: 131 ESFVVVPFELIKIRVQD-------VNSTYKSPIDCLSKIIKNEGIFAMYNGLEATMWRHG 183

Query: 178 VLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICS----PADVIKTR 233
           V       + + V   +L+      A+ K       L+AG +  T+ S    P DV+K+R
Sbjct: 184 VWNAGYFGIIFQV--RSLLP----KANNKNQSIRNDLIAGSIGGTVGSMCNTPFDVVKSR 237

Query: 234 IMNAHQ-----------HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
           I N  +            +  +L  + +  R EG   +++G++P   RLGP   ++ +V
Sbjct: 238 IQNFKKVIGEDGKIIPRKYNWSLPSIVTIYREEGFKALYKGFVPKVLRLGPGGGILLVV 296

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 83/184 (45%), Gaps = 9/184 (4%)

Query: 112 SMISGAIGG----FVGNPADVVNIRMQ-NDSAHEPHLRR----NYKNAIDGVTRIFKEEG 162
           + I+GA+ G     V  P DVV  RMQ   S   P   +     Y   ID + +I K EG
Sbjct: 14  TFIAGAVAGVSEILVMYPLDVVKTRMQLQVSKTAPSALKTATVQYNGVIDCIAKIVKNEG 73

Query: 163 VRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATT 222
             +L  G+   ++      A++    D  K   +  F  +   +K    +   AGL+ + 
Sbjct: 74  ASRLYKGITSPILMEAPKRATKFAGNDFFKAFYLREFQQERLTQKISVLSGASAGLLESF 133

Query: 223 ICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVV 282
           +  P ++IK R+ + +  ++S +  LS  I+NEG+  M+ G   +  R G      F ++
Sbjct: 134 VVVPFELIKIRVQDVNSTYKSPIDCLSKIIKNEGIFAMYNGLEATMWRHGVWNAGYFGII 193

Query: 283 EQLR 286
            Q+R
Sbjct: 194 FQVR 197

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 36/84 (42%), Gaps = 11/84 (13%)

Query: 5   KSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAAR---------PKPTLFSM- 54
           K+ + N  ++     G +GG V  +   P D+ K R+Q   +         P+   +S+ 
Sbjct: 202 KANNKNQSIRNDLIAGSIGGTVGSMCNTPFDVVKSRIQNFKKVIGEDGKIIPRKYNWSLP 261

Query: 55  -IQRILKNDGPLGLYSGLTASILR 77
            I  I + +G   LY G    +LR
Sbjct: 262 SIVTIYREEGFKALYKGFVPKVLR 285

>Smik_10.383 Chr10 (598671..599639) [969 bp, 322 aa] {ON} YJR095W
           (REAL)
          Length = 322

 Score = 91.3 bits (225), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 118/290 (40%), Gaps = 24/290 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP------KPTLFSMIQR-ILKNDGPLGLYSGLT 72
           GG  G+   +  HPLD  KVR+Q   R       KP  F    R I + +G L LY GL 
Sbjct: 17  GGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLG 76

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNPAD 127
           A ++        RF  Y+F +  L+  +   + +     + ++G   G      V NP +
Sbjct: 77  AVVIGIIPKMAIRFSSYEFYRTLLVNKE---TGIVSTGNTFVAGVGAGITEAVLVVNPME 133

Query: 128 VVNIRMQND--SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQV 185
           VV IR+Q    +  EP+    Y NAI     I KEEGV  L  G+     R      +  
Sbjct: 134 VVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANF 193

Query: 186 VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI-------MNAH 238
             Y   K  L      D           L++G +     +P D IKTR+       +   
Sbjct: 194 TVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQ 253

Query: 239 QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
              +  + + +  ++ EG   +++G  P   R+ P   + F V E +R++
Sbjct: 254 SGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREH 303

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 86/199 (43%), Gaps = 19/199 (9%)

Query: 112 SMISGAIGGFVG----NPADVVNIRMQ--NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRK 165
           ++I+G   G       +P D + +RMQ     A   H++      I     I+++EG   
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKP--PGFIKTGRTIYQKEGFLA 70

Query: 166 LLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLV-ATTIC 224
           L  GLG  ++  +   A +  SY+  +  LV       S   T F A + AG+  A  + 
Sbjct: 71  LYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKETGIVSTGNT-FVAGVGAGITEAVLVV 129

Query: 225 SPADVIKTRIM---------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNT 275
           +P +V+K R+          NA   + + +    + ++ EG+  ++RG   + AR   N 
Sbjct: 130 NPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQ 189

Query: 276 ILIFLVVEQLRKYEIGMHQ 294
              F V  +L+++    HQ
Sbjct: 190 GANFTVYSKLKEFLQNYHQ 208

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 11/92 (11%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRI-------LKNDGP 64
           P W     G + G +      PLD  K RLQ          S +++I       LK +G 
Sbjct: 213 PSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGF 272

Query: 65  LGLYSGLTASILRQCTYTTARFGCYDFIKENL 96
             LY G+T  ++R        F  Y++++E+L
Sbjct: 273 RALYKGITPRVMRVAPGQAVTFTVYEYVREHL 304

>Ecym_8329 Chr8 (666580..667476) [897 bp, 298 aa] {ON} similar to
           Ashbya gossypii ACR109W
          Length = 298

 Score = 90.9 bits (224), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 134/288 (46%), Gaps = 36/288 (12%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQ------TAARPKPTLFSMIQRILKNDGPLGLY 68
           Y +  G V G+   ++ +PLD+ K R+Q       A R    + + ++RI+  +G   LY
Sbjct: 13  YQFIAGAVAGVSEILVMYPLDVVKTRMQLQVADSAAGRHYTGVINCLKRIVVEEGTSRLY 72

Query: 69  SGLTASILRQCTYTTARFGCYD---FIKENLLPADKLNSTLYLLPCSMISGAIGG----F 121
            G+++ +L +      +F C D    I + L  A +L       P +M+SGA  G    F
Sbjct: 73  KGISSPVLMEAPKRATKFACNDEFQRIYQRLFGAKELTQ-----PITMLSGASAGCIESF 127

Query: 122 VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMT 181
           V  P ++V IR+Q+ S+       ++K  ID V  I  +EG   +  GL   + R  +  
Sbjct: 128 VVVPFELVKIRIQDVSS-------SFKGPIDVVKHIVAKEGPLAMYNGLESTIWRHAIWN 180

Query: 182 ASQV-VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMN---- 236
           +    + + +    L+        + +    A  + G  ++ + +P DV+K+RI N    
Sbjct: 181 SGYFGIIFQL--RALLPKADTKFQQTRNDLIAGTIGGSASSLLSTPFDVVKSRIQNTAIV 238

Query: 237 ---AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
              A +++ S   VL +  R EG   +++G++P   RLGP   ++ +V
Sbjct: 239 PGVARKYNWSWPAVL-TIYREEGFKALYKGFVPKVLRLGPGGGILLVV 285

>TDEL0C03310 Chr3 (589960..590919) [960 bp, 319 aa] {ON} Anc_7.467
           YJR095W
          Length = 319

 Score = 90.9 bits (224), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 123/302 (40%), Gaps = 23/302 (7%)

Query: 5   KSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPK------PTLFSMIQRI 58
           K +SSN  V      GG  G+   +  HPLD  KVR+Q   R        P   +  + I
Sbjct: 4   KKKSSNPAVN--LIAGGTAGLFEALCCHPLDTIKVRMQIYRRAASGEIKPPGFITTGKTI 61

Query: 59  LKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAI 118
              +G + LY GL A ++        RF  Y+F +   L ADK  + +     + ++G  
Sbjct: 62  YTQEGFIALYKGLGAVVIGIIPKMAIRFSSYEFYRT--LVADK-QTGIVSTGNTFLAGVG 118

Query: 119 GG-----FVGNPADVVNIRMQND--SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
            G      V NP +VV IR+Q    +   P +   YKNA+     I KEEG+  L  G+ 
Sbjct: 119 AGITEAVLVVNPMEVVKIRLQAQHLNPTAPGVAPKYKNAVHACYTIVKEEGISALYRGVS 178

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIK 231
               R      +    Y   K  L    G +           L++G +     +P D IK
Sbjct: 179 LTAARQATNQGANFTIYSKLKEYLQDYHGTEVLPSWETSCIGLISGAIGPFSNAPLDTIK 238

Query: 232 TRIMNAHQHHEST-----LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
           TR+       + +      K+ +  ++ EG   +++G  P   R+ P   + F V E  R
Sbjct: 239 TRLQKDSCTSKDSGWTRIAKIGAQLVKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFAR 298

Query: 287 KY 288
           ++
Sbjct: 299 RH 300

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 9/90 (10%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQT-AARPKPTLFSMIQRI----LKNDGPLG 66
           P W     G + G +      PLD  K RLQ  +   K + ++ I +I    +K +G   
Sbjct: 212 PSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDSCTSKDSGWTRIAKIGAQLVKEEGFRA 271

Query: 67  LYSGLTASILRQCTYTTARFGCYDFIKENL 96
           LY G+T  ++R        F  Y+F + +L
Sbjct: 272 LYKGITPRVMRVAPGQAVTFTVYEFARRHL 301

>SAKL0E09086g Chr5 complement(754996..755928) [933 bp, 310 aa] {ON}
           similar to uniprot|P40464 Saccharomyces cerevisiae
           YIL134W FLX1 Protein required for transport of flavin
           adenine dinucleotide (FAD) from mitochondria where it is
           synthesized from riboflavin to the cytosol
          Length = 310

 Score = 90.9 bits (224), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 137/301 (45%), Gaps = 38/301 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ-TAARPKPT-LFSMIQRILKNDGPLGL----YSGLTA 73
           G   G +  + THPLDL KVRLQ  A   KP   + +++RI+K+          Y GL  
Sbjct: 15  GLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHSFFRETYRGLGV 74

Query: 74  SILRQCTYTTARFGCYDFIKE--------------NLLPADK-LNSTLYLLPCSMISGAI 118
           ++L         FG Y   K+              N +  DK + S +YLL  +M SG  
Sbjct: 75  NLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAAM-SGVA 133

Query: 119 GGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGV 178
              + NP  V+  R+ + S  +    R+Y++ +DG+ ++++ EG+     GL P+L  GV
Sbjct: 134 TSVLTNPIWVIKTRIMSTSFVDS---RSYRSTVDGIKKLYRIEGLAGFWRGLVPSLF-GV 189

Query: 179 LMTASQVVSYDVCKHNLVTTFGFDASEKKT---HFTASLVAGLVATTICSPADVIKTR-- 233
              A     YD  K++       D  +K +   + T + ++ +V+ T   P  ++K+   
Sbjct: 190 SQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQLLKSNLQ 249

Query: 234 ------IMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
                 ++N    H    K++++    +G+  +++G L +  R  P+T + F V E  R 
Sbjct: 250 SFEVSTVINPKTSHR-VWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVYENFRH 308

Query: 288 Y 288
           +
Sbjct: 309 W 309

>TDEL0A05900 Chr1 (1037786..1038691) [906 bp, 301 aa] {ON} Anc_8.644
           YOR222W
          Length = 301

 Score = 90.5 bits (223), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 129/297 (43%), Gaps = 34/297 (11%)

Query: 16  PWWY----GGVGGIVACIITHPLDLAKVRLQTAARPKPT----------LFSMIQRILKN 61
           P++Y    G V GI   ++ +PLD+ K R+Q       T          +   I++I+  
Sbjct: 8   PFFYQFVAGAVAGISEILVMYPLDVVKTRMQLQVGGAATGAAAQEHYTGVVDCIRKIVAK 67

Query: 62  DGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG- 120
           +G   LY G+++ +L +      +F C D  ++  +   +        P S++SGA  G 
Sbjct: 68  EGASRLYKGISSPVLMEAPKRATKFACNDEFQK--IYKREFGVAQLTQPLSVLSGASAGI 125

Query: 121 ---FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG 177
              FV  P ++V IR+Q+        R NYK  +D V +I  +EGV  +  GL   + R 
Sbjct: 126 CEAFVVVPFELVKIRLQDS-------RSNYKGPVDVVKQIIAKEGVLAMYNGLESTMWRH 178

Query: 178 VLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNA 237
            +   S           L+        + +    A  + G V + + +P DV+K+RI N 
Sbjct: 179 AVWN-SGYFGIIFQARGLLPKPENKMQKTRNDLIAGTIGGTVGSLLSTPFDVVKSRIQNT 237

Query: 238 H------QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
                  + +  +   L    R EG   +++G++P   RLGP   ++ +V  ++  +
Sbjct: 238 AVIAGVVRKYNWSWPSLFIVYREEGFKALYKGFVPKVLRLGPGGGILLVVFTEVTDF 294

>Skud_10.317 Chr10 (567135..568103) [969 bp, 322 aa] {ON} YJR095W
           (REAL)
          Length = 322

 Score = 90.1 bits (222), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 115/290 (39%), Gaps = 24/290 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAAR-------PKPTLFSMIQRILKNDGPLGLYSGLT 72
           GG  G+   +  HPLD  KVR+Q   R         P        I + +G L LY GL 
Sbjct: 17  GGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGSTIYQKEGFLALYKGLG 76

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNPAD 127
           A ++        RF  Y+F +  L+  +   + +     + ++G   G      V NP +
Sbjct: 77  AVVIGIIPKMAIRFSSYEFYRTLLVNKE---TGIVSTGNTFVAGVGAGITEAVLVVNPME 133

Query: 128 VVNIRMQND--SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQV 185
           VV IR+Q    +  EP++   Y NAI     I KEEGV  L  G+     R      +  
Sbjct: 134 VVKIRLQAQHLTPSEPNVGPRYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANF 193

Query: 186 VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMN-------AH 238
             Y   K  L      D           L++G +     +P D IKTR+           
Sbjct: 194 TVYSKLKEFLQNYHHMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSLIKQ 253

Query: 239 QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
              +  + + +  ++ EG   +++G  P   R+ P   + F V E +R++
Sbjct: 254 SGMKKIITIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREH 303

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 85/199 (42%), Gaps = 19/199 (9%)

Query: 112 SMISGAIGGFVG----NPADVVNIRMQ--NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRK 165
           ++I+G   G       +P D + +RMQ     A   H++      I   + I+++EG   
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKP--PGFIKTGSTIYQKEGFLA 70

Query: 166 LLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLV-ATTIC 224
           L  GLG  ++  +   A +  SY+  +  LV       S   T F A + AG+  A  + 
Sbjct: 71  LYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKETGIVSTGNT-FVAGVGAGITEAVLVV 129

Query: 225 SPADVIKTRIMNAH---------QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNT 275
           +P +V+K R+   H           + + +    + ++ EG+  ++RG   + AR   N 
Sbjct: 130 NPMEVVKIRLQAQHLTPSEPNVGPRYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQ 189

Query: 276 ILIFLVVEQLRKYEIGMHQ 294
              F V  +L+++    H 
Sbjct: 190 GANFTVYSKLKEFLQNYHH 208

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 11/92 (11%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRI-------LKNDGP 64
           P W     G + G +      PLD  K RLQ          S +++I       LK +G 
Sbjct: 213 PSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSLIKQSGMKKIITIGTQLLKEEGF 272

Query: 65  LGLYSGLTASILRQCTYTTARFGCYDFIKENL 96
             LY G+T  ++R        F  Y++++E+L
Sbjct: 273 RALYKGITPRVMRVAPGQAVTFTVYEYVREHL 304

>ACR109W Chr3 (546745..547644) [900 bp, 299 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR222W (ODC2) and
           YPL134C (ODC1)
          Length = 299

 Score = 89.7 bits (221), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 141/318 (44%), Gaps = 51/318 (16%)

Query: 4   TKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQT----AARPKPT-LFSMIQRI 58
           + S++ +    Y ++ G V G+   ++ +PLD+ K R+Q      A P  T +   +++I
Sbjct: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI 61

Query: 59  LKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIK---ENLLPADKLNSTLYLLPCSMIS 115
           +  +G   LY G+++ IL +      +F C D  +   +     +KL+      P SM++
Sbjct: 62  VAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQ-----PLSMLA 116

Query: 116 GAIGG----FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           GA  G    FV  P ++V IR+Q+ S+       +YK  +D V +I   EGV  +  GL 
Sbjct: 117 GASAGCVEAFVVVPFELVKIRLQDASS-------SYKGPVDVVRKIVAREGVLAMYNGLE 169

Query: 172 PNLVRGVLMTAS------QVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTI-- 223
             L R  L          Q  +     HN           K    T  L++  +  +I  
Sbjct: 170 STLWRHALWNGGYFGIIFQARALLPAAHN-----------KTQCITNDLISDSIGCSIGC 218

Query: 224 --CSPADVIKTRIMNAH------QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNT 275
              +P DV+K+RI N        + +  +L  L +  R EG   +++G++P   RLGP  
Sbjct: 219 MLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGG 278

Query: 276 ILIFLVVEQLRKYEIGMH 293
            ++ +V   +  +   +H
Sbjct: 279 GILLVVFTGVLDFCRAIH 296

>Ecym_2469 Chr2 complement(914652..915629) [978 bp, 325 aa] {ON}
           similar to Ashbya gossypii ABL023W
          Length = 325

 Score = 89.7 bits (221), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 130/281 (46%), Gaps = 20/281 (7%)

Query: 23  GGIVACI---ITHPLDLAKVRLQTAARPKP-------TLFSMIQRILKNDGPLGLYSGLT 72
           GG+ ACI    T+P+++AK R+Q                F  +  I K +G  GL  GL 
Sbjct: 31  GGLAACIAVTFTNPVEVAKTRMQLQGELSAVGETIYKNPFQAMGLIGKTEGIRGLQKGLN 90

Query: 73  ASILRQCTYTTARFGCYDFIK--ENLLPADKLNSTLYL-----LPCSMISGAIGGFVGNP 125
            + + Q     +R G Y+ I+   N L     N  ++      +    +SG IG  +G+P
Sbjct: 91  CAYIYQIGLNGSRLGFYEPIRLETNKLLFSTKNPYVHQNMAVNIVAGTLSGMIGAVIGSP 150

Query: 126 ADVVNIRMQN-DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
             ++  RMQ+  SA +   +  Y +  +G+T I K  G++ L  G    ++R    +A Q
Sbjct: 151 LYLIKTRMQSYSSAIQVGQQTRYSSIWNGITSIVKNHGIKGLFHGTDAAILRTGAGSAVQ 210

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMN-AHQHHES 243
           +  Y+  K+ L+            H  AS ++G+    + +P DVI TR+ N +   ++ 
Sbjct: 211 LPIYNSAKNFLLRNAHMQ-DGYSLHLIASTISGVGVAIVMNPWDVILTRVYNQSGSLYKG 269

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQ 284
            +     +I+ EG   +++G+    +R+ P+TIL    +EQ
Sbjct: 270 PIDCFLKTIKIEGPSALYKGFAAQLSRICPHTILCLTFLEQ 310

 Score = 57.4 bits (137), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 71/166 (42%), Gaps = 15/166 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP--------KPTLFSMIQRILKNDGPLGLYSGL 71
           G + G++  +I  PL L K R+Q+ +            ++++ I  I+KN G  GL+ G 
Sbjct: 137 GTLSGMIGAVIGSPLYLIKTRMQSYSSAIQVGQQTRYSSIWNGITSIVKNHGIKGLFHGT 196

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL-LPCSMISGAIGGFVGNPADVVN 130
            A+ILR    +  +   Y+  K  LL    +     L L  S ISG     V NP DV+ 
Sbjct: 197 DAAILRTGAGSAVQLPIYNSAKNFLLRNAHMQDGYSLHLIASTISGVGVAIVMNPWDVIL 256

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
            R+ N S         YK  ID   +  K EG   L  G    L R
Sbjct: 257 TRVYNQSGSL------YKGPIDCFLKTIKIEGPSALYKGFAAQLSR 296

>Suva_12.183 Chr12 (288186..289154) [969 bp, 322 aa] {ON} YJR095W
           (REAL)
          Length = 322

 Score = 88.6 bits (218), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 114/290 (39%), Gaps = 24/290 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAAR-------PKPTLFSMIQRILKNDGPLGLYSGLT 72
           GG  G+   +  HPLD  KVR+Q   R         P        I   +G L LY GL 
Sbjct: 17  GGTAGLFEALCCHPLDTIKVRMQIYKRVAGIEHVKPPGFIKTGSTIYHKEGFLALYKGLG 76

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNPAD 127
           A ++        RF  Y+F +  L+  +   + +     + ++G   G      V NP +
Sbjct: 77  AVVIGIIPKMAIRFSSYEFYRTLLVNKE---TGIVSTGNTFVAGVGAGITEAVLVVNPME 133

Query: 128 VVNIRMQND--SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQV 185
           VV IR+Q    +  EP+    Y NAI     I KEEGV  L  G+     R      +  
Sbjct: 134 VVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANF 193

Query: 186 VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQ---HHE 242
             Y   K  L      D           L++G +     +P D IKTR+          +
Sbjct: 194 TVYSKLKEYLQNYQQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSLEKQ 253

Query: 243 STLKVL----SSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
           S +K +    +  ++ EG   +++G  P   R+ P   + F V E +R +
Sbjct: 254 SGMKKIVVIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVRDH 303

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 11/92 (11%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQ----TAARPKPTLFSMI---QRILKNDGP 64
           P W     G + G +      PLD  K RLQ    T+   +  +  ++    ++LK +G 
Sbjct: 213 PSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSLEKQSGMKKIVVIGTQLLKEEGF 272

Query: 65  LGLYSGLTASILRQCTYTTARFGCYDFIKENL 96
             LY G+T  ++R        F  Y++++++L
Sbjct: 273 RALYKGITPRVMRVAPGQAVTFTVYEYVRDHL 304

>AGL311C Chr7 complement(119645..120733) [1089 bp, 362 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR095W
           (SFC1)
          Length = 362

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 118/293 (40%), Gaps = 28/293 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPK-----PTLFSMIQRILKNDGPLGLYSGLTAS 74
           GG  G+   +  HPLD  KVR+Q   R       P        I   +G L  Y GL A 
Sbjct: 64  GGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAV 123

Query: 75  ILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNPADVV 129
           ++        RF  Y+F +  L  AD+  + +     + ++G   G      V NP +VV
Sbjct: 124 VIGIIPKMAIRFSSYEFYRTLL--ADR-QTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVV 180

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
            IR+Q    H    ++ Y+NAI     I KEEG+  L  G+     R      +    Y 
Sbjct: 181 KIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYS 240

Query: 190 VCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLS 249
                L    G             LV+G +     +P D IKTR+    Q  +ST + LS
Sbjct: 241 KLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRL----QKDKST-RNLS 295

Query: 250 SSIR----------NEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGM 292
           + +R           EG   +++G  P   R+ P   + F V E +R++  G+
Sbjct: 296 NWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348

>NCAS0A11060 Chr1 (2201278..2202198) [921 bp, 306 aa] {ON} Anc_3.348
          Length = 306

 Score = 87.8 bits (216), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 127/287 (44%), Gaps = 20/287 (6%)

Query: 9   SNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLY 68
            NA V      G  GGI   ++  P D  KVRLQT++ P  T   +I+++LKN+GP G Y
Sbjct: 21  DNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT-TAMEVIRKLLKNEGPKGFY 79

Query: 69  SGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL-LPCSMISGAIGG----FVG 123
            G    ++      + +FG  + +K      +  +++  L LP   I G  GG    F+ 
Sbjct: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA 139

Query: 124 NPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTAS 183
           +P + V IR+Q  +   P++   +K  +D + ++  + G    + GL P ++R      +
Sbjct: 140 SPIEHVRIRLQTQTGSGPNVE--FKGPLDCIRKLRAQGG---FMRGLTPTMLREGHGCGT 194

Query: 184 QVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTI---CSPADVIK----TRIMN 236
             + Y+    N +   GF  +E    +   L   L  TT+     P DVIK    T  + 
Sbjct: 195 YFLVYEAMVANEINK-GFKRTEVPA-WKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLK 252

Query: 237 AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           + ++  S   V  +     GLG  F+G+ P+  R  P     F   E
Sbjct: 253 SPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFE 299

>Suva_16.386 Chr16 (680514..681437) [924 bp, 307 aa] {ON} YPR058W
           (REAL)
          Length = 307

 Score = 87.8 bits (216), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 128/289 (44%), Gaps = 19/289 (6%)

Query: 7   ESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLG 66
           +  NA V      G +GGI   ++  P D  KVRLQTA+ P  T   +++++L N+GP G
Sbjct: 19  QHDNARVVKDLLAGTLGGIAQVLVGQPFDTTKVRLQTASTPT-TAMEVVKKLLANEGPRG 77

Query: 67  LYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLP----CSMISGAIGGFV 122
            Y G    ++      + +FG  + +K      +   S++  LP    C +  G +  F+
Sbjct: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHQRNANQSSILSLPQYYTCGVTGGLVNSFL 137

Query: 123 GNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTA 182
            +P + V IR+Q  +    ++   +K  ++ + ++   +G   L+ GL P ++R      
Sbjct: 138 ASPIEHVRIRLQTQTGSGSNVE--FKGPLECIKKLKNNKG---LMRGLSPTMLREAHGCG 192

Query: 183 SQVVSYDVCKHNLVTT-FGFDASEKKTHFTASLVAGLVATTI---CSPADVIKTRIMNAH 238
           +  + Y+    N +++  G +  +  T +   +   L  T +     P DVIK+ +   +
Sbjct: 193 TYFLVYEALVANQISSNHGLERKDIPT-WKLCIFGALSGTALWLMVYPLDVIKSVMQTDN 251

Query: 239 QHHESTLKVLSSSIR----NEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
                    +SS  +     EG+G  F+G+ P+  R  P     F   E
Sbjct: 252 LQKPKFGNSISSVAKTLYAKEGIGAFFKGFGPTMLRAAPANGATFATFE 300

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 89/200 (44%), Gaps = 20/200 (10%)

Query: 5   KSESSNAVVKYPWWY--GGVGGIVACIITHPLDLAKVRLQTAARPKPTL-----FSMIQR 57
           ++ + ++++  P +Y  G  GG+V   +  P++  ++RLQT       +        I++
Sbjct: 110 RNANQSSILSLPQYYTCGVTGGLVNSFLASPIEHVRIRLQTQTGSGSNVEFKGPLECIKK 169

Query: 58  ILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPAD-----KLNSTLYLLPCS 112
           +  N G   L  GL+ ++LR+       F  Y+ +  N + ++     K   T  L    
Sbjct: 170 LKNNKG---LMRGLSPTMLREAHGCGTYFLVYEALVANQISSNHGLERKDIPTWKLCIFG 226

Query: 113 MISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTR-IFKEEGVRKLLTGLG 171
            +SG     +  P DV+   MQ D+  +P     + N+I  V + ++ +EG+     G G
Sbjct: 227 ALSGTALWLMVYPLDVIKSVMQTDNLQKP----KFGNSISSVAKTLYAKEGIGAFFKGFG 282

Query: 172 PNLVRGVLMTASQVVSYDVC 191
           P ++R      +   ++++ 
Sbjct: 283 PTMLRAAPANGATFATFELA 302

>YPR021C Chr16 complement(600649..603357) [2709 bp, 902 aa] {ON}
           AGC1Mitochondrial amino acid transporter, acts both as a
           glutamate uniporter and as an aspartate-glutamate
           exchanger; involved in nitrogen metabolism and nitrogen
           compound biosynthesis
          Length = 902

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 76/278 (27%), Positives = 126/278 (45%), Gaps = 30/278 (10%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRILKNDGPLGLYSGL 71
           Y +  G + G +   + +P+D  K R+Q   + A+ K ++  ++ +I+  +G  GLYSGL
Sbjct: 532 YNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLL-KIISREGIKGLYSGL 590

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPAD 127
              ++        +    DF++  L   DK N  L L P  +ISGA  G       NP +
Sbjct: 591 GPQLIGVAPEKAIKLTVNDFMRNRL--TDK-NGKLSLFP-EIISGASAGACQVIFTNPLE 646

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           +V IR+Q  S    ++  N + A +  T+I K+ G+R L  G+   L+R V  +A    +
Sbjct: 647 IVKIRLQVQS---DYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPT 703

Query: 188 YDVCKHNLVTTFGFDASEKKTH--------FTASLVAGLVATTICSPADVIKTRIM---- 235
           Y   K +L   F FD ++K            TA  +AG+ A  + +P DVIKTR+     
Sbjct: 704 YAHLKKDL---FDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPR 760

Query: 236 NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGP 273
                +      + + ++ E     F+G      R  P
Sbjct: 761 KGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSP 798

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 48/194 (24%), Positives = 82/194 (42%), Gaps = 25/194 (12%)

Query: 105 TLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
           +LY      I+G IG  V  P D +  RMQ   +        YKN+ID + +I   EG++
Sbjct: 530 SLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRS-----LAQYKNSIDCLLKIISREGIK 584

Query: 165 KLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHF---TASLVAGLVAT 221
            L +GLGP L+      A ++   D  ++ L      D + K + F    +   AG    
Sbjct: 585 GLYSGLGPQLIGVAPEKAIKLTVNDFMRNRLT-----DKNGKLSLFPEIISGASAGACQV 639

Query: 222 TICSPADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGP 273
              +P +++K R+         N  Q +E+  ++    ++  GL  ++ G      R  P
Sbjct: 640 IFTNPLEIVKIRLQVQSDYVGENIQQANETATQI----VKKLGLRGLYNGVAACLMRDVP 695

Query: 274 NTILIFLVVEQLRK 287
            + + F     L+K
Sbjct: 696 FSAIYFPTYAHLKK 709

 Score = 38.9 bits (89), Expect = 0.013,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 5/90 (5%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT----LFSMIQRILKNDGPLGLYSGLTASI 75
           G + G+ A  +T P D+ K RLQ   R   T    +F  I+ ILK +     + G  A +
Sbjct: 734 GAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARV 793

Query: 76  LRQCTYTTARFGCYDFIKENL-LPADKLNS 104
           LR           Y+  K  +  P +KL S
Sbjct: 794 LRSSPQFGFTLAAYELFKGFIPSPDNKLKS 823

>Ecym_7158 Chr7 (330513..331484) [972 bp, 323 aa] {ON} similar to
           Ashbya gossypii AGL311C
          Length = 323

 Score = 87.0 bits (214), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 87/314 (27%), Positives = 127/314 (40%), Gaps = 36/314 (11%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAAR------PKPTLFSM 54
           MS  K+ S++  V      GG  G+   +  HPLD  KVR+Q   R        P     
Sbjct: 1   MSSKKNSSTHPAVN--LVAGGTAGLFEALCCHPLDTIKVRMQIYRRTTHEGQSSPGFLRT 58

Query: 55  IQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMI 114
              I K +G L LY GL A ++        RF  Y F +  L  AD  N+ +     + I
Sbjct: 59  GSSIYKQEGFLSLYKGLGAVVIGIIPKMAIRFSSYGFYRSVL--ADP-NTGVVSTGNTFI 115

Query: 115 SGAIGG-----FVGNPADVVNIRMQND-----SAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
           +G   G      V NP +VV IR+Q       +  +      Y+NA+     I KEEG+ 
Sbjct: 116 AGVGAGITEAVMVVNPMEVVKIRLQAQHLNPSTGADGKEVVKYRNALQAAYVIVKEEGIG 175

Query: 165 KLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTIC 224
            L  G+     R      +    Y   +  L +  G +           LV+G +     
Sbjct: 176 ALYRGVSLTAARQATNQGANFTVYSKLREFLQSYHGSETLPSWETSLIGLVSGAIGPFSN 235

Query: 225 SPADVIKTRIMNAHQHHESTLKVLSSSIR----------NEGLGFMFRGWLPSFARLGPN 274
           +P D IKTR+    Q  +ST K LS+ +R           EG   +++G  P   R+ P 
Sbjct: 236 APLDTIKTRL----QKDKST-KNLSNWVRITTIGRQLIHEEGFRALYKGITPRVMRVAPG 290

Query: 275 TILIFLVVEQLRKY 288
             + F V E +RK+
Sbjct: 291 QAVTFTVYEFVRKH 304

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 79/185 (42%), Gaps = 19/185 (10%)

Query: 124 NPADVVNIRMQ--NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMT 181
           +P D + +RMQ    + HE      +   +   + I+K+EG   L  GLG  ++  +   
Sbjct: 30  HPLDTIKVRMQIYRRTTHEGQSSPGF---LRTGSSIYKQEGFLSLYKGLGAVVIGIIPKM 86

Query: 182 ASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLV-ATTICSPADVIKTRIMNAHQH 240
           A +  SY   +  L        S   T F A + AG+  A  + +P +V+K R+   H +
Sbjct: 87  AIRFSSYGFYRSVLADPNTGVVSTGNT-FIAGVGAGITEAVMVVNPMEVVKIRLQAQHLN 145

Query: 241 ------------HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
                       + + L+     ++ EG+G ++RG   + AR   N    F V  +LR++
Sbjct: 146 PSTGADGKEVVKYRNALQAAYVIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLREF 205

Query: 289 EIGMH 293
               H
Sbjct: 206 LQSYH 210

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 9/90 (10%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQTAARPKP-----TLFSMIQRILKNDGPLG 66
           P W     G V G +      PLD  K RLQ     K       + ++ ++++  +G   
Sbjct: 216 PSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTKNLSNWVRITTIGRQLIHEEGFRA 275

Query: 67  LYSGLTASILRQCTYTTARFGCYDFIKENL 96
           LY G+T  ++R        F  Y+F++++L
Sbjct: 276 LYKGITPRVMRVAPGQAVTFTVYEFVRKHL 305

>NCAS0H00570 Chr8 complement(96997..98001) [1005 bp, 334 aa] {ON}
           Anc_7.467
          Length = 334

 Score = 87.0 bits (214), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 122/298 (40%), Gaps = 32/298 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP---KPTLFSMIQR-ILKNDGPLGLYSGLTASI 75
           GG  G+   +  HPLD  KVR+Q A R    +P  F    R I  ++G L LY GL A +
Sbjct: 20  GGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGLGAVV 79

Query: 76  LRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNPADVVN 130
           +        RF  Y+F +  L   DK   T+     + ++G   G      V NP +VV 
Sbjct: 80  IGIIPKMAIRFSSYEFYRNAL--TDKETRTI-TTGNTFLAGVGAGITEAVLVVNPMEVVK 136

Query: 131 IRMQ----NDSAHEPH-----------LRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLV 175
           IR+Q    ND   +P             +  Y NAI     I KEEG   L  G+     
Sbjct: 137 IRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSLTAA 196

Query: 176 RGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI- 234
           R      +    Y   K  L      ++          L++G +     +P D IKTR+ 
Sbjct: 197 RQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ 256

Query: 235 ----MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
               ++++   +    + +  I+ EG   +++G  P   R+ P   + F V E +RK+
Sbjct: 257 KDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRKH 314

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 80/217 (36%), Gaps = 33/217 (15%)

Query: 98  PADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ---NDSAHEPHLRRNYKNAIDGV 154
           P DK +S L  L     +G       +P D + +RMQ         PH        I   
Sbjct: 6   PNDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPH------GFITTG 59

Query: 155 TRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASL 214
             I+  EG   L  GLG  ++  +   A +  SY+  ++ L        +   T F A +
Sbjct: 60  RNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTGNT-FLAGV 118

Query: 215 VAGLV-ATTICSPADVIKTRIMNAH----------------------QHHESTLKVLSSS 251
            AG+  A  + +P +V+K R+   H                        + + +    + 
Sbjct: 119 GAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTI 178

Query: 252 IRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
           ++ EG G ++RG   + AR   N    F V   L+ Y
Sbjct: 179 VKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDY 215

 Score = 36.2 bits (82), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 41/90 (45%), Gaps = 9/90 (10%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQ-----TAARPKPTLFSMIQRILKNDGPLG 66
           P W     G + G +      PLD  K RLQ     ++      ++ +  +++K +G   
Sbjct: 226 PSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRA 285

Query: 67  LYSGLTASILRQCTYTTARFGCYDFIKENL 96
           LY G+T  ++R        F  Y+F++++L
Sbjct: 286 LYKGITPRVMRVAPGQAVTFTVYEFVRKHL 315

>KAFR0G00930 Chr7 complement(216603..217556) [954 bp, 317 aa] {ON}
           Anc_7.467 YJR095W
          Length = 317

 Score = 87.0 bits (214), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 82/306 (26%), Positives = 121/306 (39%), Gaps = 29/306 (9%)

Query: 8   SSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQT--------------AARPKPTLFS 53
           SSN +V      GG  G++  ++ HPLD  KVR+Q               A +P P    
Sbjct: 6   SSNPIVNL--LAGGSAGLMEALVCHPLDTIKVRMQIYRKSTVEMNAAENLAIKP-PGFIR 62

Query: 54  MIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLL-PADKLNSTLYLLPCS 112
               I   +G L LY GL A ++        RF  Y++ +  L  P+    ST       
Sbjct: 63  TGTSIYSQEGFLALYKGLGAVVIGIIPKMAIRFSSYEWYRSLLASPSTGTVSTGNTFIAG 122

Query: 113 MISGAIGG-FVGNPADVVNIRMQND---SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLT 168
           +++G      V NP +VV IR+Q+    +     +   YKNAI     I KEEG R L  
Sbjct: 123 LLAGVTEAVMVVNPMEVVKIRLQSQHLTTTTTKSITAKYKNAIHAAYTIVKEEGPRALYR 182

Query: 169 GLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPAD 228
           G+     R      +    Y   K  L                  L++G +     +P D
Sbjct: 183 GVSLTAARQATNQGANFTVYSKLKEYLQKNQNLTTLPSWQTSCIGLISGAIGPFSNAPLD 242

Query: 229 VIKTRIM---NAHQHHESTLKVL----SSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
            IKTR+    +      S+ K +    S  I+ EG   +++G  P   R+ P   + F V
Sbjct: 243 TIKTRLQKDKSIKSDKTSSWKRIGAIGSQLIKEEGFRALYKGITPRVMRVAPGQAVTFTV 302

Query: 282 VEQLRK 287
            E +RK
Sbjct: 303 YEFIRK 308

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 92/209 (44%), Gaps = 18/209 (8%)

Query: 97  LPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ--NDSAHEPHLRRNYKNAIDGV 154
           +P+D+ ++ +  L     +G +   V +P D + +RMQ    S  E +   N      G 
Sbjct: 1   MPSDRSSNPIVNLLAGGSAGLMEALVCHPLDTIKVRMQIYRKSTVEMNAAENLAIKPPGF 60

Query: 155 TR----IFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHF 210
            R    I+ +EG   L  GLG  ++  +   A +  SY+  +  L +      S   T F
Sbjct: 61  IRTGTSIYSQEGFLALYKGLGAVVIGIIPKMAIRFSSYEWYRSLLASPSTGTVSTGNT-F 119

Query: 211 TASLVAGLV-ATTICSPADVIKTRIMNAH----------QHHESTLKVLSSSIRNEGLGF 259
            A L+AG+  A  + +P +V+K R+ + H            +++ +    + ++ EG   
Sbjct: 120 IAGLLAGVTEAVMVVNPMEVVKIRLQSQHLTTTTTKSITAKYKNAIHAAYTIVKEEGPRA 179

Query: 260 MFRGWLPSFARLGPNTILIFLVVEQLRKY 288
           ++RG   + AR   N    F V  +L++Y
Sbjct: 180 LYRGVSLTAARQATNQGANFTVYSKLKEY 208

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 38/92 (41%), Gaps = 11/92 (11%)

Query: 16  PWWY----GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRI-------LKNDGP 64
           P W     G + G +      PLD  K RLQ     K    S  +RI       +K +G 
Sbjct: 219 PSWQTSCIGLISGAIGPFSNAPLDTIKTRLQKDKSIKSDKTSSWKRIGAIGSQLIKEEGF 278

Query: 65  LGLYSGLTASILRQCTYTTARFGCYDFIKENL 96
             LY G+T  ++R        F  Y+FI++ L
Sbjct: 279 RALYKGITPRVMRVAPGQAVTFTVYEFIRKKL 310

>ZYRO0F06600g Chr6 (544959..545852) [894 bp, 297 aa] {ON} similar to
           uniprot|Q03028 Saccharomyces cerevisiae YPL134C ODC1
           Mitochondrial inner membrane transporter exports
           2-oxoadipate and 2-oxoglutarate from the mitochondrial
           matrix to the cytosol for use in lysine and glutamate
           biosynthesis and in lysine catabolism
          Length = 297

 Score = 86.7 bits (213), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 127/287 (44%), Gaps = 36/287 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ------TAARPKPTLFSMIQRILKNDGPLGLYSGLTA 73
           G V GI   ++ +PLD+ K R+Q      +A      +    ++I+K +G   LY G+T+
Sbjct: 16  GAVAGISEILVMYPLDVVKTRMQLQLNTVSADERYNGVVDCFRKIIKKEGFSRLYKGITS 75

Query: 74  SILRQCTYTTARFGCYD----FIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNP 125
            +L +      +F C D    F K +    +KL       P S++SGA  G     V  P
Sbjct: 76  PVLMEAPKRATKFACNDEFQKFYKRS-FGVEKLTQ-----PLSILSGASAGICESLVVVP 129

Query: 126 ADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR-GVLMTASQ 184
            ++V IR+Q+ +         +K   D V  I KEEGV  +  GL   + R GV      
Sbjct: 130 FELVKIRLQDQNT-------TFKGPADVVRHICKEEGVLAMYNGLESTMWRHGVWNAGYF 182

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNA------H 238
            + + +   +L+      + + +    A  V G   +   +P DV+K+RI N        
Sbjct: 183 GIIFQI--RSLLPAAQNKSQKTRNDLLAGAVGGTFGSFCSTPFDVVKSRIQNTAVVPGQM 240

Query: 239 QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQL 285
           + +  T   L +    EG   +++G+LP   RLGP   ++ +V  ++
Sbjct: 241 RKYNWTWPSLFTIYAEEGFLALYKGFLPKVLRLGPGGGILLVVFTEV 287

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 76/183 (41%), Gaps = 13/183 (7%)

Query: 112 SMISGAIGG----FVGNPADVVNIRMQ----NDSAHEPHLRRNYKNAIDGVTRIFKEEGV 163
             ++GA+ G     V  P DVV  RMQ      SA E      Y   +D   +I K+EG 
Sbjct: 12  QFVAGAVAGISEILVMYPLDVVKTRMQLQLNTVSADE-----RYNGVVDCFRKIIKKEGF 66

Query: 164 RKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTI 223
            +L  G+   ++      A++    D  +     +FG +   +     +   AG+  + +
Sbjct: 67  SRLYKGITSPVLMEAPKRATKFACNDEFQKFYKRSFGVEKLTQPLSILSGASAGICESLV 126

Query: 224 CSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
             P +++K R+ + +   +    V+    + EG+  M+ G   +  R G      F ++ 
Sbjct: 127 VVPFELVKIRLQDQNTTFKGPADVVRHICKEEGVLAMYNGLESTMWRHGVWNAGYFGIIF 186

Query: 284 QLR 286
           Q+R
Sbjct: 187 QIR 189

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 36/86 (41%), Gaps = 6/86 (6%)

Query: 209 HFTASLVAGLVATTICSPADVIKTRI------MNAHQHHESTLKVLSSSIRNEGLGFMFR 262
            F A  VAG+    +  P DV+KTR+      ++A + +   +      I+ EG   +++
Sbjct: 12  QFVAGAVAGISEILVMYPLDVVKTRMQLQLNTVSADERYNGVVDCFRKIIKKEGFSRLYK 71

Query: 263 GWLPSFARLGPNTILIFLVVEQLRKY 288
           G         P     F   ++ +K+
Sbjct: 72  GITSPVLMEAPKRATKFACNDEFQKF 97

>NCAS0A13150 Chr1 complement(2585310..2586407) [1098 bp, 365 aa]
           {ON} Anc_7.133
          Length = 365

 Score = 87.0 bits (214), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 134/297 (45%), Gaps = 29/297 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTA---ARPKPT---LFSMIQRILKNDGPLGLYSGLTA 73
           G + G ++ II  PLD+ K RLQ     +   P    +   +  I+ ++G  GLY GL  
Sbjct: 71  GALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGLIP 130

Query: 74  SILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMIS-GAIGGFVGNPADVVNIR 132
            IL         F  Y+F K+ L P    NS      CS I+ GA    + NP  VV  R
Sbjct: 131 IILGYFPTWMIYFSVYEFAKD-LYPRVLPNSDFISHSCSAITAGAASTVLTNPIWVVKTR 189

Query: 133 MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCK 192
           +   +      R +Y+  ID   +I  +EGVR L TGL P++  G+L  A     Y+  K
Sbjct: 190 LMLQTPLGES-RTHYRGTIDAFKKIITQEGVRTLYTGLVPSMF-GLLHVAIHFPVYEKLK 247

Query: 193 HNL---VTTFGFDASEKKTHFT----ASLVAGLVATTICSPADVIKTR--------IMNA 237
           + L     T G ++ E   H T    AS  + ++A+ +  P ++++TR        +++ 
Sbjct: 248 NRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDKLLISK 307

Query: 238 HQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQ 294
           H+     L ++  + R EGL   + G+  +  R  P + +  +  E  R   + ++Q
Sbjct: 308 HK----LLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFEYFRNALLKINQ 360

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 25  IVACIITHPLDLAKVRLQTAARP----KPTLFSMIQRILKNDGPLGLYSGLTASILRQCT 80
           ++A I+T+P ++ + R+Q  +      K  L  +I+R  + +G LG YSG   ++LR   
Sbjct: 280 MLASILTYPHEILRTRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVP 339

Query: 81  YTTARFGCYDFIKENLLPADKLNSTL 106
            +      +++ +  LL  ++ + +L
Sbjct: 340 ASAITLVSFEYFRNALLKINQDHPSL 365

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 6/86 (6%)

Query: 204 SEKKTHFTASLVAGLVATTICSPADVIKTRIMN------AHQHHESTLKVLSSSIRNEGL 257
           S+ K    +  +AG ++  I  P DV KTR+         + ++   L  +S+ + +EG+
Sbjct: 62  SDPKITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGV 121

Query: 258 GFMFRGWLPSFARLGPNTILIFLVVE 283
             +++G +P      P  ++ F V E
Sbjct: 122 RGLYKGLIPIILGYFPTWMIYFSVYE 147

>Skud_16.306 Chr16 complement(564985..567687) [2703 bp, 900 aa] {ON}
           YPR021C (REAL)
          Length = 900

 Score = 88.2 bits (217), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 125/278 (44%), Gaps = 30/278 (10%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRILKNDGPLGLYSGL 71
           Y +  G + G +   + +P+D  K R+Q   + A+ K ++  ++ +I+  +G  GLYSGL
Sbjct: 530 YNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQFKNSIDCLL-KIVSREGIKGLYSGL 588

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPAD 127
              ++        +    DF++  L   DK N  L LLP  +ISGA  G       NP +
Sbjct: 589 GPQLIGVAPEKAIKLTVNDFMRNRL--TDK-NGKLSLLP-EIISGASAGACQVIFTNPLE 644

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           +V IR+Q       ++  N + A +  T+I K  G++ L  G+   L+R V  +A    +
Sbjct: 645 IVKIRLQ---VQSDYVGENIQRANETATQIVKRLGLKGLYNGVAACLMRDVPFSAIYFPT 701

Query: 188 YDVCKHNLVTTFGFDASEKKTH--------FTASLVAGLVATTICSPADVIKTRIM---- 235
           Y   K +L   F FD ++K            TA  +AG+ A  + +P DVIKTR+     
Sbjct: 702 YAHLKKDL---FNFDPNDKTKRSRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPR 758

Query: 236 NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGP 273
                +      + + +R E     F+G      R  P
Sbjct: 759 KGETKYNGIFHAIRTILREESFRSFFKGGGARVLRSSP 796

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 81/196 (41%), Gaps = 27/196 (13%)

Query: 104 STLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGV 163
            +LY      I+G IG  V  P D +  RMQ   +        +KN+ID + +I   EG+
Sbjct: 527 DSLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRS-----LAQFKNSIDCLLKIVSREGI 581

Query: 164 RKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVA--- 220
           + L +GLGP L+      A ++   D  ++ L    G      K      +++G  A   
Sbjct: 582 KGLYSGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNG------KLSLLPEIISGASAGAC 635

Query: 221 -TTICSPADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARL 271
                +P +++K R+         N  + +E+  ++    ++  GL  ++ G      R 
Sbjct: 636 QVIFTNPLEIVKIRLQVQSDYVGENIQRANETATQI----VKRLGLKGLYNGVAACLMRD 691

Query: 272 GPNTILIFLVVEQLRK 287
            P + + F     L+K
Sbjct: 692 VPFSAIYFPTYAHLKK 707

>KAFR0K01110 Chr11 (231847..232863) [1017 bp, 338 aa] {ON} Anc_7.133
           YIL006W
          Length = 338

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 124/286 (43%), Gaps = 22/286 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT------LFSMIQRILKNDGPLGLYSGLTA 73
           G + G ++ ++  PLD+AK RLQ               F  I  I++++G  GLY G+  
Sbjct: 52  GALAGFISGLLVCPLDVAKTRLQAQGLQVSENSYYRGTFGTISTIVRDEGIFGLYKGIVP 111

Query: 74  SILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMIS-GAIGGFVGNPADVVNIR 132
            +L         F  Y+F K+ + P    +       CS I+ GA+   + NP  VV  R
Sbjct: 112 IVLGYFPSWMIYFSVYEFSKD-IYPKFFPHWDFLSHSCSAITAGAVSTTIMNPIWVVKTR 170

Query: 133 MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCK 192
           +   S   P    +Y    D   +I  +EGVR L TGL P+L  G+   A     Y+  K
Sbjct: 171 LMLQSNFSP-FPTHYNGTFDAFKKIISQEGVRVLYTGLVPSLF-GLSHVAIHFPIYEKLK 228

Query: 193 ---HNLVTTFGFDASEK-----KTHFTASLVAGLVATTICSPADVIKTRIMNAHQH---- 240
              H   T+   D + K     K    AS  + ++A+ I  P ++++TR+          
Sbjct: 229 VKLHCQKTSTEIDGTRKTTINLKNLICASSASKMIASLITYPHEILRTRMQVKSDLPSIV 288

Query: 241 HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
           H   L ++ S+  NEG+   + G+  +  R  P + +  +  E ++
Sbjct: 289 HHKLLPIIRSTYLNEGVAGFYSGFTANLLRTVPASAITLVSFEYIK 334

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 83/184 (45%), Gaps = 18/184 (9%)

Query: 115 SGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRN--YKNAIDGVTRIFKEEGVRKLLT 168
           +GA+ GF+      P DV   R+Q   A    +  N  Y+     ++ I ++EG+  L  
Sbjct: 51  AGALAGFISGLLVCPLDVAKTRLQ---AQGLQVSENSYYRGTFGTISTIVRDEGIFGLYK 107

Query: 169 GLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPAD 228
           G+ P +V G   +     S      ++   F F   +  +H  +++ AG V+TTI +P  
Sbjct: 108 GIVP-IVLGYFPSWMIYFSVYEFSKDIYPKF-FPHWDFLSHSCSAITAGAVSTTIMNPIW 165

Query: 229 VIKTRIMNAHQ------HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVV 282
           V+KTR+M          H+  T       I  EG+  ++ G +PS   L  +  + F + 
Sbjct: 166 VVKTRLMLQSNFSPFPTHYNGTFDAFKKIISQEGVRVLYTGLVPSLFGLS-HVAIHFPIY 224

Query: 283 EQLR 286
           E+L+
Sbjct: 225 EKLK 228

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 43/79 (54%), Gaps = 6/79 (7%)

Query: 211 TASLVAGLVATTICSPADVIKTRI------MNAHQHHESTLKVLSSSIRNEGLGFMFRGW 264
           TA  +AG ++  +  P DV KTR+      ++ + ++  T   +S+ +R+EG+  +++G 
Sbjct: 50  TAGALAGFISGLLVCPLDVAKTRLQAQGLQVSENSYYRGTFGTISTIVRDEGIFGLYKGI 109

Query: 265 LPSFARLGPNTILIFLVVE 283
           +P      P+ ++ F V E
Sbjct: 110 VPIVLGYFPSWMIYFSVYE 128

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 25  IVACIITHPLDLAKVRLQTAARPKP----TLFSMIQRILKNDGPLGLYSGLTASILRQCT 80
           ++A +IT+P ++ + R+Q  +         L  +I+    N+G  G YSG TA++LR   
Sbjct: 262 MIASLITYPHEILRTRMQVKSDLPSIVHHKLLPIIRSTYLNEGVAGFYSGFTANLLRTVP 321

Query: 81  YTTARFGCYDFIKENL 96
            +      +++IK + 
Sbjct: 322 ASAITLVSFEYIKSSF 337

>KNAG0E03550 Chr5 (710651..711781) [1131 bp, 376 aa] {ON} Anc_7.133
           YIL006W
          Length = 376

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 137/289 (47%), Gaps = 27/289 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQT----AARPKPT---LFSMIQRILKNDGPLGLYSGLT 72
           G + G ++ I+  PLD+ K RLQ     AA   P    +F  +  I+K++G  GLY GL 
Sbjct: 85  GALAGFISGIMVCPLDVTKTRLQAQGLQAATENPYYKGIFGTMSTIVKDEGVRGLYKGLV 144

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMIS-GAIGGFVGNPADVVNI 131
             IL         F  Y++ K N+ P     S      CS I+ GA+   V NP  V+  
Sbjct: 145 PIILGYFPTWMIYFSVYEYSK-NVYPKLFPYSDFISHSCSAITAGAVSTTVTNPIWVIKT 203

Query: 132 RMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
           R+   +  +  L  +YK  +D    I+++EG+R   TGL P+L+ G+   A     Y+  
Sbjct: 204 RLMLQTNAQDQL-THYKGTLDAFRCIWRQEGLRAFYTGLVPSLL-GLFHVAIHFPVYEKL 261

Query: 192 K-HNLVTTFGFDASEKKTHFT--------ASLVAGLVATTICSPADVIKTRI-----MNA 237
           K H    +   D S+ + ++T        AS V+ +VA+ +  P ++++TR+     +  
Sbjct: 262 KIHFRCYSIARD-SKGQQYYTINLPNLIMASSVSKMVASVLTYPHEILRTRMQLKADLPT 320

Query: 238 HQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
           + HH+  L ++ ++ + EG    + G+  +  R  P + +  +  E +R
Sbjct: 321 NIHHK-LLPMIRNTYKYEGWRAFYSGFTANILRTVPASAITLVSFEYVR 368

 Score = 69.3 bits (168), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/187 (32%), Positives = 90/187 (48%), Gaps = 17/187 (9%)

Query: 112 SMISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
           + +SGA+ GF+      P DV   R+Q            YK     ++ I K+EGVR L 
Sbjct: 81  TAVSGALAGFISGIMVCPLDVTKTRLQAQGLQAATENPYYKGIFGTMSTIVKDEGVRGLY 140

Query: 168 TGLGPNLVRGVLMTASQVVS-YDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSP 226
            GL P ++ G   T     S Y+  K+     F +  S+  +H  +++ AG V+TT+ +P
Sbjct: 141 KGLVP-IILGYFPTWMIYFSVYEYSKNVYPKLFPY--SDFISHSCSAITAGAVSTTVTNP 197

Query: 227 ADVIKTRIM---NAHQ---HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILI-F 279
             VIKTR+M   NA     H++ TL       R EGL   + G +PS   LG   + I F
Sbjct: 198 IWVIKTRLMLQTNAQDQLTHYKGTLDAFRCIWRQEGLRAFYTGLVPSL--LGLFHVAIHF 255

Query: 280 LVVEQLR 286
            V E+L+
Sbjct: 256 PVYEKLK 262

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 6/86 (6%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT-----LFSMIQRILKNDGPLGLYSGLTAS 74
             V  +VA ++T+P ++ + R+Q  A   PT     L  MI+   K +G    YSG TA+
Sbjct: 291 SSVSKMVASVLTYPHEILRTRMQLKAD-LPTNIHHKLLPMIRNTYKYEGWRAFYSGFTAN 349

Query: 75  ILRQCTYTTARFGCYDFIKENLLPAD 100
           ILR    +      +++++ N+  AD
Sbjct: 350 ILRTVPASAITLVSFEYVRNNMPKAD 375

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/87 (20%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 204 SEKKTHFTASLVAGLVATTICSPADVIKTRIM-------NAHQHHESTLKVLSSSIRNEG 256
           ++ K    +  +AG ++  +  P DV KTR+          + +++     +S+ +++EG
Sbjct: 76  NDAKVTAVSGALAGFISGIMVCPLDVTKTRLQAQGLQAATENPYYKGIFGTMSTIVKDEG 135

Query: 257 LGFMFRGWLPSFARLGPNTILIFLVVE 283
           +  +++G +P      P  ++ F V E
Sbjct: 136 VRGLYKGLVPIILGYFPTWMIYFSVYE 162

>TDEL0C04440 Chr3 (792021..792956) [936 bp, 311 aa] {ON} Anc_2.227
           YIL134W
          Length = 311

 Score = 85.9 bits (211), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 130/294 (44%), Gaps = 35/294 (11%)

Query: 24  GIVACIITHPLDLAKVRLQTAARPKPTL-FS-MIQRILKNDGPLGL------YSGLTASI 75
           G +  ++ HPLDL K+RLQ  A     L +S +I  ILK      L      Y GL  + 
Sbjct: 19  GSITTLVVHPLDLVKIRLQLLATNANNLGYSYVIGSILKGGQGKSLQIVKEAYRGLGINW 78

Query: 76  LRQCTYTTARFGCYDFIK--------------ENLLPADKLNSTLYLLPCSMISGAIGGF 121
               T     FG Y   K              ++ L  D   + L  L    ISGA+   
Sbjct: 79  FGNATAWALYFGLYRVSKDLAYRLYTPGAEAGQDELRKDAKLTPLMYLSSGAISGALTSI 138

Query: 122 VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMT 181
           + NP  V+  R+ + ++ E   + +YK+ +DG+ ++ +EEG R L  GL P+L  GV   
Sbjct: 139 LTNPIWVIKTRIMSTNSRE---KSSYKSTLDGIQKLLREEGARGLWRGLIPSLF-GVSQG 194

Query: 182 ASQVVSYDVCKHNLVTTFGF------DASEKKTH-FTASLVAGLVATTICSPADVIKTRI 234
           A   + YD  KH   +   +      D + K T  F  S ++ +V+ T   P  ++K+ +
Sbjct: 195 AIYFMMYDTLKHRFSSLRHYEGKVNQDKNLKITETFVISSISKVVSVTAVYPFQLLKSNL 254

Query: 235 MN--AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
            +  A +   +  K++ S    EG    ++G   +  R  P+T + F + E L+
Sbjct: 255 QSFEAQRKQYTFSKLIRSIFEAEGTMGFYKGLSANLLRAIPSTCITFCIYENLK 308

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 78/187 (41%), Gaps = 19/187 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVR-LQTAARPKPTLFSM---IQRILKNDGPLGLYSGLTASI 75
           G + G +  I+T+P+ + K R + T +R K +  S    IQ++L+ +G  GL+ GL  S+
Sbjct: 129 GAISGALTSILTNPIWVIKTRIMSTNSREKSSYKSTLDGIQKLLREEGARGLWRGLIPSL 188

Query: 76  LRQCTYTTARFGCYDFIK---------ENLLPADKLNSTLYLLPCSMISGAIGGFVGNPA 126
               +     F  YD +K         E  +  DK          S IS  +      P 
Sbjct: 189 F-GVSQGAIYFMMYDTLKHRFSSLRHYEGKVNQDKNLKITETFVISSISKVVSVTAVYPF 247

Query: 127 DVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
            ++   +Q+  A     R+ Y  +   +  IF+ EG      GL  NL+R +  T     
Sbjct: 248 QLLKSNLQSFEAQ----RKQYTFS-KLIRSIFEAEGTMGFYKGLSANLLRAIPSTCITFC 302

Query: 187 SYDVCKH 193
            Y+  K+
Sbjct: 303 IYENLKN 309

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 90/208 (43%), Gaps = 29/208 (13%)

Query: 113 MISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEG---VRKLLTG 169
           + +G+I   V +P D+V IR+Q  + +  +L   Y   I  + +  + +    V++   G
Sbjct: 16  LATGSITTLVVHPLDLVKIRLQLLATNANNL--GYSYVIGSILKGGQGKSLQIVKEAYRG 73

Query: 170 LGPNLVRGVLMTASQVVSYDVCK---HNLVTTFGFDASEKKTHFTASL----------VA 216
           LG N        A     Y V K   + L T  G +A + +    A L          ++
Sbjct: 74  LGINWFGNATAWALYFGLYRVSKDLAYRLYTP-GAEAGQDELRKDAKLTPLMYLSSGAIS 132

Query: 217 GLVATTICSPADVIKTRIMNAHQH----HESTLKVLSSSIRNEGLGFMFRGWLPSFARLG 272
           G + + + +P  VIKTRIM+ +      ++STL  +   +R EG   ++RG +PS   + 
Sbjct: 133 GALTSILTNPIWVIKTRIMSTNSREKSSYKSTLDGIQKLLREEGARGLWRGLIPSLFGVS 192

Query: 273 PNTILIFLV------VEQLRKYEIGMHQ 294
              I   +          LR YE  ++Q
Sbjct: 193 QGAIYFMMYDTLKHRFSSLRHYEGKVNQ 220

>KNAG0D01380 Chr4 complement(231548..232534) [987 bp, 328 aa] {ON}
           Anc_7.467 YJR095W
          Length = 328

 Score = 85.9 bits (211), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/315 (25%), Positives = 125/315 (39%), Gaps = 35/315 (11%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQ--------------TAAR 46
           MS  K ++SN V+      GG  G+   +  HPLD  KVR+Q              +A +
Sbjct: 1   MSSNKKKASNPVINL--VAGGTAGLFEALCCHPLDTIKVRMQIYRRATSKLNAAEHSAIK 58

Query: 47  PKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
           P P   +  + I   +G L LY GL A ++        RF  Y++ +   L ADK   ++
Sbjct: 59  P-PGFITTGKTIYGQEGFLALYKGLGAVVIGIIPKMAIRFSSYEWYRT--LLADKTTGSV 115

Query: 107 YLLPCSMISGAIGG-----FVGNPADVVNIRMQNDSAHEPHLRR---NYKNAIDGVTRIF 158
                + ++G + G      V NP +VV IR+Q     E  ++     YKNAI     I 
Sbjct: 116 S-TGNTFLAGVLAGTTEAVIVVNPMEVVKIRLQAQHLAEGAIKDVAPKYKNAIHAAYTIV 174

Query: 159 KEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGL 218
           KEEG+  +  G+     R      +    Y   K  L      +           L++G 
Sbjct: 175 KEEGIGAMYRGVSLTAARQASNQGANFTVYSKLKEFLQKYHNQEVLPSWETSCIGLISGA 234

Query: 219 VATTICSPADVIKTRIMNAHQHH-------ESTLKVLSSSIRNEGLGFMFRGWLPSFARL 271
           +     +P D IKTR+              +    +    I+ EG   +++G  P   R+
Sbjct: 235 IGPFSNAPLDTIKTRLQKDKSISSDKSSAWKKIATIGRQLIKEEGFRALYKGITPRVMRV 294

Query: 272 GPNTILIFLVVEQLR 286
            P   + F V E +R
Sbjct: 295 APGQAVTFTVYEYVR 309

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 74/189 (39%), Gaps = 18/189 (9%)

Query: 124 NPADVVNIRMQNDSAHEPHLRRNYKNAID-------GVTRIFKEEGVRKLLTGLGPNLVR 176
           +P D + +RMQ        L     +AI        G T I+ +EG   L  GLG  ++ 
Sbjct: 30  HPLDTIKVRMQIYRRATSKLNAAEHSAIKPPGFITTGKT-IYGQEGFLALYKGLGAVVIG 88

Query: 177 GVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMN 236
            +   A +  SY+  +  L        S   T     L     A  + +P +V+K R+  
Sbjct: 89  IIPKMAIRFSSYEWYRTLLADKTTGSVSTGNTFLAGVLAGTTEAVIVVNPMEVVKIRLQA 148

Query: 237 AH----------QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
            H            +++ +    + ++ EG+G M+RG   + AR   N    F V  +L+
Sbjct: 149 QHLAEGAIKDVAPKYKNAIHAAYTIVKEEGIGAMYRGVSLTAARQASNQGANFTVYSKLK 208

Query: 287 KYEIGMHQH 295
           ++    H  
Sbjct: 209 EFLQKYHNQ 217

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 39/92 (42%), Gaps = 11/92 (11%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQTAARPK-------PTLFSMIQRILKNDGP 64
           P W     G + G +      PLD  K RLQ               + ++ ++++K +G 
Sbjct: 221 PSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISSDKSSAWKKIATIGRQLIKEEGF 280

Query: 65  LGLYSGLTASILRQCTYTTARFGCYDFIKENL 96
             LY G+T  ++R        F  Y++++ +L
Sbjct: 281 RALYKGITPRVMRVAPGQAVTFTVYEYVRGHL 312

>NDAI0A07850 Chr1 (1805583..1806533) [951 bp, 316 aa] {ON} 
          Length = 316

 Score = 85.1 bits (209), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 124/283 (43%), Gaps = 32/283 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GGI   I+  P D  KVR+QT+     T   +I +++KN+G +G Y G    I+   
Sbjct: 40  GTCGGISQVIVGQPFDTTKVRMQTSTSQSTTAKEIISKLIKNEGLMGFYKGSLIPIVGVG 99

Query: 80  TYTTARFGCYDFIKENLLPAD----KLNSTLYLLP---CSMISGAIGGFVGNPADVVNIR 132
              + +FG  + +K     A+    + N TL L     C +  G I  F+ +P + V IR
Sbjct: 100 ACVSVQFGVNEAMKRFFHQANGTNARGNDTLSLKQYYICGLTGGVINSFLSSPIEHVRIR 159

Query: 133 MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG------VLMTASQVV 186
           +Q  +      +  +   ID + ++ KE   + L+ GL P ++R         +T   ++
Sbjct: 160 LQTQTGIG---KPEFNGPIDCIRKLLKE---KSLMRGLRPMMLRAGHGLGCYFLTYEALI 213

Query: 187 SYDVCKHNLVTTFGFDASEKKTH--FTASLVAGLVATTICSPADVIKTRI----MNAHQH 240
           + D+ K       G D  +       T   ++G V      P DV+K+ I    +   + 
Sbjct: 214 ARDIKK-------GMDRCDISAWKLCTYGSLSGTVLWLSIYPLDVVKSMIQTDTLRNPKF 266

Query: 241 HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           + S  KV++   R  G+   F+G++P+  R  P     F+  E
Sbjct: 267 NNSMRKVITHLYRTHGISSFFKGFVPTMLRAAPVNGATFVTFE 309

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 35/77 (45%)

Query: 212 ASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARL 271
           A    G+    +  P D  K R+  +     +  +++S  I+NEGL   ++G L     +
Sbjct: 39  AGTCGGISQVIVGQPFDTTKVRMQTSTSQSTTAKEIISKLIKNEGLMGFYKGSLIPIVGV 98

Query: 272 GPNTILIFLVVEQLRKY 288
           G    + F V E ++++
Sbjct: 99  GACVSVQFGVNEAMKRF 115

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 4/78 (5%)

Query: 19  YGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRIL----KNDGPLGLYSGLTAS 74
           YG + G V  +  +PLD+ K  +QT     P   + +++++    +  G    + G   +
Sbjct: 234 YGSLSGTVLWLSIYPLDVVKSMIQTDTLRNPKFNNSMRKVITHLYRTHGISSFFKGFVPT 293

Query: 75  ILRQCTYTTARFGCYDFI 92
           +LR      A F  ++ I
Sbjct: 294 MLRAAPVNGATFVTFECI 311

>KAFR0H02590 Chr8 complement(495267..496181) [915 bp, 304 aa] {ON}
           Anc_8.644 YOR222W
          Length = 304

 Score = 84.7 bits (208), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 128/295 (43%), Gaps = 28/295 (9%)

Query: 4   TKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQ----TAARPKPT-LFSMIQRI 58
           T ++S+     Y +  G + G+   ++ +PLD+ K R+Q     A +   T L   + +I
Sbjct: 7   TTAKSTPLPFIYQFTAGAIAGVSEVLVMYPLDVVKTRMQLQSNVAGKVHYTGLVDCLGKI 66

Query: 59  LKNDGPLGLYSGLTASILRQCTYTTARFGCYD-FIKENLLPADKLNSTLYLLPCSMISGA 117
           ++ +G   LY G+T+ IL +      +F   + F+          N     +     +G 
Sbjct: 67  VRQEGWKTLYRGITSPILMEAPKRATKFAFNEKFVNLYSQMFKTWNKQYICVVSGASAGV 126

Query: 118 IGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG 177
           I   V  P ++V +RMQ+       +   +K+ +D + RI K++G+  +  GL   ++R 
Sbjct: 127 IEATVIVPFELVKVRMQD-------INSKFKSPLDALKRIVKQDGLLGMYGGLESTMLRH 179

Query: 178 VLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNA 237
               A     Y    + +  T G D         A  + G +   + +P DV+K+R+ + 
Sbjct: 180 AFWNAG----YFGIIYQVRNTLGTDKKSTWNDLIAGTIGGTMGCILNTPFDVVKSRVQSQ 235

Query: 238 H-----------QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
           H           + ++  +  +    R EG   +++G+ P  ARLGP   ++ +V
Sbjct: 236 HNVTKLANGQLVKKYDWAIPSVMKIYREEGFRALYKGFTPKIARLGPGGGILLIV 290

>KAFR0L00800 Chr12 complement(149629..150558) [930 bp, 309 aa] {ON}
           Anc_7.228 YER053C
          Length = 309

 Score = 85.1 bits (209), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 119/285 (41%), Gaps = 24/285 (8%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           +GGI+AC  TH    PLDL K RLQ       + FS IQ I +N+G    ++GL A+ + 
Sbjct: 23  LGGIIACGPTHSLVTPLDLVKCRLQVKPGLYKSNFSGIQSIFRNEGAGKTFTGLGATFIG 82

Query: 78  QCTYTTARFGCYDFIK----ENLLPADKLNSTLYLLPCSMISGAIGGFVGN----PADVV 129
                  ++G Y++ K      L   D      +     +++ A   F  +    P + V
Sbjct: 83  YSLQGAGKYGGYEYFKHFYSSTLCRGDPETIHRWRTSVYLLASATAEFCADIMLCPFESV 142

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
            ++ Q  +   P       N  +GV +I+K EG+  L  G+ P   R +  T  +  S++
Sbjct: 143 KVKQQ--TTMPPFCN----NVFEGVNKIYKSEGIAALYKGIVPLWCRQIPYTMVKFTSFE 196

Query: 190 VCKHNLVTTFGFDASEKKT------HFTASLVAGLVATTICSPADVIKTRIMNAHQHHES 243
                + +      SE          FT   +AG++  T+  PADV+ +++ +  +  ES
Sbjct: 197 RIVEYIYSKLPMKKSEMSALQQISVSFTGGYLAGILCATVSHPADVLVSKVNSERKMTES 256

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
            +          G   ++ G       +G  T   +L+ +  + Y
Sbjct: 257 MMDATKRIYGKIGFMGLWNGLTVRIFMIGTLTSFQWLIYDSFKAY 301

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+   ++HP D+   ++ +  +   ++    +RI    G +GL++GLT  I    
Sbjct: 226 GYLAGILCATVSHPADVLVSKVNSERKMTESMMDATKRIYGKIGFMGLWNGLTVRIFMIG 285

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 286 TLTSFQWLIYDSFK 299

>Suva_16.345 Chr16 complement(605267..606529) [1263 bp, 420 aa] {ON}
           YPR021C (REAL)
          Length = 420

 Score = 85.9 bits (211), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 124/268 (46%), Gaps = 30/268 (11%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRILKNDGPLGLYSGL 71
           Y +  G + G +   I +P+D  K R+Q   + ++ K ++   + +I+  +G  GLYSGL
Sbjct: 50  YNFSLGSIAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSI-DCLMKIVSREGIKGLYSGL 108

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPAD 127
              ++        +    DF++  L   DK N  L LLP  +ISGA  G       NP +
Sbjct: 109 GPQLIGVAPEKAIKLTVNDFLRNRL--TDK-NGRLSLLP-EIISGASAGACQVIFTNPLE 164

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           +V IR+Q       ++  N + A +   +I ++ G++ L  G+   L+R V  +A    +
Sbjct: 165 IVKIRLQ---VQSDYVGENIQQANETAVQIVRKLGLKGLYNGVAACLMRDVPFSAIYFPT 221

Query: 188 YDVCKHNLVTTFGFDASEKKTH--------FTASLVAGLVATTICSPADVIKTRIMNAHQ 239
           Y   K +L   F FD ++K            TA  +AG+ A  + +P DVIKTR+    +
Sbjct: 222 YAHLKKDL---FNFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPR 278

Query: 240 HHESTLKVLSSSIR----NEGLGFMFRG 263
             E+    +  +IR     E     F+G
Sbjct: 279 KGETRYNGIFHAIRIILKEESFRSFFKG 306

 Score = 57.8 bits (138), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 82/192 (42%), Gaps = 19/192 (9%)

Query: 104 STLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGV 163
            +LY      I+G IG  +  P D V  RMQ   +        YKN+ID + +I   EG+
Sbjct: 47  DSLYNFSLGSIAGCIGATIVYPIDFVKTRMQAQRSLS-----QYKNSIDCLMKIVSREGI 101

Query: 164 RKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTI 223
           + L +GLGP L+      A ++   D  ++ L    G  +   +    AS  AG      
Sbjct: 102 KGLYSGLGPQLIGVAPEKAIKLTVNDFLRNRLTDKNGRLSLLPEIISGAS--AGACQVIF 159

Query: 224 CSPADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNT 275
            +P +++K R+         N  Q +E+ +++    +R  GL  ++ G      R  P +
Sbjct: 160 TNPLEIVKIRLQVQSDYVGENIQQANETAVQI----VRKLGLKGLYNGVAACLMRDVPFS 215

Query: 276 ILIFLVVEQLRK 287
            + F     L+K
Sbjct: 216 AIYFPTYAHLKK 227

>ZYRO0A07348g Chr1 (599958..601049) [1092 bp, 363 aa] {ON} similar
           to uniprot|Q03829 Saccharomyces cerevisiae YMR166C
          Length = 363

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 110/252 (43%), Gaps = 16/252 (6%)

Query: 7   ESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTA---ARPKPTLFSMIQRILKNDG 63
           E++N+ + +    GG GG +     H LD  K R Q A   A+ K  + +  + I   +G
Sbjct: 49  EATNSPILHCILAGGFGGAIGDTSMHSLDTVKTRQQGAPNVAKYK-NMLAAYRTIFVEEG 107

Query: 64  PL-GLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFV 122
              GLY G +A++L         FG Y+F K  L+     N TL  L    +   +  F+
Sbjct: 108 IFRGLYGGYSAAMLGSFPSAAIFFGTYEFSKRKLINEWGFNDTLTHLFAGFLGDLVSSFI 167

Query: 123 GNPADVVNIRMQ-----NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG 177
             P++V+  R+Q     N+S  +     NYKN  D +T + K EG   LL G    L R 
Sbjct: 168 YVPSEVLKTRLQLQGRYNNSHFDSGY--NYKNLRDCITTVVKTEGPVALLFGYKATLARD 225

Query: 178 VLMTASQVVSYDVCKHNLV----TTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTR 233
           +  +A Q+  Y+  +           G D     +  +   +AG VA  + +P DVIKTR
Sbjct: 226 LPFSALQLAFYEKFRQAAFKLEYKQIGQDHLSIMSELSTGALAGGVAGVLTTPLDVIKTR 285

Query: 234 IMNAHQHHESTL 245
           +        S L
Sbjct: 286 VQTQQTSPTSEL 297

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 80/202 (39%), Gaps = 24/202 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSM----------IQRILKNDGPLGLYS 69
           G +G +V+  I  P ++ K RLQ   R   + F            I  ++K +GP+ L  
Sbjct: 157 GFLGDLVSSFIYVPSEVLKTRLQLQGRYNNSHFDSGYNYKNLRDCITTVVKTEGPVALLF 216

Query: 70  GLTASILRQCTYTTARFGCYDFIKENLLPADKLN------STLYLLPCSMISGAIGGFVG 123
           G  A++ R   ++  +   Y+  ++     +         S +  L    ++G + G + 
Sbjct: 217 GYKATLARDLPFSALQLAFYEKFRQAAFKLEYKQIGQDHLSIMSELSTGALAGGVAGVLT 276

Query: 124 NPADVVNIRMQNDSAH------EPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG 177
            P DV+  R+Q           +P    +   +   +  ++K EG+    +G+GP  +  
Sbjct: 277 TPLDVIKTRVQTQQTSPTSELGKPASLSSSLFSSLRI--VYKSEGLIGFFSGVGPRFIWT 334

Query: 178 VLMTASQVVSYDVCKHNLVTTF 199
            + ++  +  Y      L T F
Sbjct: 335 SIQSSIMLFLYQYTLGRLNTIF 356

>TBLA0B10130 Chr2 (2438249..2439163) [915 bp, 304 aa] {ON} 
          Length = 304

 Score = 84.0 bits (206), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 130/288 (45%), Gaps = 32/288 (11%)

Query: 8   SSNAVVKYPW---WYGGVG-GIVACIITHPLDLAKVRLQTAAR---------PKPTLFSM 54
           S N V   P+   +  G G G+   ++ +PLD+ K R Q              K T+ + 
Sbjct: 2   SDNKVYPLPFLCQFLAGAGAGMSETLVMYPLDVVKTRFQLQETRILSLGKNIEKITMMTC 61

Query: 55  IQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLP---ADKLNSTLYLLPC 111
           + +I++N+    LY G+++ IL +      +F C D  +  L+      K N  + LL  
Sbjct: 62  LSKIIRNESIKHLYKGMSSPILMEVPKRAVKFSCNDLFQNILMKKSQTSKANGIITLLSG 121

Query: 112 SMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           ++ +G    F+  P ++V IR+Q+ ++       NY++    + +  + EG+  L  GL 
Sbjct: 122 TL-AGLFESFIVVPFELVKIRLQDANS-------NYRSPSHCLRKTIENEGITSLYKGLE 173

Query: 172 PNLVRGVLMTASQV-VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVI 230
             + R  +  AS   + Y V K  L+ T   +      +F A  +AG ++     P DVI
Sbjct: 174 ATVWRNSIWNASYFGLIYQVKK--LMPTQSTNDKSVGRNFIAGTIAGCMSCFFSVPFDVI 231

Query: 231 KTRIMNAHQH---HESTLKVLSSSI--RNEGLGFMFRGWLPSFARLGP 273
           KT+I  +      H S   +LS  +  +  GL  ++RG +P   R GP
Sbjct: 232 KTKIQVSKVSGCVHNSNWALLSVFLMYKKYGLRSIYRGIIPIICRYGP 279

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 79/174 (45%), Gaps = 5/174 (2%)

Query: 5   KSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGP 64
           KS++S A        G + G+    I  P +L K+RLQ A     +    +++ ++N+G 
Sbjct: 106 KSQTSKANGIITLLSGTLAGLFESFIVVPFELVKIRLQDANSNYRSPSHCLRKTIENEGI 165

Query: 65  LGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLN--STLYLLPCSMISGAIGGFV 122
             LY GL A++ R   +  + FG    +K+ L+P    N  S         I+G +  F 
Sbjct: 166 TSLYKGLEATVWRNSIWNASYFGLIYQVKK-LMPTQSTNDKSVGRNFIAGTIAGCMSCFF 224

Query: 123 GNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
             P DV+  ++Q           N+  A+  V  ++K+ G+R +  G+ P + R
Sbjct: 225 SVPFDVIKTKIQVSKVSGCVHNSNW--ALLSVFLMYKKYGLRSIYRGIIPIICR 276

>KAFR0B04850 Chr2 (1008173..1009255) [1083 bp, 360 aa] {ON}
           Anc_2.344 YMR166C
          Length = 360

 Score = 84.3 bits (207), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 128/291 (43%), Gaps = 26/291 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ--TAARPKPTLFSMIQRILKNDGPLG-LYSGLTASIL 76
           G +GG++   + H LD  K R Q  +AA+ K  L S   +IL  +G  G LYSG  A++L
Sbjct: 59  GAIGGVIGDSVMHSLDTVKTRQQGSSAAKYKRNLPSTYGKILLEEGLTGGLYSGYMAAML 118

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQND 136
                +   F  Y++ K  L+    +N T+  L   ++   +  F+  P++V+  R+Q  
Sbjct: 119 GSFPTSGVFFATYEYSKRVLINDFNVNDTVSHLCSGLLGDFVSSFIYVPSEVLKTRLQLQ 178

Query: 137 SAHEPHLRR---NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKH 193
             +     +   NYKN  + +  I K EG + L  G    L R +  +A Q+  Y+  + 
Sbjct: 179 GKYNNAFSQSNYNYKNLSNAIHHIIKTEGAQTLFFGYKATLARDLPFSALQLAFYEKFRK 238

Query: 194 NLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHE----------- 242
             +                   AG +A  I +P DV+KTR+    Q H+           
Sbjct: 239 WAILLEDTRHLSIGNEILTGAAAGGLAGMITTPLDVVKTRLQTQKQKHQQLRIPSSSILL 298

Query: 243 -----STLKVLSSSIRNEGLGFMFRGWLPSFARLG-PNTILIFLVVEQLRK 287
                +++KV+    +NEG+  +F G  P F      ++I++ L    L+K
Sbjct: 299 SNSLTNSMKVI---FQNEGVLGLFSGVGPRFIWTSVQSSIMLLLYQMTLKK 346

 Score = 57.8 bits (138), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 94/206 (45%), Gaps = 23/206 (11%)

Query: 100 DKLNSTLYLLPCSMISGAIGGFVGNPA----DVVNIRMQNDSAHEPHLRRNYKNAIDGVT 155
           D L +T  +  C  +SGAIGG +G+      D V  R Q  SA +   +RN  +      
Sbjct: 44  DDLAATSPISHC-FLSGAIGGVIGDSVMHSLDTVKTRQQGSSAAK--YKRNLPSTYG--- 97

Query: 156 RIFKEEGVRK-LLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASL 214
           +I  EEG+   L +G    ++     +     +Y+  K  L+    F+ ++  +H  + L
Sbjct: 98  KILLEEGLTGGLYSGYMAAMLGSFPTSGVFFATYEYSKRVLIN--DFNVNDTVSHLCSGL 155

Query: 215 VAGLVATTICSPADVIKTRIM------NAHQHHESTLKVLSSSI----RNEGLGFMFRGW 264
           +   V++ I  P++V+KTR+       NA        K LS++I    + EG   +F G+
Sbjct: 156 LGDFVSSFIYVPSEVLKTRLQLQGKYNNAFSQSNYNYKNLSNAIHHIIKTEGAQTLFFGY 215

Query: 265 LPSFARLGPNTILIFLVVEQLRKYEI 290
             + AR  P + L     E+ RK+ I
Sbjct: 216 KATLARDLPFSALQLAFYEKFRKWAI 241

>ADL009W Chr4 (693076..694215) [1140 bp, 379 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL006W and YEL006W
          Length = 379

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 130/288 (45%), Gaps = 27/288 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ-----TAARPKPTLFSMIQRILKNDGPLGLYSGLTAS 74
           G + G V+ I+  PLD+AK RLQ     +  R    +   +  IL+++G  GLY GL   
Sbjct: 91  GALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPI 150

Query: 75  ILRQCTYTTARFGCYDFIKE---NLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNI 131
           +L         F  Y+  K+   + LP   ++        ++ +GAI   + NP  VV  
Sbjct: 151 VLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHA----ASALTAGAISTALTNPIWVVKT 206

Query: 132 RM--QNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
           R+  Q+D + +     NY++ +D   ++++ EG++   +GL P+L  G+   A     Y+
Sbjct: 207 RLMIQSDVSRD---STNYRSTLDAFRKMYRSEGLKVFYSGLVPSLF-GLFHVAIHFPVYE 262

Query: 190 VCK----HNLVTTFGFDASEKKTHF----TASLVAGLVATTICSPADVIKTRIMNAHQHH 241
             K     N     G      K        AS ++ +VA+ I  P ++++TR+   H   
Sbjct: 263 KLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGV 322

Query: 242 ESTLKVLSSSIR-NEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
             +L  L   IR +EG    + G+  +  R  P +++  +  E  RKY
Sbjct: 323 PPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFEYFRKY 370

 Score = 67.0 bits (162), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 93/197 (47%), Gaps = 25/197 (12%)

Query: 112 SMISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
           + +SGA+ GFV      P DV   R+Q   A      R Y+  +  ++ I ++EGV  L 
Sbjct: 87  TAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGE--RYYRGIVGTLSAILRDEGVAGLY 144

Query: 168 TGLGPNLVRGVLMTASQVVS-YDVCKHNLVTTF--GFDASEKKTHFTASLVAGLVATTIC 224
            GL P +V G   T     S Y+ CK    +    GF      +H  ++L AG ++T + 
Sbjct: 145 KGLAP-IVLGYFPTWMLYFSVYEKCKQRYPSYLPGGF-----VSHAASALTAGAISTALT 198

Query: 225 SPADVIKTRIM------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILI 278
           +P  V+KTR+M          ++ STL       R+EGL   + G +PS   L  +  + 
Sbjct: 199 NPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGLF-HVAIH 257

Query: 279 FLVVEQLRKYEIGMHQH 295
           F V E+L+   I +H++
Sbjct: 258 FPVYEKLK---IWLHRN 271

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 25  IVACIITHPLDLAKVRLQTA-ARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTT 83
           +VA +IT+P ++ + R+Q   +   P+L +++ RI  ++G +G YSG   +++R    + 
Sbjct: 299 VVASVITYPHEILRTRMQVRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASV 358

Query: 84  ARFGCYDFIKENL 96
                +++ ++ L
Sbjct: 359 ITLVSFEYFRKYL 371

>YMR166C Chr13 complement(593367..594473) [1107 bp, 368 aa] {ON}
           Predicted transporter of the mitochondrial inner
           membrane; has similarity to human mitochondrial
           ATP-Mg/Pi carriers; YMR166C is not an essential gene
          Length = 368

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 103/242 (42%), Gaps = 14/242 (5%)

Query: 16  PWWY----GGVGGIVACIITHPLDLAKVRLQTAARPKP--TLFSMIQRILKNDG-PLGLY 68
           P W+    GG+GG +     H LD  K R Q A   K    + S  + I   +G   GLY
Sbjct: 52  PIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLY 111

Query: 69  SGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADV 128
            G  A++L         FG Y++ K  ++   ++N T+  L    +   I  FV  P++V
Sbjct: 112 GGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLSAGFLGDFISSFVYVPSEV 171

Query: 129 VNIRMQ-NDSAHEPHLRR--NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQV 185
           +  R+Q     + P  +   NY N  + +  + KEEG R L  G    L R +  +A Q 
Sbjct: 172 LKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQF 231

Query: 186 VSYDVCKHNLVTTFGFDASEKKTHFTASLV----AGLVATTICSPADVIKTRIMNAHQHH 241
             Y+  +         D  + +      ++    AG +A  I +P DV+KTR+       
Sbjct: 232 AFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQQPPS 291

Query: 242 ES 243
           +S
Sbjct: 292 QS 293

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 88/215 (40%), Gaps = 33/215 (15%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLF----------SMIQRILKNDGPLGLYS 69
           G +G  ++  +  P ++ K RLQ   R     F          + I+ ++K +G   L+ 
Sbjct: 155 GFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFF 214

Query: 70  GLTASILRQCTYTTARFGCYDFIKE---NLLPADKLNSTLYLLPCSMISGA----IGGFV 122
           G  A++ R   ++  +F  Y+  ++    +   D  +  L + P  +++GA    + G +
Sbjct: 215 GYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSI-PNEILTGACAGGLAGII 273

Query: 123 GNPADVVNIRMQND----------SAHEPHLRRNYKNAIDG-----VTRIFKEEGVRKLL 167
             P DVV  R+Q            S   PH+      A+       +  +++ EGV    
Sbjct: 274 TTPMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFF 333

Query: 168 TGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFD 202
           +G+GP  V   + ++  ++ Y +    L   F  D
Sbjct: 334 SGVGPRFVWTSVQSSIMLLLYQMTLRGLSNAFPTD 368

>Smik_16.262 Chr16 complement(476377..479085) [2709 bp, 902 aa] {ON}
           YPR021C (REAL)
          Length = 902

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 74/278 (26%), Positives = 125/278 (44%), Gaps = 30/278 (10%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRILKNDGPLGLYSGL 71
           Y +  G + G +   + +P+D  K R+Q   + A+ K ++  ++ +I+  +G  GLYSGL
Sbjct: 532 YNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLL-KIVSREGIKGLYSGL 590

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPAD 127
              ++        +    DF++  L   DK N  L LLP  +ISGA  G       NP +
Sbjct: 591 GPQLIGVAPEKAIKLTVNDFMRNRL--TDK-NGKLSLLP-EIISGASAGACQVIFTNPLE 646

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           +V IR+Q  S    ++  N + A +   +I K+  ++ L  G+   L+R V  +A    +
Sbjct: 647 IVKIRLQVQSE---YVGENIQQANETAVQIVKKLRLKGLYNGVAACLMRDVPFSAIYFPT 703

Query: 188 YDVCKHNLVTTFGFDASEKKTH--------FTASLVAGLVATTICSPADVIKTRIM---- 235
           Y   K +L   F FD ++K            TA  +AG+ A  + +P DVIKTR+     
Sbjct: 704 YAHLKKDL---FDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPR 760

Query: 236 NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGP 273
                +      + + ++ E     F+G      R  P
Sbjct: 761 KGETKYNGIFHAIRTILKEENFKSFFKGGGARVLRSSP 798

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 49/191 (25%), Positives = 83/191 (43%), Gaps = 19/191 (9%)

Query: 105 TLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
           +LY      I+G IG  V  P D +  RMQ   +        YKN+ID + +I   EG++
Sbjct: 530 SLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRS-----LAQYKNSIDCLLKIVSREGIK 584

Query: 165 KLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTIC 224
            L +GLGP L+      A ++   D  ++ L    G  +   +    AS  AG       
Sbjct: 585 GLYSGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNGKLSLLPEIISGAS--AGACQVIFT 642

Query: 225 SPADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTI 276
           +P +++K R+         N  Q +E+ ++++   +R +GL   + G      R  P + 
Sbjct: 643 NPLEIVKIRLQVQSEYVGENIQQANETAVQIV-KKLRLKGL---YNGVAACLMRDVPFSA 698

Query: 277 LIFLVVEQLRK 287
           + F     L+K
Sbjct: 699 IYFPTYAHLKK 709

 Score = 38.1 bits (87), Expect = 0.027,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 4/78 (5%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT----LFSMIQRILKNDGPLGLYSGLTASI 75
           G + G+ A  +T P D+ K RLQ   R   T    +F  I+ ILK +     + G  A +
Sbjct: 734 GAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEENFKSFFKGGGARV 793

Query: 76  LRQCTYTTARFGCYDFIK 93
           LR           Y+  K
Sbjct: 794 LRSSPQFGFTLAAYELFK 811

>NDAI0D00510 Chr4 complement(105042..106088) [1047 bp, 348 aa] {ON} 
          Length = 348

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/312 (26%), Positives = 120/312 (38%), Gaps = 49/312 (15%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP---KPTLFSMIQR-ILKNDGPLGLYSGLTASI 75
           GG  G+   +  HPLD  KVR+Q A R    KP  F      I   +G L LY GL A +
Sbjct: 19  GGTAGLFEALCCHPLDTIKVRMQIARRSANIKPHGFIKTGNLIYSQEGFLALYKGLGAVV 78

Query: 76  LRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNPADVVN 130
           +        RF  Y++ +  L   +K   T+     + I+G   G      V NP +VV 
Sbjct: 79  MGIIPKMAIRFSSYEYYRSAL--TNKETQTIST-GNTFIAGVGAGITEAVLVVNPMEVVK 135

Query: 131 IRMQNDSAHEPHLRR----------------------------NYKNAIDGVTRIFKEEG 162
           IR+Q  S H P                                 Y NAI  V  I KEEG
Sbjct: 136 IRLQ--SQHIPVTAPAVTATSAVLSSGGTAAATGTAAAVGSAPKYTNAIHAVYTIVKEEG 193

Query: 163 VRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATT 222
           V  L  G+     R      +    Y   K  L      ++          L++G +   
Sbjct: 194 VSALYRGVSLTAARQATNQGANFTVYSQLKDYLQKYHKVESLPSWETSLVGLISGAIGPF 253

Query: 223 ICSPADVIKTRIMNAH----QHHESTLKVL---SSSIRNEGLGFMFRGWLPSFARLGPNT 275
             +P D IKTR+   H    ++H +  K+    +  I+ EG   +++G  P   R+ P  
Sbjct: 254 SNAPLDTIKTRLQKDHSLSSKNHSAWKKITIIGTQLIKEEGFRALYKGITPRVMRVAPGQ 313

Query: 276 ILIFLVVEQLRK 287
            + F V E +RK
Sbjct: 314 AVTFTVYEFVRK 325

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 43/98 (43%), Gaps = 15/98 (15%)

Query: 16  PWWYGGVGGIVACII----THPLDLAKVRLQT---------AARPKPTLFSMIQRILKND 62
           P W   + G+++  I      PLD  K RLQ          +A  K T+     +++K +
Sbjct: 236 PSWETSLVGLISGAIGPFSNAPLDTIKTRLQKDHSLSSKNHSAWKKITIIGT--QLIKEE 293

Query: 63  GPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPAD 100
           G   LY G+T  ++R        F  Y+F+++ +   D
Sbjct: 294 GFRALYKGITPRVMRVAPGQAVTFTVYEFVRKQMEKYD 331

>NCAS0B01360 Chr2 (223374..224294) [921 bp, 306 aa] {ON} Anc_8.644
          Length = 306

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 135/305 (44%), Gaps = 38/305 (12%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQ---------TAARPKPTL 51
           MS   +  +    +Y +  G + GI   ++ +PLD+ K R+Q          +A     +
Sbjct: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60

Query: 52  FSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYD-FIK--ENLLPADKLNSTLYL 108
              + +I+K +GP+ +Y G+++ +L +      +F   D FIK  +++    +L   +  
Sbjct: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI-- 118

Query: 109 LPCSMISGAIGG----FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
              S++SGA  G     V  P ++V IR+Q+       +   +K  ++ +  I K++G++
Sbjct: 119 ---SVLSGASAGITEALVIVPFELVKIRLQD-------VNSKFKGPVEVLKHIIKQDGLK 168

Query: 165 KLLTGLGPNLVRGVLMTASQV-VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTI 223
            L +G+   + R  +  A    V + V    L+        + +    A  V G      
Sbjct: 169 GLYSGVESTVWRNAVWNAGYFGVIFQV--RELLPVAKSKQEKTRNDLCAGFVGGTFGVMF 226

Query: 224 CSPADVIKTR-------IMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTI 276
            +P DV+K+R       I+N  + +  T   +      EG   +++G++P   RLGP   
Sbjct: 227 NTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGA 286

Query: 277 LIFLV 281
           ++ +V
Sbjct: 287 VLLVV 291

>TDEL0F03170 Chr6 (581231..582133) [903 bp, 300 aa] {ON} Anc_3.435
           YGR096W
          Length = 300

 Score = 82.4 bits (202), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 123/293 (41%), Gaps = 49/293 (16%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ----TAARPKPTLFSMIQRILKNDGPLGLYSGLTASI 75
           G V G++A   T P+D  K+RLQ     A+  K    ++++ +L  +G  GL+ G     
Sbjct: 22  GSVSGLLARFGTAPMDTIKIRLQITPGNASSGKA--LNVVKEMLHKEGIRGLWKGNVPGS 79

Query: 76  LRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQN 135
           L    Y   +FG Y F  + L P    NS  +      ++G    FV  P DV+  R   
Sbjct: 80  LMYVVYGGVQFGTYTFYNQLLSPL-AWNSQWHSFVVGALAGMSSSFVSYPFDVLRTRFVA 138

Query: 136 DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCK--- 192
           D + +    RN       +TR+F+E+G R L  GL  ++V   L T+    +Y+  +   
Sbjct: 139 DRSRQLSTLRN------TITRVFREDGPRGLFKGLTSSMVTITLATSILFSTYESIRIYC 192

Query: 193 --------HNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQ----- 239
                   H  + TF            AS +AGL++     P D I+ R++ ++      
Sbjct: 193 ERPQRNALHRTLDTF------------ASPIAGLISKLATFPLDTIRRRLVLSNSSDHKS 240

Query: 240 --------HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQ 284
                   H  S  ++    IR EG+  ++RG   +  +  P+T +     E+
Sbjct: 241 FGNLYKSYHRRSVAQIGLQIIRQEGITALYRGVTMALCKSVPSTAISLWSFER 293

>CAGL0F07711g Chr6 complement(751794..752900) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q03829 Saccharomyces cerevisiae
           YMR166c
          Length = 368

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 99/233 (42%), Gaps = 14/233 (6%)

Query: 16  PWWY----GGVGGIVACIITHPLDLAKVRLQTAA---RPKPTLFSMIQRILKNDGPLGLY 68
           P W+    GGVGGI+     H LD  K R Q A    + K  L +     ++     GLY
Sbjct: 52  PIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLY 111

Query: 69  SGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADV 128
            G  A++L         F  Y+F K  ++    LN T   L    +      FV  P++V
Sbjct: 112 GGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLTAGFLGDFFSSFVYVPSEV 171

Query: 129 VNIRMQNDSAH-EPHLRR--NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQV 185
           +  R+Q    +  PH     NYK+  + +  I++ EGV  L  G    L R +  +A Q 
Sbjct: 172 LKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFSALQF 231

Query: 186 VSYDVCKHNLVTTFGFDASEKKTHFTASLV----AGLVATTICSPADVIKTRI 234
             Y+  +       G D  +     +  +V    AG +A  + +P DV+KTR+
Sbjct: 232 AFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVKTRV 284

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 55/131 (41%), Gaps = 16/131 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ----------TAARPKPTLFSMIQRILKNDGPLGLYS 69
           G +G   +  +  P ++ K RLQ           +     +L + I  I + +G   L+ 
Sbjct: 155 GFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFF 214

Query: 70  GLTASILRQCTYTTARFGCYDFIKE--NLLPADKLNSTLYLLPCSMISGA----IGGFVG 123
           G  A++ R   ++  +F  Y+  ++   LL    +      +   +++GA    + G + 
Sbjct: 215 GYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILT 274

Query: 124 NPADVVNIRMQ 134
            P DVV  R+Q
Sbjct: 275 TPLDVVKTRVQ 285

>ADL049W Chr4 (598132..600870) [2739 bp, 912 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR021C
          Length = 912

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 124/276 (44%), Gaps = 27/276 (9%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQTA---ARPKPTLFSMIQRILKNDGPLGLYSGL 71
           Y +  G V G +  ++ +P+D+ K R+Q     ++ K ++  ++ +IL  +G  GLYSGL
Sbjct: 526 YNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLL-KILSKEGVRGLYSGL 584

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPAD-KLNSTLYLLPCSMISGAIGG----FVGNPA 126
              ++        +    D ++  L   D KL+     LPC +ISGA  G       NP 
Sbjct: 585 GPQLIGVAPEKAIKLTVNDHMRATLAGRDGKLS-----LPCEIISGATAGACQVVFTNPL 639

Query: 127 DVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
           ++V IR+Q  S +     RN  NAI     + K  G+  L  G G  L+R +  +A    
Sbjct: 640 EIVKIRLQVKSDYVADAARNSVNAIS----VIKNLGLIGLYRGAGACLLRDIPFSAIYFP 695

Query: 187 SYDVCKHNLVTTFGFDASEKKTHFTASL-----VAGLVATTICSPADVIKTRIMNAHQHH 241
           +Y   K N+      D+ ++    T  L     +AG+ A  + +P DVIKTR+    +  
Sbjct: 696 TYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKG 755

Query: 242 ESTLKVLSSSIR----NEGLGFMFRGWLPSFARLGP 273
           ES    +  + R     EG+   F+G      R  P
Sbjct: 756 ESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSP 791

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 86/199 (43%), Gaps = 22/199 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQT-------AARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           G   G    + T+PL++ K+RLQ        AAR      S+I    KN G +GLY G  
Sbjct: 625 GATAGACQVVFTNPLEIVKIRLQVKSDYVADAARNSVNAISVI----KNLGLIGLYRGAG 680

Query: 73  ASILRQCTYTTARFGCYDFIKENLL-----PADKLN--STLYLLPCSMISGAIGGFVGNP 125
           A +LR   ++   F  Y  IK N+       +DK N  +T  LL    ++G    F+  P
Sbjct: 681 ACLLRDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTP 740

Query: 126 ADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQV 185
            DV+  R+Q D      +   Y    D    I KEEG++    G    ++R        +
Sbjct: 741 FDVIKTRLQIDPKKGESV---YNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTL 797

Query: 186 VSYDVCKHNLVTTFGFDAS 204
            +Y++  HNL     +D S
Sbjct: 798 AAYEIF-HNLFPAPRYDDS 815

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 81/195 (41%), Gaps = 34/195 (17%)

Query: 104 STLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGV 163
            ++Y      ++G IG  V  P D+V  RMQ            YKN+ID + +I  +EGV
Sbjct: 523 DSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSK-----YKNSIDCLLKILSKEGV 577

Query: 164 RKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDAS-EKKTHFTASLVAGLVATT 222
           R L +GLGP L+ GV     + +   V  H   T  G D          +   AG     
Sbjct: 578 RGLYSGLGPQLI-GV--APEKAIKLTVNDHMRATLAGRDGKLSLPCEIISGATAGACQVV 634

Query: 223 ICSPADVIKTR-------IMNAHQHHESTLKVLSSSIRNEGLGFMFRG------------ 263
             +P +++K R       + +A ++  + + V    I+N GL  ++RG            
Sbjct: 635 FTNPLEIVKIRLQVKSDYVADAARNSVNAISV----IKNLGLIGLYRGAGACLLRDIPFS 690

Query: 264 --WLPSFARLGPNTI 276
             + P++A +  N  
Sbjct: 691 AIYFPTYAHIKSNVF 705

>Skud_16.344 Chr16 (638589..639509) [921 bp, 306 aa] {ON} YPR058W
           (REAL)
          Length = 306

 Score = 82.4 bits (202), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 127/291 (43%), Gaps = 24/291 (8%)

Query: 7   ESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLG 66
           + +NA V      G  GGI   ++  P D  KVRLQ ++ PK T   +++++L N+GP G
Sbjct: 19  QHNNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQVSSTPK-TAMEVVKKLLANEGPRG 77

Query: 67  LYSGLTASILRQCTYTTARFGCYD-----FIKENLLPADKLNSTLYLLPCSMISGAIGGF 121
            Y G    ++      + +FG  +     F + N+  +  L+ + Y   C +  G +  F
Sbjct: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHQRNVSESSTLSLSQY-YSCGVTGGIVNSF 136

Query: 122 VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMT 181
           + +P + V IR+Q  +    +    +K  ++ +  + K +G   LL GL P ++R     
Sbjct: 137 LASPIEHVRIRLQTQTGSGANAE--FKGPLECIKNLRKNKG---LLRGLTPTILREGHGC 191

Query: 182 ASQVVSYDVCKHNLVTTFGFDASE----KKTHFTASLVAGLVATTICSPADVIKTRIMNA 237
            +  + Y+    N +   G +  +    K   F A  ++G     +  P DVIK+ +M  
Sbjct: 192 GTYFLVYEALIANQINNRGLERRDIPAWKLCIFGA--LSGTALWLMVYPLDVIKS-VMQT 248

Query: 238 HQHHESTLKVLSSSIRNE-----GLGFMFRGWLPSFARLGPNTILIFLVVE 283
               +       SS+  +     G+G  F+G+ P+  R  P     F   E
Sbjct: 249 DDLQKPKFGNSISSVAKKLYARGGVGAFFKGFGPTMLRAAPANGATFATFE 299

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 82/197 (41%), Gaps = 19/197 (9%)

Query: 6   SESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTA------ARPKPTLFSMIQRIL 59
           SESS   +   +  G  GGIV   +  P++  ++RLQT       A  K  L   I+ + 
Sbjct: 113 SESSTLSLSQYYSCGVTGGIVNSFLASPIEHVRIRLQTQTGSGANAEFKGPL-ECIKNLR 171

Query: 60  KNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIG 119
           KN    GL  GLT +ILR+       F  Y+ +  N +    L           I GA+ 
Sbjct: 172 KNK---GLLRGLTPTILREGHGCGTYFLVYEALIANQINNRGLERRDIPAWKLCIFGALS 228

Query: 120 G----FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVT-RIFKEEGVRKLLTGLGPNL 174
           G     +  P DV+   MQ D   +P     + N+I  V  +++   GV     G GP +
Sbjct: 229 GTALWLMVYPLDVIKSVMQTDDLQKP----KFGNSISSVAKKLYARGGVGAFFKGFGPTM 284

Query: 175 VRGVLMTASQVVSYDVC 191
           +R      +   ++++ 
Sbjct: 285 LRAAPANGATFATFELA 301

>SAKL0F05038g Chr6 complement(400575..401741) [1167 bp, 388 aa] {ON}
           similar to uniprot|P40556 Saccharomyces cerevisiae
           YIL006W Pvruvate transporter of the mitochondrial inner
           membrane member of the mitochondrial carrier family has
           putative mouse and human orthologs
          Length = 388

 Score = 83.2 bits (204), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 129/297 (43%), Gaps = 44/297 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAA--RPKPTLFSMI----QRILKNDGPLGLYSGLTA 73
           G + G +A I   PLD+AK RLQ        P+ ++ I      I+K++   GLY GL  
Sbjct: 98  GALAGFLAGITVCPLDVAKTRLQAQGLKSSNPSYYNGIVGTLSTIVKDESVRGLYKGLVP 157

Query: 74  SILRQCTYTTARFGCYDFIKE---NLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVN 130
            I+         F  Y+  K+    L  +D ++ +      +M +GA+   + NP  VV 
Sbjct: 158 IIMGYFPTWMIYFSVYERCKKIYPGLFSSDFISHSF----SAMTAGAVSTAITNPIWVVK 213

Query: 131 IRMQ------NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
            R+       NDS +       YK  I    +I+  EG++   +GL P+L  G+   A  
Sbjct: 214 TRLMLQTHVGNDSMY-------YKGTIHAFKKIYSTEGIKVFYSGLVPSLF-GLFHVAIH 265

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTH-------FTASLVAGLVATTICSPADVIKTRIM-- 235
              Y+  K     T     S K+ H         AS  + +VA+T+  P ++++TR+   
Sbjct: 266 FPVYEKLKVWFHCT--QQTSNKREHNINLGRLIAASCTSKMVASTLTYPHEILRTRMQIK 323

Query: 236 ----NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
                A QH    LK++ ++   EGL   + G+  +  R  P + +  +  E  RKY
Sbjct: 324 STLPRASQH--GLLKMIQTTYAKEGLRGFYSGFTTNLVRTVPASAITLVSFEYFRKY 378

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 89/187 (47%), Gaps = 19/187 (10%)

Query: 112 SMISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRNYKNAIDG-VTRIFKEEGVRKL 166
           + +SGA+ GF+      P DV   R+Q       +   +Y N I G ++ I K+E VR L
Sbjct: 94  TALSGALAGFLAGITVCPLDVAKTRLQAQGLKSSN--PSYYNGIVGTLSTIVKDESVRGL 151

Query: 167 LTGLGPNLVRGVLMTASQVVS-YDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICS 225
             GL P ++ G   T     S Y+ CK       G  +S+  +H  +++ AG V+T I +
Sbjct: 152 YKGLVP-IIMGYFPTWMIYFSVYERCKKIYP---GLFSSDFISHSFSAMTAGAVSTAITN 207

Query: 226 PADVIKTRIM------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIF 279
           P  V+KTR+M      N   +++ T+         EG+   + G +PS   L  +  + F
Sbjct: 208 PIWVVKTRLMLQTHVGNDSMYYKGTIHAFKKIYSTEGIKVFYSGLVPSLFGLF-HVAIHF 266

Query: 280 LVVEQLR 286
            V E+L+
Sbjct: 267 PVYEKLK 273

>KNAG0I00800 Chr9 (143143..144255) [1113 bp, 370 aa] {ON} Anc_2.344
           YMR166C
          Length = 370

 Score = 82.8 bits (203), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 126/300 (42%), Gaps = 36/300 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAAR--PKPTLFSMIQRILKNDGPL-GLYSGLTASIL 76
           GG+GG++   + H LD  K R Q  A       ++   + ++  +G + GLY G  A++L
Sbjct: 62  GGIGGVIGDSVMHSLDTVKTRQQGTAMTLKYRDMWHAYRTVVVEEGVIRGLYGGYAAAML 121

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGN----PADVVNIR 132
                    FG Y++ K  +L   ++N +L    C +++G +G  V +    P++V   R
Sbjct: 122 GSFPSAAIFFGSYEYTKRTMLDHWQINESL----CHLVAGFVGDLVSSFAYVPSEVFKTR 177

Query: 133 MQ-NDSAHEPHLRR--NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
           +Q     +  H     NY+N  D +  I KEEG   L  G    L R +  +A Q+  Y+
Sbjct: 178 LQLQGRYNNTHFYSGYNYRNLRDAIRTIVKEEGPGALFFGYKATLSRDLPFSALQLAFYE 237

Query: 190 VCKHNLVTTFGFDASEKKTHFTASLV----AGLVATTICSPADVIKTRIMNAHQHHE--- 242
             +       G  A +     +  +     AG +A  I +P DV+KTR+           
Sbjct: 238 KFRKWAFLYEGKTADQHNLSISYEVATGACAGGLAGIITTPLDVVKTRLQTQQPTSSAGD 297

Query: 243 ---------------STLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
                          S  + LS+ +R EG+  +F G  P F      + ++ L+ +   K
Sbjct: 298 VGMHGGAPRPTVLSTSIRRSLSTVVREEGVLNLFSGVGPRFIWTSVQSSIMLLLYQMTLK 357

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 80/191 (41%), Gaps = 22/191 (11%)

Query: 113 MISGAIGGFVGNPA----DVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGV-RKLL 167
           M++G IGG +G+      D V  R Q  +     +   Y++       +  EEGV R L 
Sbjct: 59  MLAGGIGGVIGDSVMHSLDTVKTRQQGTA-----MTLKYRDMWHAYRTVVVEEGVIRGLY 113

Query: 168 TGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPA 227
            G    ++      A    SY+  K  ++  +  +  E   H  A  V  LV++    P+
Sbjct: 114 GGYAAAMLGSFPSAAIFFGSYEYTKRTMLDHWQIN--ESLCHLVAGFVGDLVSSFAYVPS 171

Query: 228 DVIKTRIM------NAHQHHESTLKVLSSSIR----NEGLGFMFRGWLPSFARLGPNTIL 277
           +V KTR+       N H +     + L  +IR     EG G +F G+  + +R  P + L
Sbjct: 172 EVFKTRLQLQGRYNNTHFYSGYNYRNLRDAIRTIVKEEGPGALFFGYKATLSRDLPFSAL 231

Query: 278 IFLVVEQLRKY 288
                E+ RK+
Sbjct: 232 QLAFYEKFRKW 242

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 18/87 (20%)

Query: 3   GTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQT-------------AARPKP 49
           G  ++  N  + Y    G   G +A IIT PLD+ K RLQT                P+P
Sbjct: 248 GKTADQHNLSISYEVATGACAGGLAGIITTPLDVVKTRLQTQQPTSSAGDVGMHGGAPRP 307

Query: 50  TLFSMIQR-----ILKNDGPLGLYSGL 71
           T+ S   R     +++ +G L L+SG+
Sbjct: 308 TVLSTSIRRSLSTVVREEGVLNLFSGV 334

>CAGL0J02002g Chr10 (200829..201914) [1086 bp, 361 aa] {ON} similar
           to uniprot|P40556 Saccharomyces cerevisiae YIL006w or
           uniprot|P39953 Saccharomyces cerevisiae YEL006w
          Length = 361

 Score = 82.8 bits (203), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 130/289 (44%), Gaps = 26/289 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQR--------ILKNDGPLGLYSGL 71
           G + G+++ I+  PLD+AK RLQ       T  ++  R        I++++G  GLY GL
Sbjct: 75  GALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKGL 134

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNI 131
              I+         F  Y+F K+NL       S +     ++ +GA+   V NP  VV  
Sbjct: 135 VPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHSFSAITAGAVSTVVTNPIWVVKT 194

Query: 132 RMQNDSAHEPHLRRN---YKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY 188
           R+      + H+  N   Y+   D   +I  +EGV+ L  GL P+L+ G+L  A     Y
Sbjct: 195 RLM----LQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLL-GLLHVAIHFPVY 249

Query: 189 DVCKHNLVTTFGFDASEKKTHFT------ASLVAGLVATTICSPADVIKTRIM---NAHQ 239
           +  K +    +  D S  ++         AS V+ +VA+ +  P ++++TR+    +   
Sbjct: 250 ERLKVSF-KCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKSDLPS 308

Query: 240 HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
           H    + ++  +   EG+   + G+  +  R  P + +  +  E +R +
Sbjct: 309 HQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNF 357

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 83/186 (44%), Gaps = 18/186 (9%)

Query: 23  GGIVACIITHPLDLAKVRL--QTAARPKPT----LFSMIQRILKNDGPLGLYSGLTASIL 76
            G V+ ++T+P+ + K RL  QT      T     +   ++I+  +G   LY+GL  S+L
Sbjct: 178 AGAVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLL 237

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNST-------LYLLPCSMISGAIGGFVGNPADVV 129
               +    F  Y+ +K +     +  S+         L+  S +S  +   +  P +++
Sbjct: 238 -GLLHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEIL 296

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
             R+Q  S    H RR     I  +   + +EG+    +G G NL R +  +A  +VS++
Sbjct: 297 RTRLQLKSDLPSHQRR----LIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFE 352

Query: 190 VCKHNL 195
             ++ L
Sbjct: 353 YVRNFL 358

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 197 TTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIM--------NAHQHHESTLKVL 248
           T FGF  ++ + +  +  +AGL++  +  P DV KTR+           + ++  ++  +
Sbjct: 59  TLFGFTLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTM 118

Query: 249 SSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           ++ +R+EG+  +++G +P      P  ++ F V E
Sbjct: 119 TTIVRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYE 153

>NCAS0I01150 Chr9 complement(208557..209531) [975 bp, 324 aa] {ON}
           Anc_3.348
          Length = 324

 Score = 82.0 bits (201), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 123/279 (44%), Gaps = 22/279 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GGI   I+  P D  KVR+QT+A+    L  +I++++KN+G    Y G    I+   
Sbjct: 46  GTCGGISQVIVGQPFDTTKVRMQTSAKSVGAL-DIIRKLVKNEGVWAFYKGSLIPIVGVG 104

Query: 80  TYTTARFGCYDFIKENLLP------ADKLNSTLYL---LPCSMISGAIGGFVGNPADVVN 130
              + +FG  + +K               + TL L     C +  G +  F+ +P + V 
Sbjct: 105 ACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVR 164

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDV 190
           IR+Q  + +     R +K  +D + ++ KE   + L+ GL P ++R         ++Y+ 
Sbjct: 165 IRLQTQTGNGNE--REFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLTYEA 219

Query: 191 CKHNLVTTFGFDASEKKTHFTASL--VAGLVATTICSPADVIKTRI----MNAHQHHEST 244
              N +   G D SE  +    S   ++G+V      P DV+K+ I    +   +   S 
Sbjct: 220 LIANEIKK-GKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSM 278

Query: 245 LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
             V++   R +G+   F+G+ P+  R  P     F+  E
Sbjct: 279 KNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317

 Score = 36.2 bits (82), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 19  YGGVGGIVACIITHPLDLAKVRLQTAA----RPKPTLFSMIQRILKNDGPLGLYSGLTAS 74
           YG + G+V  +  +PLD+ K  +QT      R K ++ ++I  + +  G    + G   +
Sbjct: 242 YGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPT 301

Query: 75  ILRQCTYTTARFGCYDFI 92
           +LR      A F  ++ +
Sbjct: 302 MLRAAPVNGATFVTFELV 319

>KLLA0E02839g Chr5 complement(261895..262749) [855 bp, 284 aa] {ON}
           similar to uniprot|Q12375 Saccharomyces cerevisiae
           YOR130C ORT1 Ornithine transporter of the mitochondrial
           inner membrane exports ornithine from mitochondria as
           part of arginine biosynthesis human ortholog is
           associated with
           hyperammonaemia-hyperornithinaemia-homocitrullinuria
           (HHH) syndrome
          Length = 284

 Score = 81.6 bits (200), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 117/280 (41%), Gaps = 21/280 (7%)

Query: 19  YGGVGGIVACIITHPLDLAKVRLQTA-ARPKPTLFSMIQRILKNDGPL-GLYSGLTASIL 76
           YG V G +  +I +P D  KVRLQT  A   PT +S I+    ++G   G Y G+ + + 
Sbjct: 13  YGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGFYQGIASPLF 72

Query: 77  RQCTYTTARF----GCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIR 132
                    F     C +F+ E       L  T+Y       +GA   F+  P ++V  +
Sbjct: 73  GAALENAVLFVSFNQCTNFLDE-FTQLKPLTKTIY---SGAFAGACASFILTPVELVKCK 128

Query: 133 MQ-NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
           +Q ++ ++       + +    +  + KE+G+  L  G     VR  L  A    +Y++ 
Sbjct: 129 LQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIM 188

Query: 192 KHNLVTTFGFDASEKKTHFTASLVAGLVATTICS----PADVIKTRIMNAHQHHESTLKV 247
           K    +      +EK+ H    LV+G  A  + +    PAD +K+        H S +  
Sbjct: 189 KMKFAS---LHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSV---CQTEHVSIVNA 242

Query: 248 LSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           L   +R  G+   +RG   +  R  P    +F   E L+K
Sbjct: 243 LKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKK 282

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 78/178 (43%), Gaps = 17/178 (9%)

Query: 102 LNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEE 161
           L S L  +    ++GAIG  +  P D V +R+Q   AH       Y      +   + +E
Sbjct: 4   LESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHL------YPTTWSCIRSTYTDE 57

Query: 162 GVRK-LLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVA 220
           G+ K    G+   L    L  A   VS++ C  N +  F       KT ++ +  AG  A
Sbjct: 58  GIWKGFYQGIASPLFGAALENAVLFVSFNQCT-NFLDEFTQLKPLTKTIYSGAF-AGACA 115

Query: 221 TTICSPADVIKTRI--------MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFAR 270
           + I +P +++K ++        ++    H S    + S I+ +GL  +++G L +F R
Sbjct: 116 SFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVR 173

>TDEL0C04900 Chr3 (885588..886505) [918 bp, 305 aa] {ON} Anc_3.348
           YPR058W
          Length = 305

 Score = 82.0 bits (201), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 118/279 (42%), Gaps = 27/279 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GGI   ++  P D  KVRLQT+  P  T   +++R++K +G L  Y G    ++   
Sbjct: 32  GTAGGIAQVLVGQPFDTTKVRLQTSTTPT-TALDVVRRLIKYEGALAFYKGTLTPLVGVG 90

Query: 80  TYTTARFGCYDFIKE-----NLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ 134
              + +FG  + +K      N  P   L    Y + C ++SG    F+ +P + + IR+Q
Sbjct: 91  ACVSIQFGVNEAMKRFFHSLNPQPQATLGLPQYYV-CGLVSGVANSFLASPIEHIRIRLQ 149

Query: 135 NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHN 194
             +   P     +K  +D + ++  + G   L+ GL P L+R      +  ++Y+    N
Sbjct: 150 TQTGSGPT--AEFKGPLDCIRKLRSQRG---LMLGLTPTLLREAQGCGTYFLTYEALVAN 204

Query: 195 LVTTFGFDASEKKTHFTASLVAGLVATT------ICSPADVIKTRI----MNAHQHHEST 244
            +         K+T   A  + G  A +      +  P DV+K+ +    +   +   S 
Sbjct: 205 EI-----KKGLKRTDIPAWKLCGFGALSGTALWLMVYPLDVVKSLMQTDNLQKPKFGRSM 259

Query: 245 LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           + V  +    EG    F+G+ P+  R  P     F   E
Sbjct: 260 VTVARTLYAKEGAKAFFKGFGPTMLRAAPANGATFATFE 298

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 82/201 (40%), Gaps = 26/201 (12%)

Query: 10  NAVVKYPWWY--GGVGGIVACIITHPLDLAKVRLQTAARPKPT--LFSMIQRILKNDGPL 65
            A +  P +Y  G V G+    +  P++  ++RLQT     PT      +  I K     
Sbjct: 115 QATLGLPQYYVCGLVSGVANSFLASPIEHIRIRLQTQTGSGPTAEFKGPLDCIRKLRSQR 174

Query: 66  GLYSGLTASILRQCTYTTARFGCYDF-----IKENL----LPADKLNSTLYLLPCSM--I 114
           GL  GLT ++LR+       F  Y+      IK+ L    +PA KL        C    +
Sbjct: 175 GLMLGLTPTLLREAQGCGTYFLTYEALVANEIKKGLKRTDIPAWKL--------CGFGAL 226

Query: 115 SGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNL 174
           SG     +  P DVV   MQ D+  +P   R+    +     ++ +EG +    G GP +
Sbjct: 227 SGTALWLMVYPLDVVKSLMQTDNLQKPKFGRSM---VTVARTLYAKEGAKAFFKGFGPTM 283

Query: 175 VRGVLMTASQVVSYDVCKHNL 195
           +R      +   ++++    L
Sbjct: 284 LRAAPANGATFATFELAMRLL 304

>KLTH0G05808g Chr7 complement(461330..462355) [1026 bp, 341 aa] {ON}
           highly similar to uniprot|P33303 Saccharomyces
           cerevisiae YJR095W SFC1 Mitochondrial succinate-fumarate
           transporter transports succinate into and fumarate out
           of the mitochondrion required for ethanol and acetate
           utilization
          Length = 341

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 80/316 (25%), Positives = 115/316 (36%), Gaps = 43/316 (13%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPK---------PTLFSMIQRILKNDGPLGLYSG 70
           GG  G+   +  HPLD  KVR+Q  +R +         P   S  + I + +G L  Y G
Sbjct: 17  GGTAGLFEALCCHPLDTIKVRMQIYSRAQEIAEHARRAPGFVSTARDIARQEGFLAFYKG 76

Query: 71  LTASILRQCTYTTARFGCYDFIKENLL-PADKLNSTLYLLPCSMISGAIGG-FVGNPADV 128
           L A ++        RF  Y+F +  L  P     ST       + +G      V NP +V
Sbjct: 77  LGAVVIGIIPKMAIRFTSYEFFRTLLADPGSGAVSTGNTFLAGVGAGITEAVLVVNPMEV 136

Query: 129 VNIRMQND------------SAHEPHLRR---------------NYKNAIDGVTRIFKEE 161
           V IR+Q               A  PH                   Y+NAI     I KEE
Sbjct: 137 VKIRLQAQHVRYVPLAAELAGAASPHTASLAGASTATANVPAAPKYRNAIQAAFVIVKEE 196

Query: 162 GVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVAT 221
           G R L  G+     R      +    Y   K  L      D           L++G V  
Sbjct: 197 GPRALYRGVSLTAARQATNQGANFTVYSTLKTRLQEYHQTDMLPSWETSLIGLLSGAVGP 256

Query: 222 TICSPADVIKTRIMNAHQHHEST-----LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTI 276
              +P D IKTR+       + +     + +    IR EG   +++G  P   R+ P   
Sbjct: 257 FSNAPLDTIKTRLQKDKSVSKDSGWARIVAIGRQLIREEGFRALYKGITPRVMRVAPGQA 316

Query: 277 LIFLVVEQLRKYEIGM 292
           + F V E +R+   G+
Sbjct: 317 VTFTVYELIREQLEGL 332

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 90/226 (39%), Gaps = 49/226 (21%)

Query: 21  GVGGIVACIITHPLDLAKVRLQT--------------AARP-----------------KP 49
           G G   A ++ +P+++ K+RLQ               AA P                  P
Sbjct: 121 GAGITEAVLVVNPMEVVKIRLQAQHVRYVPLAAELAGAASPHTASLAGASTATANVPAAP 180

Query: 50  TLFSMIQR---ILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
              + IQ    I+K +GP  LY G++ +  RQ T   A F  Y  +K  L    + +   
Sbjct: 181 KYRNAIQAAFVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKTRLQEYHQTD--- 237

Query: 107 YLLPC------SMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKE 160
            +LP        ++SGA+G F   P D +  R+Q D +        +   +    ++ +E
Sbjct: 238 -MLPSWETSLIGLLSGAVGPFSNAPLDTIKTRLQKDKSVSKD--SGWARIVAIGRQLIRE 294

Query: 161 EGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEK 206
           EG R L  G+ P ++R     A     Y++ +  L    G  AS K
Sbjct: 295 EGFRALYKGITPRVMRVAPGQAVTFTVYELIREQLE---GLAASRK 337

>YOR222W Chr15 (758330..759253) [924 bp, 307 aa] {ON}
           ODC2Mitochondrial inner membrane transporter, exports
           2-oxoadipate and 2-oxoglutarate from the mitochondrial
           matrix to the cytosol for use in lysine and glutamate
           biosynthesis and in lysine catabolism
          Length = 307

 Score = 82.0 bits (201), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 126/293 (43%), Gaps = 40/293 (13%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQ-------TAARPKPT-----LFSMIQRILKND 62
           Y +  G V GI    + +PLD+ K R Q        AA  K       +   +++I+K +
Sbjct: 14  YQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKE 73

Query: 63  GPLGLYSGLTASILRQCTYTTARFGC---YDFIKENLLPADKLNSTLYLLPCSMISGAIG 119
           G   LY G+++ +L +      +F C   Y  I +NL   ++    +     S+ +GA  
Sbjct: 74  GFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI-----SIAAGASA 128

Query: 120 GF----VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLV 175
           G     V  P +++ IRMQ+       ++ +Y   +D + +  K EG+  L  G+   + 
Sbjct: 129 GMTEAAVIVPFELIKIRMQD-------VKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMW 181

Query: 176 RGVLMTASQV-VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI 234
           R  L       V Y V   N +        + +    A  + G V T + +P DV+K+RI
Sbjct: 182 RNALWNGGYFGVIYQV--RNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRI 239

Query: 235 M------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
                  +A + +   L  L    R EG   +++G++P   RL P   L+ +V
Sbjct: 240 QSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVV 292

>KLLA0F04697g Chr6 complement(461126..462049) [924 bp, 307 aa] {ON}
           similar to uniprot|P40464 Saccharomyces cerevisiae
           YIL134W FLX1 Protein required for transport of flavin
           adenine dinucleotide (FAD) from mitochondria where it is
           synthesized from riboflavin to the cytosol
          Length = 307

 Score = 82.0 bits (201), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 132/295 (44%), Gaps = 37/295 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP-KP-TLFSMIQRILKN-DGPLGL----YSGLT 72
           G   G +  I+THPLDL K+RLQ AA   KP + ++ +QRI+K+  G   L    Y GL 
Sbjct: 19  GLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEAYRGLG 78

Query: 73  ASILRQCTYTTARFGCYDFIKE-------------NLLPADKLNSTLYLLPCSMISGAIG 119
            +I+         FG Y   K+               +   K+ S++YL+     SG   
Sbjct: 79  INIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGA-SGLAT 137

Query: 120 GFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVL 179
             + NP  V+  R+ +  + +      Y + ++ +TRI+ EEG++    GL P+L  GV 
Sbjct: 138 ALLTNPMWVIKTRIMSTKSSQ-----GYTSILNAITRIYTEEGLKTFWRGLVPSLF-GVT 191

Query: 180 MTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASL----VAGLVATTICSPADVIKTRIM 235
             A     YD  K   +     D  E++ +   ++    ++ +++ +   P  ++KT + 
Sbjct: 192 QGALYFAIYDTLKLKYLHDRN-DIQERRLNAVETIGIISLSKMISVSSVYPLQLLKTNLQ 250

Query: 236 NAHQHHESTLKVLSSSIRN----EGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
                H    K ++S IR+     G+   ++G   +  R  P+T + F V E  +
Sbjct: 251 TFRTEHNENSK-MNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYEHFK 304

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 75/182 (41%), Gaps = 14/182 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQT--AARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
            G  G+   ++T+P+ + K R+ +  +++   ++ + I RI   +G    + GL  S+  
Sbjct: 130 AGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSLF- 188

Query: 78  QCTYTTARFGCYDFIK------ENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNI 131
             T     F  YD +K       N +   +LN+   +   S+ S  I      P  ++  
Sbjct: 189 GVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISL-SKMISVSSVYPLQLLKT 247

Query: 132 RMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
            +Q  +    H   +  N++  +  I+   G+     GL  NLVR +  T      Y+  
Sbjct: 248 NLQ--TFRTEHNENSKMNSL--IRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYEHF 303

Query: 192 KH 193
           KH
Sbjct: 304 KH 305

>KAFR0G01840 Chr7 (392115..393041) [927 bp, 308 aa] {ON} Anc_8.644
           YOR222W
          Length = 308

 Score = 81.6 bits (200), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 133/309 (43%), Gaps = 42/309 (13%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPT-------LFSMIQRILKNDGPLGL 67
           Y +  G + GI   ++ +PLD+ K R+Q     K         +     +I++N+G   L
Sbjct: 12  YQFAAGAIAGISELMVMYPLDVVKTRMQLQVTSKVETATTYRGVIDCFVKIIRNEGFSRL 71

Query: 68  YSGLTASILRQCTYTTARFGCYDF---IKENLLPADKLNSTLYLLPCSMISGAIGG---- 120
           Y G+T+ +L +      +F   D    I + L   D +N  +     +++SGA  G    
Sbjct: 72  YKGITSPMLMEAPKRAVKFAANDEFQKIYKKLNGVDNVNQRV-----AVMSGASAGITEA 126

Query: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR-GVL 179
           F+  P ++V IR+Q+        + N+K  +D V  I ++EG+     G    + R GV 
Sbjct: 127 FLVVPFELVKIRLQDA-------KSNFKGPMDVVKNIVRKEGIFSFYNGFESTMWRNGVW 179

Query: 180 MTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQ 239
                 V + V   +L+      + + +    A  + G   TT+ +P DV+K+RI ++  
Sbjct: 180 NAGYFGVIFQV--RSLLPKATNKSEKSRNDLIAGFIGGTAGTTLNTPLDVVKSRIQSSTS 237

Query: 240 H-------------HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
           +             +   L  L    R EGL  +++G+LP   RL     L+ +V   + 
Sbjct: 238 NVLVTNKAGKQVLKYNWALPSLLVIYREEGLKALYKGYLPKILRLSTGGGLMLVVFSNVM 297

Query: 287 KYEIGMHQH 295
            +   +H +
Sbjct: 298 DFFRKVHYN 306

>TDEL0F01040 Chr6 (185941..188367) [2427 bp, 808 aa] {ON} Anc_8.129
           YPR021C
          Length = 808

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 114/265 (43%), Gaps = 24/265 (9%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQ---RILKNDGPLGLYSGL 71
           Y +  G + G +   I +P+DL K RLQ A R      + I    +IL  +G  GLYSGL
Sbjct: 424 YNFSLGSIAGCIGATIVYPIDLVKTRLQ-AQRSSSQYKNSIDCFTKILSREGIKGLYSGL 482

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPAD 127
              ++        +    D +++ L   DK N  L  LP  + SGA  G       NP +
Sbjct: 483 GPQLMGVAPEKAIKLAVNDLMRKTL--TDK-NGKLS-LPAEIASGACAGACQVLFTNPLE 538

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           VV IR+Q       +   N   A    T I K  G+R L  G+   L+R V  +A    +
Sbjct: 539 VVKIRLQ---VRSEYATENLAQAQITATGIIKRLGLRGLYRGVTACLMRDVPFSAIYFPT 595

Query: 188 YDVCKHNLVTTFGFDASEKKTHFTASL-----VAGLVATTICSPADVIKTRIM----NAH 238
           Y   K +L      D S++    T  L     +AG+ A  + +P DVIKTR+        
Sbjct: 596 YAHIKRDLFNFDPQDESKRSRLKTWELLLSGGLAGMPAAYLTTPCDVIKTRLQIDPRRGE 655

Query: 239 QHHESTLKVLSSSIRNEGLGFMFRG 263
            H++  L    + ++ E     FRG
Sbjct: 656 THYKGILHAARTILKEESFRSFFRG 680

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 79/186 (42%), Gaps = 16/186 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQ----RILKNDGPLGLYSGLTASI 75
           G   G    + T+PL++ K+RLQ  +       +  Q     I+K  G  GLY G+TA +
Sbjct: 523 GACAGACQVLFTNPLEVVKIRLQVRSEYATENLAQAQITATGIIKRLGLRGLYRGVTACL 582

Query: 76  LRQCTYTTARFGCYDFIKENLLPADKLNS-------TLYLLPCSMISGAIGGFVGNPADV 128
           +R   ++   F  Y  IK +L   D  +        T  LL    ++G    ++  P DV
Sbjct: 583 MRDVPFSAIYFPTYAHIKRDLFNFDPQDESKRSRLKTWELLLSGGLAGMPAAYLTTPCDV 642

Query: 129 VNIRMQNDSAH-EPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           +  R+Q D    E H    YK  +     I KEE  R    G G  ++R        + +
Sbjct: 643 IKTRLQIDPRRGETH----YKGILHAARTILKEESFRSFFRGGGARVLRSSPQFGFTLAA 698

Query: 188 YDVCKH 193
           Y++ K+
Sbjct: 699 YELFKN 704

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 80/192 (41%), Gaps = 19/192 (9%)

Query: 104 STLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGV 163
            +LY      I+G IG  +  P D+V  R+Q   +        YKN+ID  T+I   EG+
Sbjct: 421 DSLYNFSLGSIAGCIGATIVYPIDLVKTRLQAQRSSS-----QYKNSIDCFTKILSREGI 475

Query: 164 RKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVA--- 220
           + L +GLGP L+      A ++   D+ +  L    G      K    A + +G  A   
Sbjct: 476 KGLYSGLGPQLMGVAPEKAIKLAVNDLMRKTLTDKNG------KLSLPAEIASGACAGAC 529

Query: 221 -TTICSPADVIKTRIMNAHQHHESTLK----VLSSSIRNEGLGFMFRGWLPSFARLGPNT 275
                +P +V+K R+    ++    L       +  I+  GL  ++RG      R  P +
Sbjct: 530 QVLFTNPLEVVKIRLQVRSEYATENLAQAQITATGIIKRLGLRGLYRGVTACLMRDVPFS 589

Query: 276 ILIFLVVEQLRK 287
            + F     +++
Sbjct: 590 AIYFPTYAHIKR 601

>TBLA0G02640 Chr7 complement(699692..700654) [963 bp, 320 aa] {ON}
           Anc_2.227 YIL134W
          Length = 320

 Score = 81.6 bits (200), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 133/309 (43%), Gaps = 44/309 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ--TAARPKPTLFSMIQRIL----KNDGPLGLYSGLTA 73
           G   G +  +I HPLDL K+RLQ    ++   + ++ I + L    KN     +Y GL  
Sbjct: 15  GLTAGTLTTLIVHPLDLIKIRLQLLVTSQNNSSGYAQIIKSLITSQKNHPIKEIYRGLAI 74

Query: 74  SILRQCTYTTARFGCYDFIKENL----------LPADKLNST--------LYLLPCSMIS 115
           +I          FG Y   K+ L          LP   L+S         L  L  S  S
Sbjct: 75  NIFGNAIAWGLYFGFYRTFKDYLYNNYTLSLKDLPKSNLSSDSKDAQLTPLMYLTASACS 134

Query: 116 GAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLV 175
           G     + NP  V+  R+ + S   P    +YK+  DG+T++ + EG+  L  GL P+ V
Sbjct: 135 GISTTLITNPIWVLKTRIMSTSVQNPD---SYKSIKDGLTKLLRTEGISSLWRGLIPS-V 190

Query: 176 RGVLMTASQVVSYDVCKHNLV------TTFGFDASEKKTHFTASL--------VAGLVAT 221
            GV   A   ++YD  K  ++      T+  ++   K    + +         ++ + + 
Sbjct: 191 FGVGQGAIYFMTYDSLKKKVLSYKIVKTSSAYEEISKNNSISLNTFEIISITSLSKMFSV 250

Query: 222 TICSPADVIKTRI--MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIF 279
           +   P  +IK+ +   NA+ H+   L+ +S+  +  G+   ++G L +  R  P+T + F
Sbjct: 251 STTYPFQLIKSNLQSFNAYNHNYKLLQFISTLYKKRGIRGFYKGLLTNLVRTVPSTCITF 310

Query: 280 LVVEQLRKY 288
              E  +K+
Sbjct: 311 CTYECFKKH 319

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 94/220 (42%), Gaps = 36/220 (16%)

Query: 2   SGTKSESSNAVVKYPWWY---GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQ-- 56
           S   S+S +A +  P  Y       GI   +IT+P+ + K R+ + +   P  +  I+  
Sbjct: 111 SNLSSDSKDAQLT-PLMYLTASACSGISTTLITNPIWVLKTRIMSTSVQNPDSYKSIKDG 169

Query: 57  --RILKNDGPLGLYSGLTASIL---RQCTYTTARFGCYDFIKENLLP------------A 99
             ++L+ +G   L+ GL  S+    +   Y    F  YD +K+ +L              
Sbjct: 170 LTKLLRTEGISSLWRGLIPSVFGVGQGAIY----FMTYDSLKKKVLSYKIVKTSSAYEEI 225

Query: 100 DKLNS----TLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVT 155
            K NS    T  ++  + +S         P  ++   +Q+ +A+      NYK  +  ++
Sbjct: 226 SKNNSISLNTFEIISITSLSKMFSVSTTYPFQLIKSNLQSFNAYN----HNYK-LLQFIS 280

Query: 156 RIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNL 195
            ++K+ G+R    GL  NLVR V  T     +Y+  K +L
Sbjct: 281 TLYKKRGIRGFYKGLLTNLVRTVPSTCITFCTYECFKKHL 320

>CAGL0K12210g Chr11 (1194600..1195535) [936 bp, 311 aa] {ON} similar
           to uniprot|P38087 Saccharomyces cerevisiae YBR104w YMC2
           or uniprot|P32331 Saccharomyces cerevisiae YPR058w YMC1
          Length = 311

 Score = 81.3 bits (199), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 63/285 (22%), Positives = 124/285 (43%), Gaps = 30/285 (10%)

Query: 18  WYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           + G +GG+   ++  P D  KVRLQT+ + K  +  ++Q +L+N+G L  Y G+   +L 
Sbjct: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTS-KTKIGVIEVVQNLLRNEGALAFYKGMLTPLLG 89

Query: 78  QCTYTTARFGCYDFIKENLLP--ADKLNSTLYL-LP------CSMISGAIGGFVGNPADV 128
                + +FG  + +K       AD+++   ++ LP      C +  G +  F+  P + 
Sbjct: 90  VGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEH 149

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY 188
           V IR+Q  ++      R +K   D + ++ K    + L+ GL P ++R      +   +Y
Sbjct: 150 VRIRLQTQTSQGNE--RQFKGPFDCIKKLAK---AKALMRGLLPTMIRAGHGLGTYFAAY 204

Query: 189 DVCKHNLVTTFGFDASEKKTHFTA------SLVAGLVATTICSPADVIK----TRIMNAH 238
           +      +    F+    +    A        ++G +      P DV+K    T  +   
Sbjct: 205 EA-----LVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENP 259

Query: 239 QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           ++  S +K   +  +  G+   F+G++P+  R  P     F+  E
Sbjct: 260 KYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304

>ZYRO0A13156g Chr1 complement(1036035..1037195) [1161 bp, 386 aa]
           {ON} highly similar to uniprot|P38127 Saccharomyces
           cerevisiae YBR192W RIM2 Protein of the mitochondrial
           carrier (MCF) family that is required for respiration
           Probable carrier protein mitochondrial
          Length = 386

 Score = 82.0 bits (201), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 133/317 (41%), Gaps = 59/317 (18%)

Query: 16  PWWY---GGVGGIVACIITHPLDLAKVRLQTAARPK------------PT---------- 50
           PW +   GG+GG+   ++T P DL K RLQ+                 PT          
Sbjct: 65  PWVHFVAGGIGGMAGSVVTCPFDLVKTRLQSDVYQNIYKSKAIYKTGTPTQRVLNYMAQA 124

Query: 51  ------LFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNS 104
                  F ++  + K +G   L+ GL  +++      +  F  Y   K+  + +   N 
Sbjct: 125 GVHFKETFGILGSVYKQEGFTSLFKGLGPNLIGVIPARSINFFTYGTTKD--IYSRYFND 182

Query: 105 TLYLLPCSMISGAIGGF----VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKE 160
                   +++GA  G+      NP  ++  R+Q D A +    + YKN+ D +  I K 
Sbjct: 183 GQEAAWIHLMAGATAGWATSTATNPIWMIKTRLQLDKAGK---TKQYKNSWDCIKSIMKN 239

Query: 161 EGVRKLLTGLGPNLVRGVLMTASQVVSYD----VCKHNLVTTFGFD-----ASEKKTHFT 211
           EGVR +  GL  + + G + +  Q + Y+    V K   +  FG D      SEK   + 
Sbjct: 240 EGVRGMYKGLSASYL-GSVESILQWILYEQMKRVIKERSIEKFGHDERHKSVSEKIKEWC 298

Query: 212 ----ASLVAGLVATTICSPADVIKTRIM-----NAHQHHESTLKVLSSSIRNEGLGFMFR 262
               ++ +A LVA+ +  P +V++TR+      N    +   ++     I+ EG   M+ 
Sbjct: 299 QRSGSAGLAKLVASIVTYPHEVVRTRLRQAPLENGKPKYTGLIQSFKVIIKEEGFISMYS 358

Query: 263 GWLPSFARLGPNTILIF 279
           G  P   R  PN+I++F
Sbjct: 359 GLTPHLMRTVPNSIIMF 375

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 89/205 (43%), Gaps = 32/205 (15%)

Query: 113 MISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRR---------------------NY 147
            ++G IGG  G+    P D+V  R+Q+D     +  +                     ++
Sbjct: 69  FVAGGIGGMAGSVVTCPFDLVKTRLQSDVYQNIYKSKAIYKTGTPTQRVLNYMAQAGVHF 128

Query: 148 KNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKK 207
           K     +  ++K+EG   L  GLGPNL+  +   +    +Y   K      F        
Sbjct: 129 KETFGILGSVYKQEGFTSLFKGLGPNLIGVIPARSINFFTYGTTKDIYSRYFNDGQEAAW 188

Query: 208 THFTASLVAGLVATTICSPADVIKTRIM----NAHQHHESTLKVLSSSIRNEGLGFMFRG 263
            H  A   AG   +T  +P  +IKTR+        + ++++   + S ++NEG+  M++G
Sbjct: 189 IHLMAGATAGWATSTATNPIWMIKTRLQLDKAGKTKQYKNSWDCIKSIMKNEGVRGMYKG 248

Query: 264 WLPSFARLGP-NTILIFLVVEQLRK 287
              S+  LG   +IL +++ EQ+++
Sbjct: 249 LSASY--LGSVESILQWILYEQMKR 271

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 5/78 (6%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTA----ARPKPT-LFSMIQRILKNDGPLGLYSGLTAS 74
            G+  +VA I+T+P ++ + RL+ A     +PK T L    + I+K +G + +YSGLT  
Sbjct: 304 AGLAKLVASIVTYPHEVVRTRLRQAPLENGKPKYTGLIQSFKVIIKEEGFISMYSGLTPH 363

Query: 75  ILRQCTYTTARFGCYDFI 92
           ++R    +   FG ++ +
Sbjct: 364 LMRTVPNSIIMFGTWEIV 381

>Kpol_1013.83 s1013 complement(201961..202983) [1023 bp, 340 aa]
           {ON} complement(201961..202983) [1023 nt, 341 aa]
          Length = 340

 Score = 81.3 bits (199), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 112/310 (36%), Gaps = 45/310 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAAR------PKPTLFSMIQRILKNDGPLGLYSGLTA 73
           GG  G+   +  HPLD  KVR+Q   R        P        I   +G L LY GL A
Sbjct: 16  GGTAGLFEALCCHPLDTIKVRMQIYKRSHSSNIKPPGFVKTGSSIYNQEGFLALYKGLGA 75

Query: 74  SILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNPADV 128
            ++        RF  Y+  +  L  ADK    +     + I+G   G      V NP +V
Sbjct: 76  VVIGIIPKMAIRFSSYEAYRSML--ADKQTGKVS-TGNTFIAGVGAGITEAVLVVNPMEV 132

Query: 129 VNIRMQNDSAHEPHL------------------------RRNYKNAIDGVTRIFKEEGVR 164
           V IR+Q  S   P                          +  Y+NAI  V  I KEEGV 
Sbjct: 133 VKIRLQAQSLVTPTTIQTNSISGGAATATATATATATAPQPKYRNAIHAVYTIIKEEGVS 192

Query: 165 KLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTIC 224
            L  G+     R      +    Y   K  L      +           L++G +     
Sbjct: 193 TLYRGVSLTAARQATNQGANFTVYSKLKEYLQNYHKTEVLPSWETSCIGLISGAIGPFSN 252

Query: 225 SPADVIKTRIMNAHQHHEST-------LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTIL 277
           +P D IKTR+         T       + + +  I+ EG   +++G  P   R+ P   +
Sbjct: 253 APLDTIKTRLQKEKTSKTDTGSSWKRIVTIGNQLIKEEGFRALYKGITPRVMRVAPGQAV 312

Query: 278 IFLVVEQLRK 287
            F V E +RK
Sbjct: 313 TFTVYEFIRK 322

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 88/224 (39%), Gaps = 41/224 (18%)

Query: 21  GVGGIVACIITHPLDLAKVRLQTAARPKPTLFSM-------------------------- 54
           G G   A ++ +P+++ K+RLQ  +   PT                              
Sbjct: 117 GAGITEAVLVVNPMEVVKIRLQAQSLVTPTTIQTNSISGGAATATATATATATAPQPKYR 176

Query: 55  -----IQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLL 109
                +  I+K +G   LY G++ +  RQ T   A F  Y  +KE L    K      +L
Sbjct: 177 NAIHAVYTIIKEEGVSTLYRGVSLTAARQATNQGANFTVYSKLKEYLQNYHKTE----VL 232

Query: 110 PC------SMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGV 163
           P        +ISGAIG F   P D +  R+Q +   +     ++K  +    ++ KEEG 
Sbjct: 233 PSWETSCIGLISGAIGPFSNAPLDTIKTRLQKEKTSKTDTGSSWKRIVTIGNQLIKEEGF 292

Query: 164 RKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKK 207
           R L  G+ P ++R     A     Y+  +  L  T  F +S  K
Sbjct: 293 RALYKGITPRVMRVAPGQAVTFTVYEFIRKRLEDTGFFKSSGPK 336

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 30/74 (40%), Gaps = 13/74 (17%)

Query: 209 HFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLK-----VLSSSIRNE-------- 255
           +  A   AGL     C P D IK R+    + H S +K        SSI N+        
Sbjct: 12  NLIAGGTAGLFEALCCHPLDTIKVRMQIYKRSHSSNIKPPGFVKTGSSIYNQEGFLALYK 71

Query: 256 GLGFMFRGWLPSFA 269
           GLG +  G +P  A
Sbjct: 72  GLGAVVIGIIPKMA 85

>Skud_15.388 Chr15 (697346..698269) [924 bp, 307 aa] {ON} YOR222W
           (REAL)
          Length = 307

 Score = 80.9 bits (198), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 125/293 (42%), Gaps = 40/293 (13%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQ-------TAARPKPT-----LFSMIQRILKND 62
           Y +  G V GI    + +PLD+ K R Q        AA  K       +   +++I+K +
Sbjct: 14  YQFISGAVAGISELAVMYPLDVVKTRFQLEVTTPAAAAAGKQVEKYNGVIDCLKKIVKKE 73

Query: 63  GPLGLYSGLTASILRQCTYTTARFGC---YDFIKENLLPADKLNSTLYLLPCSMISGAIG 119
           G   LY G+++ +L +      +F C   Y  + +NL    +    +     S+ +GA  
Sbjct: 74  GFGRLYRGISSPMLMEAPKRATKFACNDQYQKVFKNLFNTKETTQKI-----SIAAGASA 128

Query: 120 GF----VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLV 175
           G     V  P +++ IRMQ+       +  NY   +D + +  K EG+  L  G+   + 
Sbjct: 129 GMTEAAVIVPFELIKIRMQD-------INSNYPGPMDCLKKTIKNEGITGLYKGVESTMW 181

Query: 176 RGVLMTASQV-VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI 234
           R  L       V + V   N +        + +    A  + G V T + +P DV+K+RI
Sbjct: 182 RNALWNGGYFGVIFQV--RNSMPEAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRI 239

Query: 235 MN------AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
            +      A + +  +L  L    R EG   +++G++P   RL P   L+ +V
Sbjct: 240 QSVDAVNSAVKKYNWSLPSLLIIYREEGFRALYKGFVPKVCRLAPGGSLMLVV 292

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 33/91 (36%), Gaps = 12/91 (13%)

Query: 209 HFTASLVAGLVATTICSPADVIKTRIM------------NAHQHHESTLKVLSSSIRNEG 256
            F +  VAG+    +  P DV+KTR                 + +   +  L   ++ EG
Sbjct: 15  QFISGAVAGISELAVMYPLDVVKTRFQLEVTTPAAAAAGKQVEKYNGVIDCLKKIVKKEG 74

Query: 257 LGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
            G ++RG         P     F   +Q +K
Sbjct: 75  FGRLYRGISSPMLMEAPKRATKFACNDQYQK 105

>Smik_6.333 Chr6 (524689..525618) [930 bp, 309 aa] {ON} YPL134C
           (REAL)
          Length = 309

 Score = 80.9 bits (198), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 126/297 (42%), Gaps = 32/297 (10%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPT---------------LFSMIQRIL 59
           Y +  G + G+   ++ +PLD+ K R+Q     K +               +   + +I+
Sbjct: 13  YQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKSSPVVDAVKVAADHYTGVMDCLTKIV 72

Query: 60  KNDGPLGLYSGLTASILRQCTYTTARFG---CYDFIKENLLPADKLNSTLYLLPCSMIS- 115
           K +G   LY G+T+ IL +      +F     +    + + P      T  +  CS  S 
Sbjct: 73  KKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQLFYKKIFPTPNGEMTQKIAICSGASA 132

Query: 116 GAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLV 175
           GA+  F+  P ++V IR+Q+       +   +K  I+ V     + GV  L  GL   + 
Sbjct: 133 GAVEAFIVAPFELVKIRLQD-------VNSPFKTPIEVVKNSVAKGGVLSLFNGLEATIW 185

Query: 176 RGVLMTASQV-VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI 234
           R VL  A    + + V K  L+     +  + +    A  + G V   + +P DV+K+RI
Sbjct: 186 RHVLWNAGYFGIIFQVRK--LLPAAKTNTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRI 243

Query: 235 MNAH---QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
             +    + +  +L  +    R EG   +++G++P   RL P   L+ +V   +  +
Sbjct: 244 QRSSGPLRKYNWSLSSVLLVYREEGFKALYKGFVPKVMRLAPGGGLLLVVFTNVMDF 300

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 70/168 (41%), Gaps = 10/168 (5%)

Query: 106 LYLLPCSMISGAIGGFVGNPADVVNIRMQND--SAHEPHLR------RNYKNAIDGVTRI 157
           +Y      I+G     V  P DVV  RMQ    +   P +        +Y   +D +T+I
Sbjct: 12  IYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKSSPVVDAVKVAADHYTGVMDCLTKI 71

Query: 158 FKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASE--KKTHFTASLV 215
            K+EG   L  G+   ++      A +    D  +      F     E  +K    +   
Sbjct: 72  VKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQLFYKKIFPTPNGEMTQKIAICSGAS 131

Query: 216 AGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRG 263
           AG V   I +P +++K R+ + +   ++ ++V+ +S+   G+  +F G
Sbjct: 132 AGAVEAFIVAPFELVKIRLQDVNSPFKTPIEVVKNSVAKGGVLSLFNG 179

>TPHA0A03660 Chr1 complement(801293..802228) [936 bp, 311 aa] {ON}
           Anc_3.348 YPR058W
          Length = 311

 Score = 80.9 bits (198), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 120/278 (43%), Gaps = 19/278 (6%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GGI   ++  P D  KVRLQT+     T   +I+ ++K++G  G Y G    ++   
Sbjct: 32  GTTGGIAQVLVGQPFDTTKVRLQTSTAEDITTMKVIKDLVKHEGLKGFYKGTLTPLIGVG 91

Query: 80  TYTTARFGCYDFIKENLLPADK----LNSTLYLLP----CSMISGAIGGFVGNPADVVNI 131
              + +FG  +++K  L   +K    ++S +  LP    C +  G +  F+ +P + + I
Sbjct: 92  ACVSVQFGVNEYMKRLLKTYNKTYKGIDSKILSLPQYYACGLTGGLVNSFLSSPIEHIRI 151

Query: 132 RMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
           R+Q       +    +   +D + ++ K+   ++L+ GL   +VR         + Y+  
Sbjct: 152 RLQIQKNSGKN--AEFSGPLDCIKKLLKQ---KQLMRGLPVMMVRAGHGLGVYFLVYEAL 206

Query: 192 KHNLVTTFGFDASEKKTHFTA--SLVAGLVATTICSPADVIKTRI----MNAHQHHESTL 245
             N +     +  + K+         AG +      P DVIK+ I    + + ++  S  
Sbjct: 207 IANQIKKKSINREDIKSWRLCLYGATAGTLLWIAVYPIDVIKSIIQSDNLKSPKYGTSLF 266

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           KV       EGL   F+G LP+  R  P   + F V E
Sbjct: 267 KVGRQLYLKEGLPVFFKGLLPTMLRATPANAVTFTVFE 304

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 35/76 (46%)

Query: 212 ASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARL 271
           A    G+    +  P D  K R+  +     +T+KV+   +++EGL   ++G L     +
Sbjct: 31  AGTTGGIAQVLVGQPFDTTKVRLQTSTAEDITTMKVIKDLVKHEGLKGFYKGTLTPLIGV 90

Query: 272 GPNTILIFLVVEQLRK 287
           G    + F V E +++
Sbjct: 91  GACVSVQFGVNEYMKR 106

>KNAG0J01540 Chr10 (282285..283232) [948 bp, 315 aa] {ON} Anc_8.644
           YOR222W
          Length = 315

 Score = 80.5 bits (197), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 79/167 (47%), Gaps = 13/167 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G   GI    +  P +L KVR Q AA        +++ I+K DG LGLY+GL A++ R  
Sbjct: 128 GASAGITEAFVIVPFELVKVRCQDAAAKVNGPMEVLKAIVKKDGVLGLYNGLEATVWRHA 187

Query: 80  TYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVG----NPADVVNIRMQN 135
            + +  FG   F    LLPA K  S    +   +++G +GG +G     P DVV  R+Q+
Sbjct: 188 LWNSGYFGII-FQVRKLLPAAKSKSE--KVRNDLLAGTVGGTMGCIFNTPFDVVKSRIQS 244

Query: 136 ------DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
                 D A      + Y  ++  V  I+KEEG   L  G  P + R
Sbjct: 245 SGNSVVDPADATKTIKKYNWSVPAVKTIYKEEGFSALYKGFVPKIAR 291

 Score = 69.3 bits (168), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 64/296 (21%), Positives = 128/296 (43%), Gaps = 40/296 (13%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQTAARPK---------PTLFSMIQRILKNDGPL 65
           Y +  G V G+   ++ +PLD+ K R+Q  +  +           L   + +I+K +G  
Sbjct: 18  YQFIAGAVAGVSELLVMYPLDVVKTRMQLQSSVRGGAGGGEVYSGLVDCLSKIIKREGAR 77

Query: 66  GLYSGLTASILRQCTYTTARFGCYDFIKE------NLLPADKLNSTLYLLPCSMISGAIG 119
            LY G+++ IL +      +F   +  ++       L P  K N  + +L  +  +G   
Sbjct: 78  TLYRGISSPILMEAPKRATKFAFNEKFQKLYANVVGLAPG-KTNQAISILAGAS-AGITE 135

Query: 120 GFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVL 179
            FV  P ++V +R Q+ +A            ++ +  I K++GV  L  GL   + R  L
Sbjct: 136 AFVIVPFELVKVRCQDAAAK-------VNGPMEVLKAIVKKDGVLGLYNGLEATVWRHAL 188

Query: 180 MTASQV-VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAH 238
             +    + + V K  L+      + + +    A  V G +     +P DV+K+RI ++ 
Sbjct: 189 WNSGYFGIIFQVRK--LLPAAKSKSEKVRNDLLAGTVGGTMGCIFNTPFDVVKSRIQSSG 246

Query: 239 -------------QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
                        + +  ++  + +  + EG   +++G++P  ARLGP   ++ +V
Sbjct: 247 NSVVDPADATKTIKKYNWSVPAVKTIYKEEGFSALYKGFVPKIARLGPGGGILLIV 302

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 13/85 (15%)

Query: 6   SESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTA-------ARPKPTL------F 52
           ++S +  V+     G VGG + CI   P D+ K R+Q++       A    T+       
Sbjct: 207 AKSKSEKVRNDLLAGTVGGTMGCIFNTPFDVVKSRIQSSGNSVVDPADATKTIKKYNWSV 266

Query: 53  SMIQRILKNDGPLGLYSGLTASILR 77
             ++ I K +G   LY G    I R
Sbjct: 267 PAVKTIYKEEGFSALYKGFVPKIAR 291

>Kwal_47.18216 s47 (736491..737492) [1002 bp, 333 aa] {ON} YJR095W
           (SFC1) - mitochondrial succinate-fumarate transport
           protein [contig 197] FULL
          Length = 333

 Score = 80.5 bits (197), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 114/311 (36%), Gaps = 46/311 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT------LFSMIQRILKNDGPLGLYSGLTA 73
           GG  G+   +  HPLD  KVR+Q  +R +             + I   +G L LY GL A
Sbjct: 17  GGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGA 76

Query: 74  SILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNPADV 128
            ++        RF  Y+F +   L AD+  + +     + ++G   G      V NP +V
Sbjct: 77  VVIGIIPKMAIRFTSYEFFRT--LLADR-QTGVVSTGNTFVAGVGAGITEAVMVVNPMEV 133

Query: 129 VNIRMQNDSAHEPHLRRN---------------------------YKNAIDGVTRIFKEE 161
           V IR+Q        L+                             Y+NAI     I KEE
Sbjct: 134 VKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVKEE 193

Query: 162 GVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVAT 221
           G R L  G+     R      +    Y   K  L      D           L++G +  
Sbjct: 194 GPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGP 253

Query: 222 TICSPADVIKTRIMNAHQHHEST-----LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTI 276
              +P D IKTR+       + +     L +    IR EG   +++G  P   R+ P   
Sbjct: 254 FSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQA 313

Query: 277 LIFLVVEQLRK 287
           + F V E +RK
Sbjct: 314 VTFTVYELIRK 324

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 9/90 (10%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQT-AARPKPTLFSMI----QRILKNDGPLG 66
           P W     G + G +      PLD  K RLQ   +  K + +S I    +++++ +G   
Sbjct: 237 PSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRA 296

Query: 67  LYSGLTASILRQCTYTTARFGCYDFIKENL 96
           LY G+T  ++R        F  Y+ I++ L
Sbjct: 297 LYKGITPRVMRVAPGQAVTFTVYELIRKKL 326

>KLTH0F12804g Chr6 (1063271..1064413) [1143 bp, 380 aa] {ON} similar
           to uniprot|P40556 Saccharomyces cerevisiae YIL006W
           Pvruvate transporter of the mitochondrial inner membrane
           member of the mitochondrial carrier family has putative
           mouse and human orthologs
          Length = 380

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 133/308 (43%), Gaps = 42/308 (13%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPK--PTLFSMI----QRILKNDGPLGLYSGLTA 73
           G V G +A I   PLD+AK RLQ        P  ++ I      I++++G  GLY GL  
Sbjct: 82  GAVAGFLAGITVCPLDVAKTRLQAQGLSSRLPNYYNGILGTLNTIVRDEGVRGLYKGLVP 141

Query: 74  SILRQCTYTTARFGCYDFIKE---NLLPA-DKLNSTLYLLPCSMISGAIGGFVGNPADVV 129
            I+         F  Y+  K+    + P+ D L+ +      ++ +GAI   + NP  VV
Sbjct: 142 IIMGYFPTWMIYFSVYESSKKIYPQVFPSFDFLSHS----ASALTAGAISTILTNPVWVV 197

Query: 130 NIRMQNDSAHEPHLRRN---YKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
             R+      + H+  N   YK   D   +I+  EG++   +GL P+L  G+   A    
Sbjct: 198 KTRLM----LQTHVNENSTRYKGTFDAFHKIYTTEGIKTFYSGLLPSLF-GLFHVAIHFP 252

Query: 187 SYDVCKHNLVTTFGFDASEKKTHFTASLVAG-----LVATTICSPADVIKTRI------- 234
            Y+  K  L       AS+      A L+A      +VA+ +  P ++++TR+       
Sbjct: 253 IYEKLKIWLHCYPSIAASDDYNLNLARLIAASSASKMVASALTYPHEILRTRMQIRAPPE 312

Query: 235 ------MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
                 M A  H  S ++++  + R EGL   + G+  +  R  P + +  +  E  RKY
Sbjct: 313 SLAATEMKASSH--SLIRLVRQTYRTEGLRGFYSGFTANLVRTVPASAITLVSFEYFRKY 370

Query: 289 EIGMHQHF 296
              ++  F
Sbjct: 371 LNKLNDSF 378

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 106/244 (43%), Gaps = 35/244 (14%)

Query: 41  LQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPAD 100
           L + AR +P L  +   IL  D    L S   A +L    +T  R G  D     L  AD
Sbjct: 17  LVSGARKRPHL--IYDEILAPDCSTPLSS---ADVLED--FTRLRTGGNDNNGSPLPTAD 69

Query: 101 K-LNSTLYLLPCSMISGAIGGFVGN----PADVVNIRMQND--SAHEPHLRRNYKNAIDG 153
           K L+ T      + +SGA+ GF+      P DV   R+Q    S+  P    NY N I G
Sbjct: 70  KALDDT----QITALSGAVAGFLAGITVCPLDVAKTRLQAQGLSSRLP----NYYNGILG 121

Query: 154 -VTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS-YDVCKHNLVTTF-GFDASEKKTHF 210
            +  I ++EGVR L  GL P ++ G   T     S Y+  K      F  FD     +H 
Sbjct: 122 TLNTIVRDEGVRGLYKGLVP-IIMGYFPTWMIYFSVYESSKKIYPQVFPSFDF---LSHS 177

Query: 211 TASLVAGLVATTICSPADVIKTRIM-NAHQHHES-----TLKVLSSSIRNEGLGFMFRGW 264
            ++L AG ++T + +P  V+KTR+M   H +  S     T          EG+   + G 
Sbjct: 178 ASALTAGAISTILTNPVWVVKTRLMLQTHVNENSTRYKGTFDAFHKIYTTEGIKTFYSGL 237

Query: 265 LPSF 268
           LPS 
Sbjct: 238 LPSL 241

>Skud_16.146 Chr16 complement(270247..271176) [930 bp, 309 aa] {ON}
           YPL134C (REAL)
          Length = 309

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 130/297 (43%), Gaps = 32/297 (10%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQ-----------TAARPKPTLFSMIQ----RIL 59
           Y +  G + G+   ++ +PLD+ K R+Q           TAA+     ++ +     +I+
Sbjct: 13  YQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTSKVSPGVTAAKAAAEHYTGVMDCLTKIV 72

Query: 60  KNDGPLGLYSGLTASILRQCTYTTARFGCYDFIK---ENLLPADKLNSTLYLLPCSMIS- 115
           K +G   LY G+T+ IL +      +F   D  +   + + P      T  +  CS  S 
Sbjct: 73  KREGFSRLYKGITSPILMEAPKRAIKFSGNDTFQTFYKTVFPTPNGEMTQQIAICSGASA 132

Query: 116 GAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLV 175
           GA+  F+  P ++V IR+Q+ ++        +K  I+ V     + GV  L  GL   + 
Sbjct: 133 GAVEAFIVAPFELVKIRLQDVNSQ-------FKTPIEVVKNSVMKGGVLSLFNGLEATIW 185

Query: 176 RGVLMTASQV-VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI 234
           R VL  A    + + V K  L+     +  + +    A  + G V   + +P DV+K+RI
Sbjct: 186 RHVLWNAGYFGIIFQVRK--LLPAAKTNTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRI 243

Query: 235 MNAH---QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
             +    + +  +L  +    R EG   +++G+ P   RL P   L+ +V   +  +
Sbjct: 244 QRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVLRLAPGGGLLLVVFTNVMDF 300

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 71/168 (42%), Gaps = 10/168 (5%)

Query: 106 LYLLPCSMISGAIGGFVGNPADVVNIRMQND--SAHEPHLR------RNYKNAIDGVTRI 157
           +Y      I+G     V  P DVV  RMQ    S   P +        +Y   +D +T+I
Sbjct: 12  IYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTSKVSPGVTAAKAAAEHYTGVMDCLTKI 71

Query: 158 FKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASE--KKTHFTASLV 215
            K EG  +L  G+   ++      A +    D  +    T F     E  ++    +   
Sbjct: 72  VKREGFSRLYKGITSPILMEAPKRAIKFSGNDTFQTFYKTVFPTPNGEMTQQIAICSGAS 131

Query: 216 AGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRG 263
           AG V   I +P +++K R+ + +   ++ ++V+ +S+   G+  +F G
Sbjct: 132 AGAVEAFIVAPFELVKIRLQDVNSQFKTPIEVVKNSVMKGGVLSLFNG 179

>Smik_15.407 Chr15 (707967..708890) [924 bp, 307 aa] {ON} YOR222W
           (REAL)
          Length = 307

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 125/290 (43%), Gaps = 34/290 (11%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQ-------TAARPKPT-----LFSMIQRILKND 62
           Y +  G V GI    + +PLD+ K R Q        AA  K       +   +++I+K +
Sbjct: 14  YQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPAAAAVGKQAERYNGVIDCLKKIVKKE 73

Query: 63  GPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGF- 121
           G   LY G+++ +L +      +F C D  ++        N T   +  S+ +GA  G  
Sbjct: 74  GFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKSLFNTNETTQKI--SIAAGASAGMT 131

Query: 122 ---VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGV 178
              V  P +++ IRMQ+       ++ +Y   +D + +  K EG+  L  G+   + R  
Sbjct: 132 EAAVIVPFELIKIRMQD-------VKSSYLGPMDCLKKTIKNEGIFGLYKGIESTMWRNA 184

Query: 179 LMTASQV-VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIM-- 235
           L       V + V   N +        + +    A  + G V T + +P DV+K+RI   
Sbjct: 185 LWNGGYFGVIFQV--RNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242

Query: 236 ----NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
               N+ + +  +L  L    R EG   +++G++P   RL P   L+ +V
Sbjct: 243 DAVSNSVKKYNWSLPSLLIIYREEGFRALYKGFVPKVCRLAPGGSLMLVV 292

>Kpol_312.2 s312 (5727..6908) [1182 bp, 393 aa] {ON} (5727..6908)
           [1182 nt, 394 aa]
          Length = 393

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 127/305 (41%), Gaps = 45/305 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAA-------RPKPTLFSMIQRILKNDGPLGLYSGLT 72
           G + G V+ +I  PLD+AK RLQ          +    L+  +  I++++GP GLY GL 
Sbjct: 85  GALAGFVSGVIVCPLDVAKTRLQAQGLQSRGENKYYRGLYGTLSTIVRDEGPKGLYKGLV 144

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMIS-GAIGGFVGNPADVVNI 131
             ++         F  Y+F K +  P     S      CS I+ GAI   + NP  V+  
Sbjct: 145 PILMGYLPTWMIYFSVYEFCKTS-YPQIFHKSDFVSHSCSAITAGAISTIITNPIWVIKT 203

Query: 132 R--MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
           R  +Q D         +YK   D   +I+ +EGV+ L +GL P+ + G+   A     ++
Sbjct: 204 RLMLQTDITKN---STHYKGTFDAFKKIYTQEGVKALYSGLVPSFI-GLFHVAIHFPVFE 259

Query: 190 VCK--------HNLVTTFGFDASEKKTH--------------FTASLVAGLVATTICSPA 227
             K         N  T   F     K H                AS ++ ++A+ I  P 
Sbjct: 260 KLKVMFNYKTITNTDTNLDFINGNNKNHQLHRIEYSINLNRLILASCISKMIASVITYPH 319

Query: 228 DVIKTRIM------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
           ++++TR+       ++ QH    + ++  +   EG    + G+  +  R  P + +  + 
Sbjct: 320 EILRTRMQLKSDLPSSVQH--KIIPLIKKTYAQEGFKGFYSGFSANLIRTVPASAITLVS 377

Query: 282 VEQLR 286
            E +R
Sbjct: 378 FEYVR 382

 Score = 63.9 bits (154), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 87/186 (46%), Gaps = 15/186 (8%)

Query: 112 SMISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
           + +SGA+ GFV      P DV   R+Q          + Y+     ++ I ++EG + L 
Sbjct: 81  TAMSGALAGFVSGVIVCPLDVAKTRLQAQGLQSRGENKYYRGLYGTLSTIVRDEGPKGLY 140

Query: 168 TGLGPNLVRGVLMTASQVVS-YDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSP 226
            GL P ++ G L T     S Y+ CK +      F  S+  +H  +++ AG ++T I +P
Sbjct: 141 KGLVP-ILMGYLPTWMIYFSVYEFCKTSYPQI--FHKSDFVSHSCSAITAGAISTIITNP 197

Query: 227 ADVIKTRIM------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFL 280
             VIKTR+M          H++ T          EG+  ++ G +PSF  L  +  + F 
Sbjct: 198 IWVIKTRLMLQTDITKNSTHYKGTFDAFKKIYTQEGVKALYSGLVPSFIGLF-HVAIHFP 256

Query: 281 VVEQLR 286
           V E+L+
Sbjct: 257 VFEKLK 262

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 86/208 (41%), Gaps = 35/208 (16%)

Query: 23  GGIVACIITHPLDLAKVRL--QTAARPKPT----LFSMIQRILKNDGPLGLYSGLTASIL 76
            G ++ IIT+P+ + K RL  QT      T     F   ++I   +G   LYSGL  S +
Sbjct: 187 AGAISTIITNPIWVIKTRLMLQTDITKNSTHYKGTFDAFKKIYTQEGVKALYSGLVPSFI 246

Query: 77  RQCTYTTARFGCYDFIKE--------------NLLPADKLNSTLY----------LLPCS 112
               +    F  ++ +K               + +  +  N  L+          L+  S
Sbjct: 247 -GLFHVAIHFPVFEKLKVMFNYKTITNTDTNLDFINGNNKNHQLHRIEYSINLNRLILAS 305

Query: 113 MISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGP 172
            IS  I   +  P +++  RMQ  S     ++      I  + + + +EG +   +G   
Sbjct: 306 CISKMIASVITYPHEILRTRMQLKSDLPSSVQHK---IIPLIKKTYAQEGFKGFYSGFSA 362

Query: 173 NLVRGVLMTASQVVSYDVCKHNLVTTFG 200
           NL+R V  +A  +VS++  + NL++  G
Sbjct: 363 NLIRTVPASAITLVSFEYVR-NLLSNLG 389

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 7/92 (7%)

Query: 199 FGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIM-------NAHQHHESTLKVLSSS 251
           FG   SE +    +  +AG V+  I  P DV KTR+          ++++      LS+ 
Sbjct: 71  FGLKLSETQITAMSGALAGFVSGVIVCPLDVAKTRLQAQGLQSRGENKYYRGLYGTLSTI 130

Query: 252 IRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           +R+EG   +++G +P      P  ++ F V E
Sbjct: 131 VRDEGPKGLYKGLVPILMGYLPTWMIYFSVYE 162

>Suva_13.346 Chr13 complement(573436..574539) [1104 bp, 367 aa] {ON}
           YMR166C (REAL)
          Length = 367

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 108/254 (42%), Gaps = 23/254 (9%)

Query: 20  GGVGGIVACIIT------------HPLDLAKVRLQTAARPKP--TLFSMIQRILKNDG-P 64
           GG+  I  C+I+            H LD  K R Q A   K    + S  + I   +G  
Sbjct: 48  GGLSPIWHCVISGGIGGIIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWFEEGIR 107

Query: 65  LGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGN 124
            GLY G  A++L         FG Y++ K  ++    +N T+  L    +   I  FV  
Sbjct: 108 RGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWHINDTITHLSAGFLGDFISSFVYV 167

Query: 125 PADVVNIRMQ-NDSAHEPHLRR--NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMT 181
           P++V+  R+Q     + P  +   NY N  + +  + KEEGVR L  G    L R +  +
Sbjct: 168 PSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGVRSLFFGYKATLARDLPFS 227

Query: 182 ASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLV----AGLVATTICSPADVIKTRIMNA 237
           A Q   Y+  +         D  +++   +  ++    AG +A  I +P DV+KTR+   
Sbjct: 228 ALQFAFYEKFRQLAFKIENKDGKDEELSISNEILTGACAGGLAGIITTPMDVVKTRV-QT 286

Query: 238 HQHHESTLKVLSSS 251
            Q   S+ K  S S
Sbjct: 287 QQPPSSSNKAYSVS 300

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 83/211 (39%), Gaps = 31/211 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLF----------SMIQRILKNDGPLGLYS 69
           G +G  ++  +  P ++ K RLQ   R     F          + I+ ++K +G   L+ 
Sbjct: 155 GFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGVRSLFF 214

Query: 70  GLTASILRQCTYTTARFGCYD------FIKENLLPADKLNSTLYLLPCSMISGAIGGFVG 123
           G  A++ R   ++  +F  Y+      F  EN    D+  S    +     +G + G + 
Sbjct: 215 GYKATLARDLPFSALQFAFYEKFRQLAFKIENKDGKDEELSISNEILTGACAGGLAGIIT 274

Query: 124 NPADVVNIRMQND----------SAHEPHLRRNYKNAID-----GVTRIFKEEGVRKLLT 168
            P DVV  R+Q            S   PH+      A+       +  +++ EG     +
Sbjct: 275 TPMDVVKTRVQTQQPPSSSNKAYSVSHPHVTNGRPVALSNSILLSLRTVYQSEGALGFFS 334

Query: 169 GLGPNLVRGVLMTASQVVSYDVCKHNLVTTF 199
           G+GP  V   + ++  ++ Y +    L  TF
Sbjct: 335 GVGPRFVWTSVQSSIMLLLYQMTLRGLGNTF 365

>Suva_16.176 Chr16 complement(308048..308977) [930 bp, 309 aa] {ON}
           YPL134C (REAL)
          Length = 309

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 128/297 (43%), Gaps = 32/297 (10%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVR--LQTAARPKPTLFSM-------------IQRIL 59
           Y +  G + G+   ++ +PLD+ K R  LQ     KP + ++             + +I+
Sbjct: 13  YQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTTSKPGVAALKAVGEHYTGVMDCLTKIV 72

Query: 60  KNDGPLGLYSGLTASILRQCTYTTARFGCYDFIK---ENLLPADKLNSTLYLLPCSMIS- 115
           K +G   LY G+T+ IL +      +F   D  +   + L P      T  +  CS  S 
Sbjct: 73  KKEGFSRLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKLFPTPNGEMTQKIAICSGASA 132

Query: 116 GAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLV 175
           GA+  F+  P ++V IR+Q+       +   +K  I+ V     + GV  L  GL   + 
Sbjct: 133 GAVEAFIVAPFELVKIRLQD-------VNSPFKTPIEVVKNCVVKGGVLSLFNGLEATIW 185

Query: 176 RGVLMTASQV-VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI 234
           R VL  A    + + V K  ++     +  + +    A  + G V   + +P DV+K+RI
Sbjct: 186 RHVLWNAGYFGIIFQVRK--ILPAAKTNTEKTRNDMIAGAIGGTVGCLLNTPFDVVKSRI 243

Query: 235 MNAH---QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
             +    + +  +L  +    R EG   +++G+ P   RL P   L+ +V   +  +
Sbjct: 244 QRSSGPLRKYNWSLPSVFVVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDF 300

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 71/168 (42%), Gaps = 10/168 (5%)

Query: 106 LYLLPCSMISGAIGGFVGNPADVVNIRMQND--SAHEPHLR------RNYKNAIDGVTRI 157
           +Y      I+G     V  P DVV  RMQ    +  +P +        +Y   +D +T+I
Sbjct: 12  IYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTTSKPGVAALKAVGEHYTGVMDCLTKI 71

Query: 158 FKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASE--KKTHFTASLV 215
            K+EG  +L  G+   ++      A +    D  +      F     E  +K    +   
Sbjct: 72  VKKEGFSRLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKLFPTPNGEMTQKIAICSGAS 131

Query: 216 AGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRG 263
           AG V   I +P +++K R+ + +   ++ ++V+ + +   G+  +F G
Sbjct: 132 AGAVEAFIVAPFELVKIRLQDVNSPFKTPIEVVKNCVVKGGVLSLFNG 179

>NDAI0B01060 Chr2 (250970..252154) [1185 bp, 394 aa] {ON} Anc_7.133
          Length = 394

 Score = 80.5 bits (197), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 131/293 (44%), Gaps = 26/293 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQT---AARPKPT---LFSMIQRILKNDGPLGLYSGLTA 73
           G + G ++ +   PLD+ K RLQ         P    L   +  I+K++G  GLY G+  
Sbjct: 106 GALAGFLSGVTVCPLDVTKTRLQAQGIEGIENPYYRGLLGTMSTIVKDEGVKGLYKGIVP 165

Query: 74  SILRQCTYTTARFGCYDFIKE---NLLPADKLNSTLYLLPCSMIS-GAIGGFVGNPADVV 129
            I+      T  F  Y+  K+    LLP  +  S      CS I+ GA    + NP  VV
Sbjct: 166 IIMGYFPTWTIYFSVYEISKDMYSKLLPYSEFLSH----SCSAITAGAASTILTNPIWVV 221

Query: 130 NIRM--QNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
             R+  Q   A  P     Y   ID   +I ++EG+R L TGL P+L  G+L  A     
Sbjct: 222 KTRLMLQTPMAKHPTY---YSGTIDAFRKIIRQEGIRTLYTGLVPSLF-GLLHVAIHFPV 277

Query: 188 YDVCKHNL-VTTFGFDAS-EKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTL 245
           Y+  K  L   +   D S + K    AS V+ ++A++I  P ++++TR+    +    T 
Sbjct: 278 YEKLKRKLHCDSKETDHSIQLKRLIIASSVSKMIASSITYPHEILRTRMQIKLKSPNPTQ 337

Query: 246 KVLSSSIR----NEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQ 294
           + L + I+     EG+   + G+  +  R  P + +  +  E  R   I +++
Sbjct: 338 RKLFTLIKKTFVQEGIMGFYSGFATNLIRTVPASAITLVSFEYFRNTLIRLNE 390

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 100/211 (47%), Gaps = 26/211 (12%)

Query: 91  FIKENLLPADKLNSTLYLLPCSMISGAIGGFVGN----PADVVNIRMQN---DSAHEPHL 143
           F  +N L + KL+ T      + +SGA+ GF+      P DV   R+Q    +    P+ 
Sbjct: 85  FPFKNPLRSIKLSDT----KITALSGALAGFLSGVTVCPLDVTKTRLQAQGIEGIENPY- 139

Query: 144 RRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS-YDVCKHNLVTTFGFD 202
              Y+  +  ++ I K+EGV+ L  G+ P ++ G   T +   S Y++ K        + 
Sbjct: 140 ---YRGLLGTMSTIVKDEGVKGLYKGIVP-IIMGYFPTWTIYFSVYEISKDMYSKLLPY- 194

Query: 203 ASEKKTHFTASLVAGLVATTICSPADVIKTRIM------NAHQHHESTLKVLSSSIRNEG 256
            SE  +H  +++ AG  +T + +P  V+KTR+M          ++  T+      IR EG
Sbjct: 195 -SEFLSHSCSAITAGAASTILTNPIWVVKTRLMLQTPMAKHPTYYSGTIDAFRKIIRQEG 253

Query: 257 LGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           +  ++ G +PS   L  +  + F V E+L++
Sbjct: 254 IRTLYTGLVPSLFGLL-HVAIHFPVYEKLKR 283

>TBLA0B04020 Chr2 complement(920523..921419) [897 bp, 298 aa] {ON}
           Anc_8.644 YOR222W
          Length = 298

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 123/294 (41%), Gaps = 27/294 (9%)

Query: 6   SESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQ-TAARPKPT--------LFSMIQ 56
           SE  N    Y +  G V GI   ++ +PLD+ K R+Q   + P  T        +     
Sbjct: 2   SEKKNTPFVYKFTAGAVAGISEILLMYPLDVVKTRMQLQVSNPGITNSDTMYGGIIDCFT 61

Query: 57  RILKNDGPLGLYSGLTASILRQCTYTTARFGC---YDFIKENLLPADKLNSTLYLLPCSM 113
           ++++ +G   LY G+++ IL +      +F     + +  + L P     S   L   S 
Sbjct: 62  KMIRKEGASKLYKGISSPILMEAPKRATKFATNEEFSYQYKRLFPNVGAQSIATLSGAS- 120

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPN 173
            +G    FV  P ++V IR+Q+ ++        +K  +D +  + K+EGV  +  GL   
Sbjct: 121 -AGICEAFVVVPFELVKIRLQDRNSV-------FKGPLDVLRNLIKKEGVFSIYNGLEST 172

Query: 174 LVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTR 233
           L R  +  A    S    +  L      + +       A ++ G +   +  P DV+K+R
Sbjct: 173 LWRQSVWNAGYFGSIFQIRSILNQYPSMEKNVTIRDLIAGMIGGTIGVLLNIPFDVVKSR 232

Query: 234 IM------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
           I       N  + +      L    R EG   +++G+LP   RLGP   ++ +V
Sbjct: 233 IQSQPILENGVRKYNWAWPSLFVVYREEGFLALYKGFLPKVVRLGPGGGIMLVV 286

>ZYRO0D09218g Chr4 (792744..793802) [1059 bp, 352 aa] {ON} similar
           to uniprot|P40556 Saccharomyces cerevisiae YIL006W
           Pvruvate transporter of the mitochondrial inner membrane
           member of the mitochondrial carrier family has putative
           mouse and human orthologs
          Length = 352

 Score = 80.1 bits (196), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 122/288 (42%), Gaps = 24/288 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT-------LFSMIQRILKNDGPLGLYSGLT 72
           G + G ++ +   PLD+AK RLQ               +F  ++ I +++GP G+Y GL 
Sbjct: 49  GALAGFLSGVAVCPLDVAKTRLQAQGMQSQNENKYYRGMFGTLRTIYRDEGPRGMYKGLV 108

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMIS-GAIGGFVGNPADVVNI 131
             +L         F  Y+F K+ L PA           CS IS GA+     NP  VV  
Sbjct: 109 PIVLGYFPTWMIYFSVYEFCKD-LYPALFPGYDFISHSCSAISAGAVSTICTNPIWVVKT 167

Query: 132 R--MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
           R  +Q   +  P    +YK   D   +I+ +EG++    GL P+L+ G+   A     Y+
Sbjct: 168 RLMLQTHVSTNP---THYKGTRDAFRKIWNQEGIKSFYAGLIPSLL-GLFHVAIHFPVYE 223

Query: 190 VCKHNLVTTFGFD-ASEKKTHF----TASLVAGLVATTICSPADVIKTRIMNAHQHHEST 244
             K         D  S +  H      AS  + +VA+ I  P ++++TR+        + 
Sbjct: 224 KLKITFKCYGDSDLRSGRSLHLGRLILASCCSKMVASLITYPHEILRTRMQLKSNLPSTV 283

Query: 245 LKVLSSSIRN----EGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
            K L   I+N    EG    + G+  +  R  P + +  +  E +R +
Sbjct: 284 QKRLFPLIKNTYQREGFRAFYSGFATNLFRTVPASAITLVSFEYVRDH 331

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 84/185 (45%), Gaps = 17/185 (9%)

Query: 114 ISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTG 169
           ISGA+ GF+      P DV   R+Q       +  + Y+     +  I+++EG R +  G
Sbjct: 47  ISGALAGFLSGVAVCPLDVAKTRLQAQGMQSQNENKYYRGMFGTLRTIYRDEGPRGMYKG 106

Query: 170 LGPNLVRGVLMTASQVVS-YDVCKHNLVTTF-GFDASEKKTHFTASLVAGLVATTICSPA 227
           L P +V G   T     S Y+ CK      F G+D     +H  +++ AG V+T   +P 
Sbjct: 107 LVP-IVLGYFPTWMIYFSVYEFCKDLYPALFPGYDF---ISHSCSAISAGAVSTICTNPI 162

Query: 228 DVIKTRIM-NAH-----QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
            V+KTR+M   H      H++ T          EG+   + G +PS   L  +  + F V
Sbjct: 163 WVVKTRLMLQTHVSTNPTHYKGTRDAFRKIWNQEGIKSFYAGLIPSLLGLF-HVAIHFPV 221

Query: 282 VEQLR 286
            E+L+
Sbjct: 222 YEKLK 226

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 80/188 (42%), Gaps = 17/188 (9%)

Query: 23  GGIVACIITHPLDLAKVRL--QTAARPKPTLF----SMIQRILKNDGPLGLYSGLTASIL 76
            G V+ I T+P+ + K RL  QT     PT +       ++I   +G    Y+GL  S+L
Sbjct: 151 AGAVSTICTNPIWVVKTRLMLQTHVSTNPTHYKGTRDAFRKIWNQEGIKSFYAGLIPSLL 210

Query: 77  RQCTYTTARFGCYDFIK-------ENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVV 129
               +    F  Y+ +K       ++ L + +      L+  S  S  +   +  P +++
Sbjct: 211 -GLFHVAIHFPVYEKLKITFKCYGDSDLRSGRSLHLGRLILASCCSKMVASLITYPHEIL 269

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
             RMQ  S     ++   K     +   ++ EG R   +G   NL R V  +A  +VS++
Sbjct: 270 RTRMQLKSNLPSTVQ---KRLFPLIKNTYQREGFRAFYSGFATNLFRTVPASAITLVSFE 326

Query: 190 VCKHNLVT 197
             + ++ +
Sbjct: 327 YVRDHITS 334

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 48/110 (43%), Gaps = 9/110 (8%)

Query: 181 TASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI------ 234
           ++S VV  + C+  ++   G      +    +  +AG ++     P DV KTR+      
Sbjct: 19  SSSDVV--EPCRSEIIDNDGSRLGGTQIVAISGALAGFLSGVAVCPLDVAKTRLQAQGMQ 76

Query: 235 -MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
             N ++++      L +  R+EG   M++G +P      P  ++ F V E
Sbjct: 77  SQNENKYYRGMFGTLRTIYRDEGPRGMYKGLVPIVLGYFPTWMIYFSVYE 126

>KLTH0G09020g Chr7 (736937..737866) [930 bp, 309 aa] {ON} similar to
           uniprot|P40464 Saccharomyces cerevisiae YIL134W FLX1
           Protein required for transport of flavin adenine
           dinucleotide (FAD) from mitochondria where it is
           synthesized from riboflavin to the cytosol
          Length = 309

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 124/298 (41%), Gaps = 33/298 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT--LFSMIQRILKNDGPLGL-----YSGLT 72
           G   G +  + THPLDL K+RLQ  A    +     +I+ I+ +    G      Y GL 
Sbjct: 15  GLSAGTLTTVATHPLDLVKLRLQLLATSHQSHGYTEVIKTIVTDSKANGTFIREAYRGLG 74

Query: 73  ASILRQCTYTTARFGCYDFIKENL---------------LPADKLNSTLYLLPCSMISGA 117
            +++         FG Y F K+ +                  D     L+ L  + +SG 
Sbjct: 75  VNLVGNSIAWGLYFGLYRFSKDAVYRMWTKDPDSDGQTSFQKDSTMGPLFYLASAALSGI 134

Query: 118 IGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG 177
               + NP  VV  R+ + +A   H    YK   DG+ +I+ +EG+     GL P+L  G
Sbjct: 135 ATAVLTNPIWVVKTRIMSTNARAAH---GYKTMWDGIRKIYTQEGLTGFWRGLLPSLF-G 190

Query: 178 VLMTASQVVSYDVCKHNLVTTFGFDASEKKTHF---TASLVAGLVATTICSPADVIKTRI 234
           V   A    +YD  KH    + G    +K  +      + V+ +V+ +   P  ++K+ +
Sbjct: 191 VGQGAIYFTAYDSLKHRYFASRGIHKEQKLDNLENIALTSVSRMVSVSAVYPLQLLKSNL 250

Query: 235 MN---AHQHHESTLKVLSSSI-RNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
            +     Q +   L  L  SI   +G   +++G   +  R  P+T + F + E +R +
Sbjct: 251 QSFEAVKQQNSYKLWALIRSIYYKDGAKGLYKGLSANLVRALPSTCITFCIYENMRHW 308

>Ecym_7045 Chr7 complement(90632..91738) [1107 bp, 368 aa] {ON}
           similar to Ashbya gossypii AEL253W
          Length = 368

 Score = 79.7 bits (195), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 130/313 (41%), Gaps = 53/313 (16%)

Query: 16  PWWY---GGVGGIVACIITHPLDLAKVRLQTA---------ARPKPT------------- 50
           PW +   GG+GG++  ++T P D+ K RLQ++         A P  T             
Sbjct: 49  PWVHFVAGGIGGVMGAVVTCPFDVVKTRLQSSMFQTAYRSNAAPITTPINIVSRGLIHFK 108

Query: 51  -LFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLL 109
             F +I  +   +G   L+ GL  +++      +  F  Y   K+  + +   N+     
Sbjct: 109 ETFGIIHNLYSQEGFRSLFKGLGPNLIGVIPARSINFFTYGTTKD--ICSRLFNNGEESP 166

Query: 110 PCSMISGAIGGF----VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRK 165
               ++GA  G+      NP  +V  R+Q D A E    R YKN+ D +  + + EG+  
Sbjct: 167 SIHFLAGATAGWATSTATNPIWLVKTRLQLDKA-EKSTARKYKNSWDCIKNVVRNEGILG 225

Query: 166 LLTGLGPNLVRGVLMTASQVVSYD----VCKHNLVTTFGFDASEKKTHFT---------- 211
           L  GL  + + G + +  Q V Y+    + K   +  FG  + E K+ +           
Sbjct: 226 LYKGLSASYL-GSVESILQWVLYEQMKRIVKQRSIEEFGDISEENKSTYLKIKEWCQRSG 284

Query: 212 ASLVAGLVATTICSPADVIKTR-----IMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLP 266
            +  A L A+ I  P +VI+TR     + N    +   L+      + EG   M+ G  P
Sbjct: 285 GAGAAKLFASIITYPHEVIRTRLRQAPVENGKLKYTGLLQSFRIIFKEEGFRSMYGGLTP 344

Query: 267 SFARLGPNTILIF 279
              R  PN+I++F
Sbjct: 345 HLLRTVPNSIIMF 357

 Score = 64.7 bits (156), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 98/221 (44%), Gaps = 32/221 (14%)

Query: 96  LLPADKLNSTLYLLP-CSMISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRN---- 146
           +L  DK+ +     P    ++G IGG +G     P DVV  R+Q+ S  +   R N    
Sbjct: 35  ILLQDKIKNYSQTPPWVHFVAGGIGGVMGAVVTCPFDVVKTRLQS-SMFQTAYRSNAAPI 93

Query: 147 -------------YKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKH 193
                        +K     +  ++ +EG R L  GLGPNL+  +   +    +Y   K 
Sbjct: 94  TTPINIVSRGLIHFKETFGIIHNLYSQEGFRSLFKGLGPNLIGVIPARSINFFTYGTTKD 153

Query: 194 NLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIM------NAHQHHESTLKV 247
                F         HF A   AG   +T  +P  ++KTR+       +  + ++++   
Sbjct: 154 ICSRLFNNGEESPSIHFLAGATAGWATSTATNPIWLVKTRLQLDKAEKSTARKYKNSWDC 213

Query: 248 LSSSIRNEGLGFMFRGWLPSFARLGP-NTILIFLVVEQLRK 287
           + + +RNEG+  +++G   S+  LG   +IL +++ EQ+++
Sbjct: 214 IKNVVRNEGILGLYKGLSASY--LGSVESILQWVLYEQMKR 252

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTA----ARPKPT-LFSMIQRILKNDGPLGLYSGLTAS 74
            G   + A IIT+P ++ + RL+ A     + K T L    + I K +G   +Y GLT  
Sbjct: 286 AGAAKLFASIITYPHEVIRTRLRQAPVENGKLKYTGLLQSFRIIFKEEGFRSMYGGLTPH 345

Query: 75  ILRQCTYTTARFGCYDFI 92
           +LR    +   FG ++ +
Sbjct: 346 LLRTVPNSIIMFGTWELV 363

>KAFR0D02750 Chr4 complement(543629..544516) [888 bp, 295 aa] {ON}
           Anc_3.348 YPR058W
          Length = 295

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 115/275 (41%), Gaps = 21/275 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GG+   ++  P D  KVRLQT+     T F +I+R++KN+G L  Y G    ++   
Sbjct: 24  GTFGGVAQVLVGQPFDTTKVRLQTSPHGTRT-FEIIKRLVKNEGILAFYKGTLTPLVGVG 82

Query: 80  TYTTARFGCYDFIKENLL-----PADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ 134
              + +FG  + +K           D   S  Y+    M+ G    F+ +P + V IR+Q
Sbjct: 83  ACVSVQFGVNESMKRWFRYHVNDGKDLKLSQFYM--SGMMGGLCNSFLCSPIEHVRIRLQ 140

Query: 135 NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHN 194
             S    H  + +    D V ++ +    R L+ GL   ++R         ++Y+    N
Sbjct: 141 TQS----HGTKEFNGPWDCVKKLVQN---RSLMKGLPVMMLRAGHGLGCYFLTYEALIKN 193

Query: 195 LVTTFGFDASEKKTHFTASL--VAGLVATTICSPADVIKTRIMNAHQHH----ESTLKVL 248
            +       +E ++        VAG +      P DVIK+ I   +  H     S +K  
Sbjct: 194 ELGRRSVHRNEIESWKLCVFGSVAGTMLWLCIYPLDVIKSMIQTDNLMHPKFNNSMMKAT 253

Query: 249 SSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
            +  R EGL   F+G+ P+  R  P     FL  E
Sbjct: 254 KTLYRKEGLKGFFKGFTPTLLRASPANGATFLTFE 288

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/183 (19%), Positives = 79/183 (43%), Gaps = 23/183 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTL---FSMIQRILKNDGPLGLYSGLTASIL 76
           G +GG+    +  P++  ++RLQT +         +  ++++++N     L  GL   +L
Sbjct: 118 GMMGGLCNSFLCSPIEHVRIRLQTQSHGTKEFNGPWDCVKKLVQNRS---LMKGLPVMML 174

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLY--------LLPCSMISGAIGGFVGNPADV 128
           R         GCY    E L+  +    +++        L     ++G +      P DV
Sbjct: 175 R----AGHGLGCYFLTYEALIKNELGRRSVHRNEIESWKLCVFGSVAGTMLWLCIYPLDV 230

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTR-IFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           +   +Q D+   P     + N++   T+ ++++EG++    G  P L+R      +  ++
Sbjct: 231 IKSMIQTDNLMHP----KFNNSMMKATKTLYRKEGLKGFFKGFTPTLLRASPANGATFLT 286

Query: 188 YDV 190
           +++
Sbjct: 287 FEM 289

 Score = 32.7 bits (73), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 4/76 (5%)

Query: 19  YGGVGGIVACIITHPLDLAKVRLQTAARPKP----TLFSMIQRILKNDGPLGLYSGLTAS 74
           +G V G +  +  +PLD+ K  +QT     P    ++    + + + +G  G + G T +
Sbjct: 213 FGSVAGTMLWLCIYPLDVIKSMIQTDNLMHPKFNNSMMKATKTLYRKEGLKGFFKGFTPT 272

Query: 75  ILRQCTYTTARFGCYD 90
           +LR      A F  ++
Sbjct: 273 LLRASPANGATFLTFE 288

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 212 ASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARL 271
           A    G+    +  P D  K R+  +  H   T +++   ++NEG+   ++G L     +
Sbjct: 23  AGTFGGVAQVLVGQPFDTTKVRLQTS-PHGTRTFEIIKRLVKNEGILAFYKGTLTPLVGV 81

Query: 272 GPNTILIFLVVEQLRKY 288
           G    + F V E ++++
Sbjct: 82  GACVSVQFGVNESMKRW 98

>CAGL0M09020g Chr13 complement(896312..897358) [1047 bp, 348 aa]
           {ON} highly similar to uniprot|P33303 Saccharomyces
           cerevisiae YJR095w succinate-fumarate transporter
          Length = 348

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 118/316 (37%), Gaps = 50/316 (15%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ---------------------------------TAAR 46
           GG  G+   +  HPLD  KVR+Q                                 TAA 
Sbjct: 18  GGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDATAAI 77

Query: 47  PKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
             P      + I   +G L LY GL A ++        RF  Y+F +  L  ADK  + +
Sbjct: 78  KPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLL--ADK-QTGV 134

Query: 107 YLLPCSMISGAIGG-----FVGNPADVVNIRMQNDSAHEPH--LRRNYKNAIDGVTRIFK 159
                + I+G   G      V NP +VV IR+Q    +  H   +  Y NA+     I K
Sbjct: 135 VSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIK 194

Query: 160 EEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLV 219
           EEG+  L  G+     R      +    Y   +  L    G +           L++G +
Sbjct: 195 EEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLISGAI 254

Query: 220 ATTICSPADVIKTRIMNAHQ---HHESTLKVL----SSSIRNEGLGFMFRGWLPSFARLG 272
                +P D IKTR+          ES  K +    +  ++ EG   +++G  P   R+ 
Sbjct: 255 GPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVA 314

Query: 273 PNTILIFLVVEQLRKY 288
           P   + F V E +R++
Sbjct: 315 PGQAVTFTVYEFVRRH 330

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 41/95 (43%), Gaps = 17/95 (17%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQTAARPKPTLF---SMIQRI-------LKN 61
           P W     G + G +      PLD  K RLQ   + K T F   S  +RI       LK 
Sbjct: 240 PSWETSCIGLISGAIGPFSNAPLDTIKTRLQ---KDKSTSFKGESGWKRIAHIGTQLLKE 296

Query: 62  DGPLGLYSGLTASILRQCTYTTARFGCYDFIKENL 96
           +G   LY G+T  ++R        F  Y+F++ +L
Sbjct: 297 EGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 331

>KLTH0E06996g Chr5 (644098..646746) [2649 bp, 882 aa] {ON} similar
           to uniprot|Q12482 Saccharomyces cerevisiae YPR021C AGC1
           Mitochondrial transporter acts both as a glutamate
           uniporter and as an aspartate- glutamate exchanger
           involved in nitrogen metabolism ornithine synthesis and
           the malate-aspartate NADH shuttle
          Length = 882

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 111/235 (47%), Gaps = 27/235 (11%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQTA---ARPKPTLFSMIQRILKNDGPLGLYSGL 71
           Y +  G V G +     +P+DL K R+Q     ++ K ++   + +I   +G  G+YSGL
Sbjct: 502 YNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFV-KIFSREGVRGIYSGL 560

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPAD 127
              ++        +    D++++ L+ +   N+ L  LP  ++SGA  G       NP +
Sbjct: 561 GPQLVGVAPEKAIKLTVNDYVRKMLMDS---NNHL-TLPLEILSGASAGACQVIFTNPLE 616

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           +V IR+Q  S +   + R+  NA      I K  G+R L  G+G  L+R V  +A    +
Sbjct: 617 IVKIRLQVRSEYAESISRSQVNAFG----IVKSLGLRGLYRGIGACLMRDVPFSAIYFPT 672

Query: 188 YDVCKHNLVTTFGFDASEKKTH--------FTASLVAGLVATTICSPADVIKTRI 234
           Y   K ++   F +D  +K            TA  +AG+ A  + +P DVIKTR+
Sbjct: 673 YAHLKKDI---FNYDPQDKNGRTRLRTWELLTAGGLAGMPAAYLTTPFDVIKTRL 724

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 84/196 (42%), Gaps = 28/196 (14%)

Query: 104 STLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRN---YKNAIDGVTRIFKE 160
            ++Y      ++G IG     P D+V  RMQ         +RN   YKN+ID   +IF  
Sbjct: 499 DSIYNFLLGSVAGCIGATAVYPIDLVKTRMQ--------AQRNFSQYKNSIDCFVKIFSR 550

Query: 161 EGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASL------ 214
           EGVR + +GLGP LV      A ++   D  +  L+        +   H T  L      
Sbjct: 551 EGVRGIYSGLGPQLVGVAPEKAIKLTVNDYVRKMLM--------DSNNHLTLPLEILSGA 602

Query: 215 VAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSS---IRNEGLGFMFRGWLPSFARL 271
            AG       +P +++K R+    ++ ES  +   ++   +++ GL  ++RG      R 
Sbjct: 603 SAGACQVIFTNPLEIVKIRLQVRSEYAESISRSQVNAFGIVKSLGLRGLYRGIGACLMRD 662

Query: 272 GPNTILIFLVVEQLRK 287
            P + + F     L+K
Sbjct: 663 VPFSAIYFPTYAHLKK 678

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 93/221 (42%), Gaps = 24/221 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ-------TAARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           G   G    I T+PL++ K+RLQ       + +R +   F +++ +    G  GLY G+ 
Sbjct: 601 GASAGACQVIFTNPLEIVKIRLQVRSEYAESISRSQVNAFGIVKSL----GLRGLYRGIG 656

Query: 73  ASILRQCTYTTARFGCYDFIKENLL---PADKLNST----LYLLPCSMISGAIGGFVGNP 125
           A ++R   ++   F  Y  +K+++    P DK   T      LL    ++G    ++  P
Sbjct: 657 ACLMRDVPFSAIYFPTYAHLKKDIFNYDPQDKNGRTRLRTWELLTAGGLAGMPAAYLTTP 716

Query: 126 ADVVNIRMQNDSAHEPHLRRNYKNAI-DGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
            DV+  R+Q D    P       N I      I KEE  +    G G  ++R        
Sbjct: 717 FDVIKTRLQID----PRKGETKYNGIWHAAKTILKEERFKSFFKGGGARVLRSSPQFGFT 772

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICS 225
           + +Y++ + NL      + +  K      +V G+ ++ + S
Sbjct: 773 LAAYEIFQ-NLFPLKHSEVNNTKQDDDTPIVTGMFSSFLES 812

>CAGL0D01606g Chr4 complement(169066..169983) [918 bp, 305 aa] {ON}
           highly similar to uniprot|P32331 Saccharomyces
           cerevisiae YPR058w YMC1 or uniprot|P38087 Saccharomyces
           cerevisiae YBR104w YMC2
          Length = 305

 Score = 78.2 bits (191), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 121/276 (43%), Gaps = 21/276 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GGI   +I  P D  KVRLQT+  P  +   +++ +LKN+GP G Y G    ++   
Sbjct: 32  GTAGGIAQVLIGQPFDTTKVRLQTSKVPT-SAAEVVKNLLKNEGPKGFYKGTLTPLVGVG 90

Query: 80  TYTTARFGCYDFIK-----ENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ 134
              + +FG  + +K      N+     L+ + Y L C +  G    F+ +P + V IR+Q
Sbjct: 91  ACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYL-CGLTGGMTNSFLASPIEHVRIRLQ 149

Query: 135 NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHN 194
             +      +  +K  ID + ++  ++G   L+ GL P ++R      +  + Y+     
Sbjct: 150 TQTGS--GAQAEFKGPIDCIKKLRSQKG---LMRGLIPTMLREGHGCGTYFLVYEALVSK 204

Query: 195 LVTTFGFDASEKKTHFTASLVAGLVATTI---CSPADVIK----TRIMNAHQHHESTLKV 247
            +   G   +E    +   L   L  T +     P DV+K    T  +N  Q+ ++ ++V
Sbjct: 205 QINQ-GLKRTEIPP-WKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQV 262

Query: 248 LSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
             +    EGL   F+G+ P+  R  P     F   E
Sbjct: 263 ARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFE 298

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 80/195 (41%), Gaps = 22/195 (11%)

Query: 10  NAVVKYPWWY--GGVGGIVACIITHPLDLAKVRLQT--AARPKPTLFSMIQRILKNDGPL 65
           NA +    +Y  G  GG+    +  P++  ++RLQT   +  +      I  I K     
Sbjct: 115 NATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQK 174

Query: 66  GLYSGLTASILRQCTYTTARFGCYDFI---------KENLLPADKLNSTLYLLPCSMISG 116
           GL  GL  ++LR+       F  Y+ +         K   +P  KL   LY      +SG
Sbjct: 175 GLMRGLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKL--CLY----GALSG 228

Query: 117 AIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
                +  P DVV   MQ D+ ++P   +N KN I     ++  EG++    G GP ++R
Sbjct: 229 TALWLMVYPIDVVKSVMQTDNLNKP---QNGKNMIQVARNLYAREGLKAFFKGFGPTMLR 285

Query: 177 GVLMTASQVVSYDVC 191
                     ++++ 
Sbjct: 286 AAPANGGTFATFELA 300

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 39/204 (19%), Positives = 71/204 (34%), Gaps = 50/204 (24%)

Query: 112 SMISGAIGG----FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
            +++G  GG     +G P D   +R+Q              +A + V  + K EG +   
Sbjct: 28  DLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPT--------SAAEVVKNLLKNEGPKGFY 79

Query: 168 TGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKK----------------THFT 211
            G           T + +V    C   +   FG + + K+                 ++ 
Sbjct: 80  KG-----------TLTPLVGVGAC---VSIQFGVNEAMKRFFHARNVDHNATLSLSQYYL 125

Query: 212 ASLVAGLVATTICSPADVIKTRIMN-----AHQHHESTLKVLSSSIRNEGLGFMFRGWLP 266
             L  G+  + + SP + ++ R+       A    +  +  +      +GL    RG +P
Sbjct: 126 CGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGL---MRGLIP 182

Query: 267 SFARLGPNTILIFLVVEQLRKYEI 290
           +  R G      FLV E L   +I
Sbjct: 183 TMLREGHGCGTYFLVYEALVSKQI 206

>TBLA0D04160 Chr4 (1031885..1032784) [900 bp, 299 aa] {ON} Anc_7.228
           YER053C
          Length = 299

 Score = 78.2 bits (191), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 121/284 (42%), Gaps = 25/284 (8%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLFSMIQRILKNDGPL-GLYSGLTASIL 76
           +GGI+AC  TH    PLDL K RLQ       +     Q I+KN+G +  +++G  A+ +
Sbjct: 17  LGGIIACGPTHSSVTPLDLVKCRLQVNPSLYKSNLQGWQNIIKNEGGVKAIFTGFGATFI 76

Query: 77  RQCTYTTARFGCYDFIK---ENLLPADKLN-STLYLLPCSMISGAIGGFVGNPADVVNIR 132
                   ++G Y+F K       P    N STL  L  S  +  +   +  P + + +R
Sbjct: 77  GYSLQGAGKYGGYEFFKHYYSTWFPNLYSNYSTLVYLGASGTAEFLADIMLCPFEAIKVR 136

Query: 133 MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCK 192
            Q  +   P      KN   G ++I  +EG+  L  G+ P   R +  T  +  S++   
Sbjct: 137 QQ--TTMPPFC----KNVFQGWSKIVSKEGIAGLYKGITPLWFRQIPYTMVKFTSFEKIV 190

Query: 193 HNLVTTFGFDASEKK------THFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLK 246
            ++ +      S+          FT   +AG++   +  PADV+ ++I N     E  L 
Sbjct: 191 ESIYSYLPTPKSQMSMLQQISVSFTGGYLAGILCAAVSHPADVMVSKINNERAKDEEMLA 250

Query: 247 VLSSSIRNEGLGFM--FRGWLPSFARLGPNTILIFLVVEQLRKY 288
             +  I N  +GFM  + G       +G  T   +L+ +  + Y
Sbjct: 251 A-TKRIYNR-IGFMGLWNGLTVRIFMIGTLTSFQWLIYDSFKAY 292

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 79/181 (43%), Gaps = 16/181 (8%)

Query: 21  GVGGIVACIITHPLDLAKVRLQTAARPK-PTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G    +A I+  P +  KVR QT   P    +F    +I+  +G  GLY G+T    RQ 
Sbjct: 117 GTAEFLADIMLCPFEAIKVRQQTTMPPFCKNVFQGWSKIVSKEGIAGLYKGITPLWFRQI 176

Query: 80  TYTTARFGCYDFIKENL---LPADKLN-STLYLLPCSMISGAIGGF----VGNPADVVNI 131
            YT  +F  ++ I E++   LP  K   S L  +  S   G + G     V +PADV+  
Sbjct: 177 PYTMVKFTSFEKIVESIYSYLPTPKSQMSMLQQISVSFTGGYLAGILCAAVSHPADVMVS 236

Query: 132 RMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
           ++ N+ A +  +       +    RI+   G   L  GL   +     +T+ Q + YD  
Sbjct: 237 KINNERAKDEEM-------LAATKRIYNRIGFMGLWNGLTVRIFMIGTLTSFQWLIYDSF 289

Query: 192 K 192
           K
Sbjct: 290 K 290

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+   ++HP D+   ++         + +  +RI    G +GL++GLT  I    
Sbjct: 217 GYLAGILCAAVSHPADVMVSKINNERAKDEEMLAATKRIYNRIGFMGLWNGLTVRIFMIG 276

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 277 TLTSFQWLIYDSFK 290

>Kpol_1070.14 s1070 (37139..38056) [918 bp, 305 aa] {ON}
           (37139..38056) [918 nt, 306 aa]
          Length = 305

 Score = 78.2 bits (191), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 118/285 (41%), Gaps = 24/285 (8%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLG-LYSGLTASIL 76
           +GGIVAC  TH    PLDL K RLQ       +     ++I+K +G +  +++G+ A+ +
Sbjct: 20  LGGIVACGPTHSSVTPLDLVKCRLQVNPDLYTSNLQGWKQIIKTEGGVSKIFTGVGATFI 79

Query: 77  RQCTYTTARFGCYDFIKE-----NLLPADKLNS--TLYLLPCSMISGAIGGFVGNPADVV 129
                   ++G Y+F K       L   + +N   TL  L  S  +  I      P + +
Sbjct: 80  GYSLQGAGKYGGYEFFKHYYSHTGLFSQETVNKHKTLVYLAASATAEFIADIFLCPFEAI 139

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
            +R Q        L   YKN  +G+++++  EG+     G+ P   R +  T  +  S++
Sbjct: 140 KVRQQTT------LPPAYKNVFEGLSKVYANEGLTGFYKGITPLWCRQIPYTMCKFTSFE 193

Query: 190 VCKHNLVTTFGFDASEKKT------HFTASLVAGLVATTICSPADVIKTRIMNAHQHHES 243
                +        SE          F    +AG++   +  PADV+ +++    + +ES
Sbjct: 194 KIVEGIYHRLPVKKSEMNALQQISVSFAGGYLAGILCAIVSHPADVMVSKVNVDRKPNES 253

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
                S   +  G   ++ G       +G  T   +L+ +  + Y
Sbjct: 254 MGAATSRIYKQIGFNGLWNGLPLRIVMIGTLTSFQWLIYDSFKAY 298

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+  I++HP D+   ++    +P  ++ +   RI K  G  GL++GL   I+   
Sbjct: 223 GYLAGILCAIVSHPADVMVSKVNVDRKPNESMGAATSRIYKQIGFNGLWNGLPLRIVMIG 282

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 283 TLTSFQWLIYDSFK 296

>Suva_8.274 Chr8 (497296..498219) [924 bp, 307 aa] {ON} YOR222W
           (REAL)
          Length = 307

 Score = 77.8 bits (190), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 121/290 (41%), Gaps = 34/290 (11%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTL------------FSMIQRILKND 62
           Y +  G V GI    + +PLD+ K R Q        +               +++I+K +
Sbjct: 14  YQFISGAVAGISELAVMYPLDVVKTRFQLEVTTPAAIAAGKQVEKYNGVIDCLKKIVKKE 73

Query: 63  GPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGF- 121
           G   LY G+++ +L +      +F C D  ++        ++T      S+ +GA  G  
Sbjct: 74  GFSRLYRGISSPMLMEAPKRATKFACNDQYQKMF--QSLFHTTETTQKISIAAGASAGMT 131

Query: 122 ---VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGV 178
              V  P +++ IRMQ+       +R +Y   +D + +  K EG+  L  G+   + R  
Sbjct: 132 EAAVIVPFELIKIRMQD-------IRSSYLGPMDCLKKTIKNEGITGLYKGVESTMWRNA 184

Query: 179 LMTASQV-VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNA 237
           L       V + V   N +        + +    A  + G V T + +P DV+K+RI + 
Sbjct: 185 LWNGGYFGVIFQV--RNSMPEAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242

Query: 238 H------QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
                  + +  +L  L    R EG   +++G++P   RL P   L+ +V
Sbjct: 243 AAVDSVVKKYNWSLPSLLIIYREEGFRALYKGFVPKVCRLAPGGSLMLVV 292

>TDEL0H02960 Chr8 (492274..493338) [1065 bp, 354 aa] {ON} Anc_7.133
           YIL006W
          Length = 354

 Score = 78.2 bits (191), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 127/293 (43%), Gaps = 36/293 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAA-------RPKPTLFSMIQRILKNDGPLGLYSGLT 72
           G + G ++ I+  PLD+AK RLQ          R    +      I++++G  GLY GL 
Sbjct: 68  GALSGFISGIVVCPLDVAKTRLQAQGLQSVGENRYYNGMLGTFSTIIRDEGVRGLYKGLV 127

Query: 73  ASILRQCTYTTARFGCYDFIKE---NLLP-ADKLNSTLYLLPCSMISGAIGGFVGNPADV 128
             I+         F  Y+F K+    +LP  D L+ +L     ++ +GA+   V NP  V
Sbjct: 128 PIIMGYFPTWMIYFSFYEFCKDFYPRMLPHQDFLSYSL----SAITAGAVSTTVTNPIWV 183

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY 188
           +  R+   + H      +YK   D   +I  +EG + L  GL P+   G+L  A     Y
Sbjct: 184 IKTRLMLQT-HVSQYPTHYKGTFDAFNKIRTQEGFKALYAGLVPSYF-GLLHVAIHFPVY 241

Query: 189 DVCKHNLVTTFGFDASEKKTH-------FTASLVAGLVATTICSPADVIKTRIM------ 235
           +  K     TF     +   H         AS V+ ++A+ I  P ++++TR+       
Sbjct: 242 EKLK----VTFNCYRGKNNNHELDLSRLIMASCVSKMIASVITYPHEILRTRMQLKSNLP 297

Query: 236 NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
           ++ QH    + ++  +   EG+   + G+  +  R  P + +  +  E +R +
Sbjct: 298 DSVQH--KMIPLIRKTYFTEGIRGFYSGFTTNLVRTVPASAITLVSFEYVRNH 348

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 86/193 (44%), Gaps = 11/193 (5%)

Query: 101 KLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKE 160
           +LN T        +SG I G V  P DV   R+Q          R Y   +   + I ++
Sbjct: 57  RLNDTEITALSGALSGFISGIVVCPLDVAKTRLQAQGLQSVGENRYYNGMLGTFSTIIRD 116

Query: 161 EGVRKLLTGLGPNLVRGVLMTASQVVS-YDVCKHNLVTTFGFDASEKKTHFTASLVAGLV 219
           EGVR L  GL P ++ G   T     S Y+ CK            +  ++  +++ AG V
Sbjct: 117 EGVRGLYKGLVP-IIMGYFPTWMIYFSFYEFCKDFYPRM--LPHQDFLSYSLSAITAGAV 173

Query: 220 ATTICSPADVIKTRIM-NAH-----QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGP 273
           +TT+ +P  VIKTR+M   H      H++ T    +     EG   ++ G +PS+  L  
Sbjct: 174 STTVTNPIWVIKTRLMLQTHVSQYPTHYKGTFDAFNKIRTQEGFKALYAGLVPSYFGLL- 232

Query: 274 NTILIFLVVEQLR 286
           +  + F V E+L+
Sbjct: 233 HVAIHFPVYEKLK 245

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 81/189 (42%), Gaps = 25/189 (13%)

Query: 23  GGIVACIITHPLDLAKVRL--QTAARPKPT----LFSMIQRILKNDGPLGLYSGLTASIL 76
            G V+  +T+P+ + K RL  QT     PT     F    +I   +G   LY+GL  S  
Sbjct: 170 AGAVSTTVTNPIWVIKTRLMLQTHVSQYPTHYKGTFDAFNKIRTQEGFKALYAGLVPSYF 229

Query: 77  RQCTYTTARFGCYDFIKE--NLLPADKLNSTL---YLLPCSMISGAIGGFVGNPADVVNI 131
               +    F  Y+ +K   N       N  L    L+  S +S  I   +  P +++  
Sbjct: 230 -GLLHVAIHFPVYEKLKVTFNCYRGKNNNHELDLSRLIMASCVSKMIASVITYPHEILRT 288

Query: 132 RMQNDSAHEPHLRRNYKNAIDG-----VTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
           RMQ        L+ N  +++       + + +  EG+R   +G   NLVR V  +A  +V
Sbjct: 289 RMQ--------LKSNLPDSVQHKMIPLIRKTYFTEGIRGFYSGFTTNLVRTVPASAITLV 340

Query: 187 SYDVCKHNL 195
           S++  +++L
Sbjct: 341 SFEYVRNHL 349

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 44/91 (48%), Gaps = 9/91 (9%)

Query: 215 VAGLVATTICSPADVIKTRI-------MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
           ++G ++  +  P DV KTR+       +  ++++   L   S+ IR+EG+  +++G +P 
Sbjct: 70  LSGFISGIVVCPLDVAKTRLQAQGLQSVGENRYYNGMLGTFSTIIRDEGVRGLYKGLVPI 129

Query: 268 FARLGPNTILIFLVVEQLRKYEIGM--HQHF 296
                P  ++ F   E  + +   M  HQ F
Sbjct: 130 IMGYFPTWMIYFSFYEFCKDFYPRMLPHQDF 160

>Ecym_8386 Chr8 complement(786255..788990) [2736 bp, 911 aa] {ON}
           similar to Ashbya gossypii ADL049W
          Length = 911

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/265 (26%), Positives = 120/265 (45%), Gaps = 25/265 (9%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQT--AARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           Y +  G + G +   + +P+D+ K R+Q   A       F  + +IL  +G  GLYSGL 
Sbjct: 525 YNFTLGSIAGCIGATVVYPIDMVKTRMQAQRAFSEYKNSFDCLMKILSREGLRGLYSGLG 584

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPAD-KLNSTLYLLPCSMISGAIGG----FVGNPAD 127
             ++        +    D+++  L   D KLN     L   +ISGA  G       NP +
Sbjct: 585 PQLIGVAPEKAIKLTVNDYMRSILAGRDRKLN-----LSSEIISGATAGACQVVFTNPLE 639

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           ++ IR+Q  S +   + R+  NAI     + ++ G   L  G+   L+R +  +A    +
Sbjct: 640 IIKIRLQVKSEYVGDIARSNINAIS----VARQLGFLGLYKGVFACLLRDIPFSAIYFPT 695

Query: 188 YDVCKHNLVTTFGFDASEKKTHFTASL-----VAGLVATTICSPADVIKTRIMNAHQHHE 242
           Y   K NL      D++++    T  L     +AG+ A  + +P DVIKTR+    +  E
Sbjct: 696 YARIKANLFEFDPTDSTKRSKLKTWHLLLSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGE 755

Query: 243 STLKVLSSSIR----NEGLGFMFRG 263
           S+   +  ++R     EG+   F+G
Sbjct: 756 SSYHGIFHAVRTILKEEGIKSFFKG 780

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 88/206 (42%), Gaps = 26/206 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTA-------ARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           G   G    + T+PL++ K+RLQ         AR      S+ +++    G LGLY G+ 
Sbjct: 624 GATAGACQVVFTNPLEIIKIRLQVKSEYVGDIARSNINAISVARQL----GFLGLYKGVF 679

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNS-------TLYLLPCSMISGAIGGFVGNP 125
           A +LR   ++   F  Y  IK NL   D  +S       T +LL    ++G    F+  P
Sbjct: 680 ACLLRDIPFSAIYFPTYARIKANLFEFDPTDSTKRSKLKTWHLLLSGGLAGMPAAFLTTP 739

Query: 126 ADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQV 185
            DV+  R+Q D         +Y      V  I KEEG++    G    ++R        +
Sbjct: 740 FDVIKTRLQIDPKKG---ESSYHGIFHAVRTILKEEGIKSFFKGGPARVLRSSPQFGFTL 796

Query: 186 VSYDVCKHNL----VTTFGFDASEKK 207
            +Y++  HNL    +   G+D  + +
Sbjct: 797 AAYEIF-HNLFPMPIKDEGYDRRDNR 821

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 64/145 (44%), Gaps = 24/145 (16%)

Query: 103 NSTLYLLPC---------SMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDG 153
           N+ LY  P            I+G IG  V  P D+V  RMQ   A        YKN+ D 
Sbjct: 512 NANLYFFPIFDSIYNFTLGSIAGCIGATVVYPIDMVKTRMQAQRAFSE-----YKNSFDC 566

Query: 154 VTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTAS 213
           + +I   EG+R L +GLGP L+      A ++   D  +  L         ++K + ++ 
Sbjct: 567 LMKILSREGLRGLYSGLGPQLIGVAPEKAIKLTVNDYMRSILA------GRDRKLNLSSE 620

Query: 214 LVAGLVA----TTICSPADVIKTRI 234
           +++G  A        +P ++IK R+
Sbjct: 621 IISGATAGACQVVFTNPLEIIKIRL 645

>TBLA0B08970 Chr2 complement(2124130..2125131) [1002 bp, 333 aa]
           {ON} Anc_2.451 YKL120W
          Length = 333

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 124/290 (42%), Gaps = 36/290 (12%)

Query: 23  GGIVACI---ITHPLDLAKVRLQTAARPKPTLFSMIQRILKND------GPLGLYS---- 69
           GG+ ACI   +T+P+++ K ++Q A++   +   ++Q  + N        P+ + S    
Sbjct: 20  GGLAACIAVTLTNPIEVVKTKMQLASKHTHSGAKVLQSAVNNSVQVISRNPIKVMSDTWK 79

Query: 70  ---------GLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG 120
                    GL A+ L Q +    R G Y  + + + PA         +    I G+ G 
Sbjct: 80  AGGMRAVQRGLIAAYLYQLSMNGIRLGLYGPVAQEV-PA---------MVAGAIVGSAGA 129

Query: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180
           F G P  +   R+Q  + H      +   A   +  ++   G+  L  G+   +VR    
Sbjct: 130 FFGAPLQLAKTRLQAQALHSGTKSTHKGGAWVVLKNVYAARGITGLWRGVNVGMVRCTAG 189

Query: 181 TASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAH-- 238
           +  Q  +Y   K      +G+  S    HF +S +AGL      +P DV+ T  M AH  
Sbjct: 190 SCVQQPAYFAVKGWFSNKYGWKDS-IPLHFLSSAIAGLAVGFAINPWDVVLTH-MVAHPG 247

Query: 239 QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
                 +  +++ I +EG   +F+G      R+ P+T+L  + +EQ ++Y
Sbjct: 248 SSKGGMIACMANIITHEGPMALFKGIEAQLLRIAPHTVLCLVFLEQTKRY 297

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 62/168 (36%), Gaps = 20/168 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ-------TAARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           G + G        PL LAK RLQ       T +  K   + +++ +    G  GL+ G+ 
Sbjct: 121 GAIVGSAGAFFGAPLQLAKTRLQAQALHSGTKSTHKGGAWVVLKNVYAARGITGLWRGVN 180

Query: 73  ASILR----QCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADV 128
             ++R     C    A F    +        D +   L+ L  S I+G   GF  NP DV
Sbjct: 181 VGMVRCTAGSCVQQPAYFAVKGWFSNKYGWKDSI--PLHFL-SSAIAGLAVGFAINPWDV 237

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
           V   M        H   +    I  +  I   EG   L  G+   L+R
Sbjct: 238 VLTHM------VAHPGSSKGGMIACMANIITHEGPMALFKGIEAQLLR 279

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%)

Query: 210 FTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNE 255
           F A  +A  +A T+ +P +V+KT++  A +H  S  KVL S++ N 
Sbjct: 17  FMAGGLAACIAVTLTNPIEVVKTKMQLASKHTHSGAKVLQSAVNNS 62

>Smik_16.300 Chr16 (550436..551359) [924 bp, 307 aa] {ON} YPR058W
           (REAL)
          Length = 307

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 122/290 (42%), Gaps = 21/290 (7%)

Query: 7   ESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLG 66
           +  NA V      G  GGI   ++  P D  KVRLQT++ P  T   +++++L N+GP G
Sbjct: 19  QHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT-TAMEVVKKLLANEGPRG 77

Query: 67  LYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLP----CSMISGAIGGFV 122
            Y G    ++      + +FG  + +K      +   S+   LP    C +  G +  F+
Sbjct: 78  FYKGTLIPLIGVGACVSLQFGVNEAMKRFFHQRNTNESSTLSLPQYYACGVTGGIVNSFL 137

Query: 123 GNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTA 182
            +P + + IR+Q  +         +K  +D + ++   +G   LL GL P ++R      
Sbjct: 138 ASPIEHIRIRLQTQTGSGADAE--FKGPLDCIKKLRNNKG---LLRGLTPTILREGHGCG 192

Query: 183 SQVVSYDVCKHNLVTT-FGFDASE----KKTHFTASLVAGLVATTICSPADVIKTRIMNA 237
           +  + Y+    N + +  G +  +    K   F A  ++G     +  P DVIK+ +   
Sbjct: 193 TYFLVYEALIANQINSKHGLERKDIPAWKLCIFGA--LSGTALWLMVYPLDVIKSVMQTD 250

Query: 238 HQHHESTLKVLSSSIRN----EGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           +         + S  +N     G+   F+G+ P+  R  P     F   E
Sbjct: 251 NLQKPKFGNSIPSVAKNLYSRGGIAAFFKGFGPTMLRAAPANGATFATFE 300

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 95/209 (45%), Gaps = 38/209 (18%)

Query: 5   KSESSNAVVKYPWWY--GGVGGIVACIITHPLDLAKVRLQTA------ARPKPTLFSMIQ 56
           ++ + ++ +  P +Y  G  GGIV   +  P++  ++RLQT       A  K  L   I+
Sbjct: 110 RNTNESSTLSLPQYYACGVTGGIVNSFLASPIEHIRIRLQTQTGSGADAEFKGPL-DCIK 168

Query: 57  RILKNDGPLGLYSGLTASILRQ---CTYTTARFGCYDFIKENLLPADKLNSTLYL----L 109
           ++  N    GL  GLT +ILR+   C       G Y  + E L+ A+++NS   L    +
Sbjct: 169 KLRNNK---GLLRGLTPTILREGHGC-------GTYFLVYEALI-ANQINSKHGLERKDI 217

Query: 110 PC--SMISGAIGG----FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTR-IFKEEG 162
           P     I GA+ G     +  P DV+   MQ D+  +P     + N+I  V + ++   G
Sbjct: 218 PAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKP----KFGNSIPSVAKNLYSRGG 273

Query: 163 VRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
           +     G GP ++R      +   ++++ 
Sbjct: 274 IAAFFKGFGPTMLRAAPANGATFATFELA 302

>TPHA0M01550 Chr13 (328262..329182) [921 bp, 306 aa] {ON} Anc_3.348
           YPR058W
          Length = 306

 Score = 77.0 bits (188), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 116/275 (42%), Gaps = 18/275 (6%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GGI   ++  P D  KVRLQT+  P   +  +++ +LKN+GP G Y G    ++   
Sbjct: 32  GTAGGISQVLVGQPFDTTKVRLQTSTTPTSAI-DVVKNLLKNEGPSGFYKGTLTPLIGVG 90

Query: 80  TYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPADVVNIRMQN 135
              + +FG  + +K      + LNS    L    +SG  GG    F+ +P + V IR+Q 
Sbjct: 91  ACVSIQFGVNEAMKRYFHSVNNLNSETLSLSQYYLSGLAGGVANSFLASPIEHVRIRLQT 150

Query: 136 DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNL 195
            ++   +   ++K  +D + ++  + G   L+ GL   ++R      +  + Y+    N 
Sbjct: 151 QTSSGAN--ADFKGPLDCIRKLRAQGG---LMRGLSATMLRESHGCGTYFLVYEALVANE 205

Query: 196 VTTFGFDASEKKTHFTASLVAGLVATTI---CSPADVIKTRIMNAH----QHHESTLKVL 248
           V       ++    +   L      TT+     P DVIK+ I   +    ++  S   V 
Sbjct: 206 VNKLKVKRADIPA-WKLCLFGAFSGTTLWMMVYPLDVIKSVIQTDNIKNPKNGNSIRDVA 264

Query: 249 SSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
                  GL   F+G+ P+  R  P     F   E
Sbjct: 265 KRIYGRGGLSAFFKGFGPTMLRAAPANGATFATFE 299

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 74/183 (40%), Gaps = 15/183 (8%)

Query: 17  WWYGGVGGIVACIITHPLDLAKVRLQT--AARPKPTLFSMIQRILKNDGPLGLYSGLTAS 74
           +  G  GG+    +  P++  ++RLQT  ++         +  I K     GL  GL+A+
Sbjct: 124 YLSGLAGGVANSFLASPIEHVRIRLQTQTSSGANADFKGPLDCIRKLRAQGGLMRGLSAT 183

Query: 75  ILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGN-------PAD 127
           +LR+       F  Y+ +  N    +KL      +P   +    G F G        P D
Sbjct: 184 MLRESHGCGTYFLVYEALVAN--EVNKLKVKRADIPAWKLC-LFGAFSGTTLWMMVYPLD 240

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           V+   +Q D+   P   +N  +  D   RI+   G+     G GP ++R      +   +
Sbjct: 241 VIKSVIQTDNIKNP---KNGNSIRDVAKRIYGRGGLSAFFKGFGPTMLRAAPANGATFAT 297

Query: 188 YDV 190
           +++
Sbjct: 298 FEL 300

>Kwal_23.3529 s23 (331232..332419) [1188 bp, 395 aa] {ON} YMR166C -
           Hypothetical ORF [contig 252] FULL
          Length = 395

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 112/261 (42%), Gaps = 23/261 (8%)

Query: 30  ITHPLDLAKVRLQTAAR-PK-PTLFSMIQRILKNDG-PLGLYSGLTASILRQCTYTTARF 86
           + H LD  K R Q A   PK   + S  Q+I   +G   GLY G TA++L         F
Sbjct: 102 VMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFF 161

Query: 87  GCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAH-EPHLRR 145
           G Y+  K  L+    +N TL  L   +    +   V  P++V+  R+Q    +  PH   
Sbjct: 162 GTYELTKRKLIDDWGVNETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHS 221

Query: 146 --NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDA 203
             NY+N  D +T I + EG + L  G    L R +  +A Q   Y+  +    T  G   
Sbjct: 222 GYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLEGKTP 281

Query: 204 SEKKT---HFTASLVAGLVATTICSPADVIKTRIMNAH------------QHHESTLKVL 248
           S+  +          AG +A  I +P DVIKTRI                +   S +K L
Sbjct: 282 SQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGL 341

Query: 249 SSSIRNEG-LGFMFRGWLPSF 268
           ++  R+EG LGF F G  P F
Sbjct: 342 TAVYRSEGTLGF-FSGVGPRF 361

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 84/197 (42%), Gaps = 22/197 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQT----------AARPKPTLFSMIQRILKNDGPLGLYS 69
           G  G +V+ ++  P ++ K RLQ           +      L   I  I++ +G   L+ 
Sbjct: 187 GLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFF 246

Query: 70  GLTASILRQCTYTTARFGCYD------FIKENLLPADKLNSTLYLLPCSMISGAIGGFVG 123
           G  A++ R   ++  +F  Y+      F  E   P+  L S L  L     +G + G + 
Sbjct: 247 GYKATLCRDLPFSAFQFAFYEKFRQWAFTLEGKTPSQDL-SLLNELLTGAAAGGLAGIIT 305

Query: 124 NPADVVNIRMQND-----SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGV 178
            P DV+  R+Q       ++    L R   + I G+T +++ EG     +G+GP  +   
Sbjct: 306 TPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTS 365

Query: 179 LMTASQVVSYDVCKHNL 195
           + ++  ++ Y V   +L
Sbjct: 366 IQSSIMLLLYQVTLKSL 382

>Kwal_33.12988 s33 complement(28012..28923) [912 bp, 303 aa] {ON}
           YPR058W (YMC1) - putative mitochondrial carrier protein
           [contig 123] FULL
          Length = 303

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 120/282 (42%), Gaps = 33/282 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GGI   ++  P D+ KVRLQT++ P  T   ++Q ++KN+G  G Y G T  ++   
Sbjct: 30  GTTGGIAQVLVGQPFDITKVRLQTSSTPT-TALRVVQDLVKNEGLRGFYKGTTLPLIGVG 88

Query: 80  TYTTARFGCYDFIKENLLPADKLNSTLYLLP----CSMISGAIGGFVGNPADVVNIRMQN 135
              +++FG  + +K      +   ST   LP    C  +SG    F+  P + V I +Q 
Sbjct: 89  LCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIEHVRILLQV 148

Query: 136 DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR-----GVLMTASQVVSYDV 190
            +         Y+ A+D + ++ KE    KL+ G  P ++R     GV  T+ + +   +
Sbjct: 149 QTKSRADA--EYQGAMDCIKKLLKEG---KLMRGFTPTILRTSHGFGVYFTSYEAM---I 200

Query: 191 CKHNLVTTFGFDASEKKT----HFTASLVAGLVATTICSPADVIKTRIMNAHQ-----HH 241
           C          D    K      F+ SL+  +V      P DVIK+ +M + +     + 
Sbjct: 201 CSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMV-----YPFDVIKS-VMQSDKLRTPVYG 254

Query: 242 ESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
            +  +V  +     G     +G+ P+  R  P     F   E
Sbjct: 255 TNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFE 296

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 78/198 (39%), Gaps = 36/198 (18%)

Query: 13  VKYPWWY--GGVGGIVACIITHPLDLAKVRLQTAARPKPTL-----FSMIQRILKNDGPL 65
           ++ P +Y  G V G     +  P++  ++ LQ   + +           I+++LK     
Sbjct: 116 LRLPEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKEGK-- 173

Query: 66  GLYSGLTASILRQCTYTTARFGCY-------------DFIKENLLPADKLNSTLYLLPCS 112
            L  G T +ILR    T+  FG Y               I    +PA KL   LY     
Sbjct: 174 -LMRGFTPTILR----TSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKL--CLY----G 222

Query: 113 MISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGP 172
             SG++   +  P DV+   MQ+D    P       N       I+ E G +  + G GP
Sbjct: 223 AFSGSLLWAMVYPFDVIKSVMQSDKLRTPVYG---TNVFQVAKNIYNERGPKAFVKGFGP 279

Query: 173 NLVRGVLMTASQVVSYDV 190
            ++R + +  +   ++++
Sbjct: 280 TMLRSLPVNGATFTAFEM 297

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 34/186 (18%), Positives = 69/186 (37%), Gaps = 18/186 (9%)

Query: 92  IKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAI 151
           + ++L     +  TL  +      G     VG P D+  +R+Q  S     LR       
Sbjct: 10  VVDDLTDKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTALRV------ 63

Query: 152 DGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKK--TH 209
             V  + K EG+R    G    L+   L  +SQ  + +  K        F ++  +   +
Sbjct: 64  --VQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEY 121

Query: 210 FTASLVAGLVATTICSPADVIKTRIM-----NAHQHHESTLKVLSSSIRNEGLGFMFRGW 264
           +    V+G     + +P + ++  +       A   ++  +  +   ++    G + RG+
Sbjct: 122 YACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKE---GKLMRGF 178

Query: 265 LPSFAR 270
            P+  R
Sbjct: 179 TPTILR 184

>KLLA0F03212g Chr6 (302915..303832) [918 bp, 305 aa] {ON} similar to
           uniprot|P33303 Saccharomyces cerevisiae YJR095W SFC1
           Mitochondrial succinate-fumarate transporter transports
           succinate into and fumarate out of the mitochondrion
           required for ethanol and acetate utilization
          Length = 305

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 85/304 (27%), Positives = 125/304 (41%), Gaps = 29/304 (9%)

Query: 4   TKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQT------AARPKPTLFSMIQR 57
           +K +SSN  V      GG  G++  +  HPLD  KVR+Q       +    P        
Sbjct: 3   SKQKSSNPAVN--LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60

Query: 58  ILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGA 117
           I +N+G L  Y GL A ++        RF  Y+F +   L ADK    +     + I+G 
Sbjct: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYR--TLLADKETGKVST-GNTFIAGV 117

Query: 118 IGGFV-----GNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGP 172
             G        NP +VV IR+Q    +       YKNA+     I KEEG   L  G+  
Sbjct: 118 GAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSL 177

Query: 173 NLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTIC----SPAD 228
              R      +    Y   K  L    G+   E    +  SL+ GL++  I     +P D
Sbjct: 178 TAARQATNQGANFTVYSKLKEFLQ---GYHNQEMLPSWETSLI-GLISGAIGPFSNAPLD 233

Query: 229 VIKTRIM-NAHQHHESTLKVLS----SSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
            IKTR+  +    + S LK ++      I+ EG   +++G  P   R+ P   + F   E
Sbjct: 234 TIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293

Query: 284 QLRK 287
            +RK
Sbjct: 294 FIRK 297

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 39/92 (42%), Gaps = 13/92 (14%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRI-------LKNDGP 64
           P W     G + G +      PLD  K RLQ     K    S ++RI       ++ +G 
Sbjct: 210 PSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKN--MSGLKRITIIGKQLIQEEGF 267

Query: 65  LGLYSGLTASILRQCTYTTARFGCYDFIKENL 96
             LY G+T  ++R        F  Y+FI++ L
Sbjct: 268 RALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299

 Score = 35.8 bits (81), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 83/199 (41%), Gaps = 30/199 (15%)

Query: 115 SGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAI-DGVT---------RIFKEEGVR 164
           +G + G   +P D + +RMQ            YKNA+  GV           I++ EG  
Sbjct: 20  AGLMEGLCCHPLDTIKVRMQI-----------YKNAVGSGVKAPGFIKTGGEIYRNEGFL 68

Query: 165 KLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLV-ATTI 223
               GLG  ++      A +  SY+  +  L        S   T F A + AG+  A  +
Sbjct: 69  AFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNT-FIAGVGAGITEAVVV 127

Query: 224 CSPADVIKTRIMNAHQH-------HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTI 276
            +P +V+K R+   H +       +++ ++   + ++ EG   ++RG   + AR   N  
Sbjct: 128 VNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQG 187

Query: 277 LIFLVVEQLRKYEIGMHQH 295
             F V  +L+++  G H  
Sbjct: 188 ANFTVYSKLKEFLQGYHNQ 206

>Kpol_1039.8 s1039 (20067..21017) [951 bp, 316 aa] {ON}
           (20067..21017) [951 nt, 317 aa]
          Length = 316

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 131/302 (43%), Gaps = 43/302 (14%)

Query: 24  GIVACIITHPLDLAKVRLQTAARPKPT--LFSMIQRILKNDGPLG-----LYSGLTASIL 76
           G +  I+ HPLDL KVRLQ  A  K       +++++  N   L      +Y GL  ++ 
Sbjct: 19  GAITTIVVHPLDLIKVRLQLLATYKTDGGYIKVLKKLFSNSNGLNPMIKEVYRGLGINVF 78

Query: 77  RQCTYTTARFGCYDFIKE-------------------------NLLPADKLNSTLYLLPC 111
                    FG Y F K+                         +++   K++S +Y L  
Sbjct: 79  GNSVAWALYFGFYRFSKDIIYHHYYYKGGSSVTDSIDKETTHTDIIHDQKMSSFMY-LTA 137

Query: 112 SMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
            +ISGAI   + NP  VV  R+ + S  E     +Y +   G  R+  EEG   L  GL 
Sbjct: 138 GVISGAITTLLTNPIWVVKTRIMSTSKSEIG---SYTSTYHGFKRLLAEEGYLGLWRGLV 194

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGL---VATTICSPAD 228
           P+   GV   A   + YD  K    ++   D ++K  +    L+  L   ++ T   P  
Sbjct: 195 PSFF-GVSQGAIYFMVYDTLKFKF-SSIRTDNTDKLRNSEIILITSLSKMISVTSVYPFQ 252

Query: 229 VIKTRIMNAHQHHES-TLKVLSSSI-RNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
           ++K+ + + +   ++ TLK L+  I + +GL  +++G + +  R  P+T + F + E  R
Sbjct: 253 LLKSNLQSFNAIDQNYTLKNLTKLIYKADGLRGLYKGLMANLIRAIPSTCITFCIYENFR 312

Query: 287 KY 288
            +
Sbjct: 313 GW 314

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 91/204 (44%), Gaps = 39/204 (19%)

Query: 115 SGAIGGFVGNPADVVNIRMQ------NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLT 168
           +GAI   V +P D++ +R+Q       D  +   L++ + N+ +G+  + KE     +  
Sbjct: 18  TGAITTIVVHPLDLIKVRLQLLATYKTDGGYIKVLKKLFSNS-NGLNPMIKE-----VYR 71

Query: 169 GLGPNL----VRGVLMTASQVVSYDVCKHNLVTTFG---FDASEKKT------------- 208
           GLG N+    V   L       S D+  H+     G    D+ +K+T             
Sbjct: 72  GLGINVFGNSVAWALYFGFYRFSKDIIYHHYYYKGGSSVTDSIDKETTHTDIIHDQKMSS 131

Query: 209 --HFTASLVAGLVATTICSPADVIKTRIMNAHQ----HHESTLKVLSSSIRNEGLGFMFR 262
             + TA +++G + T + +P  V+KTRIM+  +     + ST       +  EG   ++R
Sbjct: 132 FMYLTAGVISGAITTLLTNPIWVVKTRIMSTSKSEIGSYTSTYHGFKRLLAEEGYLGLWR 191

Query: 263 GWLPSFARLGPNTILIFLVVEQLR 286
           G +PSF  +    I  F+V + L+
Sbjct: 192 GLVPSFFGVSQGAIY-FMVYDTLK 214

>TDEL0G02740 Chr7 (523615..524700) [1086 bp, 361 aa] {ON} Anc_2.344
           YMR166C
          Length = 361

 Score = 77.4 bits (189), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 94/226 (41%), Gaps = 10/226 (4%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTA--ARPKPTLFSMIQRILKNDG-PLGLYSGLTASIL 76
           GG+GG +     H LD  K R Q A  A     + +  + I   +G   GLY G  A++L
Sbjct: 59  GGLGGAIGDTAMHSLDTVKTRQQGAPSAGKYKNMLTAYRTIFAQEGVRRGLYGGYGAAML 118

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ-N 135
                    F  Y++ K  ++   ++N T   L    +   +   V  P++V+  R+Q  
Sbjct: 119 GSFPSAAIFFSTYEYSKRKMIDDWQVNETATHLTAGFLGDLVSSIVYVPSEVLKTRLQLQ 178

Query: 136 DSAHEPHLRR--NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKH 193
              + P      NYKN  D ++ I K EGV  LL G    L R +  +A Q   Y+  + 
Sbjct: 179 GRYNNPFFDSGYNYKNLRDTISTIVKTEGVGALLFGYKATLARDLPFSALQFAFYEKFRQ 238

Query: 194 NLVTTFGFDASEKKTHFTASLV----AGLVATTICSPADVIKTRIM 235
                 G D           +     AG +A  I +P DVIKTR+ 
Sbjct: 239 WAFAIEGKDIGADDLSVAGEIYTGASAGGLAGIITTPLDVIKTRVQ 284

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 80/202 (39%), Gaps = 23/202 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFS----------MIQRILKNDGPLGLYS 69
           G +G +V+ I+  P ++ K RLQ   R     F            I  I+K +G   L  
Sbjct: 154 GFLGDLVSSIVYVPSEVLKTRLQLQGRYNNPFFDSGYNYKNLRDTISTIVKTEGVGALLF 213

Query: 70  GLTASILRQCTYTTARFGCYDFIKE-------NLLPADKLNSTLYLLPCSMISGAIGGFV 122
           G  A++ R   ++  +F  Y+  ++         + AD L S    +     +G + G +
Sbjct: 214 GYKATLARDLPFSALQFAFYEKFRQWAFAIEGKDIGADDL-SVAGEIYTGASAGGLAGII 272

Query: 123 GNPADVVNIRMQNDSAHEPHLRRNYKNAIDG-----VTRIFKEEGVRKLLTGLGPNLVRG 177
             P DV+  R+Q        +       + G     +  ++  EG     +G+GP  V  
Sbjct: 273 TTPLDVIKTRVQTQQPSSADVSSAKPLKLSGSLFGSLRTVYTSEGFFGFFSGVGPRFVWT 332

Query: 178 VLMTASQVVSYDVCKHNLVTTF 199
            + ++  ++ Y +   +L  +F
Sbjct: 333 SIQSSIMLLLYQMTLRSLNNSF 354

>SAKL0E06248g Chr5 complement(508609..509682) [1074 bp, 357 aa] {ON}
           similar to uniprot|Q03829 Saccharomyces cerevisiae
           YMR166C Hypothetical ORF
          Length = 357

 Score = 77.4 bits (189), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 94/213 (44%), Gaps = 11/213 (5%)

Query: 32  HPLDLAKVRLQTAAR--PKPTLFSMIQRILKNDG-PLGLYSGLTASILRQCTYTTARFGC 88
           H LD  K R Q A R      + +  + I   +G   GLY G TA++L         FG 
Sbjct: 61  HSLDTVKTRQQGAPRILKYKNMITAYRTIFLEEGLRRGLYGGYTAAMLGSFPSAAIFFGT 120

Query: 89  YDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ-NDSAHEPHLRR-- 145
           Y+F+K  ++    LN T+  L    +   +   V  P++V+  R+Q     + P  +   
Sbjct: 121 YEFVKRKMIDDWTLNETMSHLTAGFLGDLVSSVVYVPSEVLKTRLQLQGRYNNPFFQSGY 180

Query: 146 NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVT----TFGF 201
           NYK+  D V+ I ++EG + L  G    L R +  +A Q   Y+  +         T G 
Sbjct: 181 NYKHLRDSVSTIVRKEGWQTLFFGYKATLARDLPFSALQFAFYEKFRQWAFVVEKKTMGQ 240

Query: 202 DASEKKTHFTASLVAGLVATTICSPADVIKTRI 234
           D S      T +   GL A  I +P DVIKTR+
Sbjct: 241 DLSIFSEVLTGASAGGL-AGVITTPLDVIKTRV 272

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 85/201 (42%), Gaps = 25/201 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLF----------SMIQRILKNDGPLGLYS 69
           G +G +V+ ++  P ++ K RLQ   R     F            +  I++ +G   L+ 
Sbjct: 144 GFLGDLVSSVVYVPSEVLKTRLQLQGRYNNPFFQSGYNYKHLRDSVSTIVRKEGWQTLFF 203

Query: 70  GLTASILRQCTYTTARFGCYDFIKENLLPADK--LNSTLYLLPCSMISGAIGGFVG---N 124
           G  A++ R   ++  +F  Y+  ++     +K  +   L +    +   + GG  G    
Sbjct: 204 GYKATLARDLPFSALQFAFYEKFRQWAFVVEKKTMGQDLSIFSEVLTGASAGGLAGVITT 263

Query: 125 PADVVNIRMQN--------DSAHEPHLRRNY-KNAI-DGVTRIFKEEGVRKLLTGLGPNL 174
           P DV+  R+Q         +SA+ P  +     N+I  G+  ++K EG     +G+GP  
Sbjct: 264 PLDVIKTRVQTQLPRDALPESANLPKGKPVVITNSIFKGLFAVYKSEGTLGFFSGVGPRF 323

Query: 175 VRGVLMTASQVVSYDVCKHNL 195
           +   + ++  ++ Y V    L
Sbjct: 324 IWTSVQSSIMLLLYQVTLKTL 344

>Skud_16.297 Chr16 complement(547342..548322) [981 bp, 326 aa] {ON}
           YPR011C (REAL)
          Length = 326

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 128/289 (44%), Gaps = 25/289 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT---LFSMIQRILKNDGPLGLYSGLTASIL 76
           GGV G V+  +  P +  K+ LQ  +        +FS I+++   +GP GL+ G   + +
Sbjct: 29  GGVAGAVSRTVVSPFERVKILLQVQSSTNSYNHGIFSSIRQVYCEEGPKGLFRGNGLNCI 88

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCS-MISGAIGG----FVGNPADVVNI 131
           R   Y+  +F  Y+  K+ +   D  +    L     + SGA+ G        P D++  
Sbjct: 89  RIFPYSAVQFVVYEGCKKKVFHVDAYDGQEQLTNSQRLFSGALCGGCSVVATYPLDLIRT 148

Query: 132 RMQNDSAHEPHLRRNYKNAIDGVTRIFK--------EEGVRKLLTGLGPNLVRGVLMTAS 183
           R+   +A+   L R+   +I     I+K        E G++ L  G+ P  +  V   A 
Sbjct: 149 RLSIQTANLSGLSRSKAKSISKPPGIWKLLSETYRLEGGIKGLYRGVWPTSLGVVPYVAL 208

Query: 184 QVVSYDVCKHNLVTTFGFDASEKKTHFTASL--VAGLVATTICSPADVIKTRI----MNA 237
               Y+  +   + + GF+ S K   +  ++  V+G VA T+  P D+++ R     M  
Sbjct: 209 NFAVYEQLREISINSSGFEPSWKSNLYKLAIGAVSGGVAQTMTYPFDLLRRRFQVLAMGG 268

Query: 238 HQ---HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           ++    + S    L +  + EG G  ++G   +  ++ P+T + +LV E
Sbjct: 269 NELGFKYSSVWDALVTIGKAEGFGGYYKGLSANLFKVVPSTAISWLVYE 317

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 92/199 (46%), Gaps = 30/199 (15%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAI-DGVTRIFKEEGVRKLLTGLGP 172
           ++GA+   V +P + V I +Q  S+       +Y + I   + +++ EEG + L  G G 
Sbjct: 31  VAGAVSRTVVSPFERVKILLQVQSSTN-----SYNHGIFSSIRQVYCEEGPKGLFRGNGL 85

Query: 173 NLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH----FTASLVAG--LVATTICSP 226
           N +R    +A Q V Y+ CK  +     +D  E+ T+    F+ +L  G  +VAT    P
Sbjct: 86  NCIRIFPYSAVQFVVYEGCKKKVFHVDAYDGQEQLTNSQRLFSGALCGGCSVVATY---P 142

Query: 227 ADVIKTRI--------------MNAHQHHESTLKVLSSSIRNE-GLGFMFRGWLPSFARL 271
            D+I+TR+                +        K+LS + R E G+  ++RG  P+   +
Sbjct: 143 LDLIRTRLSIQTANLSGLSRSKAKSISKPPGIWKLLSETYRLEGGIKGLYRGVWPTSLGV 202

Query: 272 GPNTILIFLVVEQLRKYEI 290
            P   L F V EQLR+  I
Sbjct: 203 VPYVALNFAVYEQLREISI 221

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 82/190 (43%), Gaps = 19/190 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRL--QTA-----ARPK-------PTLFSMIQRILKNDGPL 65
           G + G  + + T+PLDL + RL  QTA     +R K       P ++ ++    + +G +
Sbjct: 129 GALCGGCSVVATYPLDLIRTRLSIQTANLSGLSRSKAKSISKPPGIWKLLSETYRLEGGI 188

Query: 66  -GLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLN----STLYLLPCSMISGAIGG 120
            GLY G+  + L    Y    F  Y+ ++E  + +        S LY L    +SG +  
Sbjct: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQLREISINSSGFEPSWKSNLYKLAIGAVSGGVAQ 248

Query: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180
            +  P D++  R Q  +     L   Y +  D +  I K EG      GL  NL + V  
Sbjct: 249 TMTYPFDLLRRRFQVLAMGGNELGFKYSSVWDALVTIGKAEGFGGYYKGLSANLFKVVPS 308

Query: 181 TASQVVSYDV 190
           TA   + Y+V
Sbjct: 309 TAISWLVYEV 318

>KAFR0B02040 Chr2 complement(399235..401928) [2694 bp, 897 aa] {ON}
           Anc_8.129 YPR021C
          Length = 897

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 74/278 (26%), Positives = 123/278 (44%), Gaps = 28/278 (10%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRILKNDGPLGLYSGL 71
           Y +  G V G +     +P+D  K R+Q   +  + K ++  +I ++   +G  GL+SGL
Sbjct: 494 YNFALGSVAGCIGSTFVYPIDFIKTRMQAQRSLTKYKNSIDCLI-KVYSREGIKGLFSGL 552

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPAD 127
              +L        +    DF++  L   DK N+++ L P  + +GAI G     V NP +
Sbjct: 553 GFQLLGVAPEKAIKLTINDFLRNKL--TDKRNASIKL-PNEVFAGAIAGACQVLVTNPIE 609

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           +V I++Q  S +       Y  A +G+  I K+ G   L  G+   L+R V  +A    +
Sbjct: 610 IVKIKLQVRSEYLAEADSIYGKA-NGL-HIIKKLGFPGLYRGITACLMRDVPFSAIYFPT 667

Query: 188 YDVCKHNLVTTFGFDASEKKTH--------FTASLVAGLVATTICSPADVIKTRIMNAHQ 239
           Y   K ++   F FD ++             TA  +AG+ A  + +P DVIKTR+    +
Sbjct: 668 YAHLKKDI---FHFDPNKPGKRKRLKTWELLTAGALAGMPAAFLTTPLDVIKTRLQIEPK 724

Query: 240 HHES----TLKVLSSSIRNEGLGFMFRGWLPSFARLGP 273
           H E+          + +R E     F+G      R  P
Sbjct: 725 HGETRYTGIFHAFKTILREENFRSFFKGGGARVLRSSP 762

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 42/189 (22%), Positives = 80/189 (42%), Gaps = 13/189 (6%)

Query: 105 TLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
           ++Y      ++G IG     P D +  RMQ   +        YKN+ID + +++  EG++
Sbjct: 492 SMYNFALGSVAGCIGSTFVYPIDFIKTRMQAQRS-----LTKYKNSIDCLIKVYSREGIK 546

Query: 165 KLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEK-KTHFTASLVAGLVATTI 223
            L +GLG  L+      A ++   D  ++ L  T   +AS K      A  +AG     +
Sbjct: 547 GLFSGLGFQLLGVAPEKAIKLTINDFLRNKL--TDKRNASIKLPNEVFAGAIAGACQVLV 604

Query: 224 CSPADVIKTRIMNAHQHHESTLKVLSSS-----IRNEGLGFMFRGWLPSFARLGPNTILI 278
            +P +++K ++    ++      +   +     I+  G   ++RG      R  P + + 
Sbjct: 605 TNPIEIVKIKLQVRSEYLAEADSIYGKANGLHIIKKLGFPGLYRGITACLMRDVPFSAIY 664

Query: 279 FLVVEQLRK 287
           F     L+K
Sbjct: 665 FPTYAHLKK 673

>Kpol_1065.26 s1065 complement(58774..59688) [915 bp, 304 aa] {ON}
           complement(58774..59688) [915 nt, 305 aa]
          Length = 304

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 119/278 (42%), Gaps = 21/278 (7%)

Query: 18  WYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           + G +GGI   ++  P D  KVRLQT+ +   T   +I+ +LKN+G LG Y G    ++ 
Sbjct: 29  FAGTIGGIAQVLVGQPFDTTKVRLQTSMK-NTTQMEVIKDLLKNEGLLGFYKGTLIPLVG 87

Query: 78  QCTYTTARFGCYDFIKENLLPADKLNSTLYLLP----CSMISGAIGGFVGNPADVVNIRM 133
                + +FG  +++K      +   S    LP    C    G +  F+ +P + V IR+
Sbjct: 88  VGACVSVQFGVNEYMKRFFNSRNNNGSKTLTLPQYYICGFTGGVVNSFLASPIEHVRIRL 147

Query: 134 QNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKH 193
           Q  +A   +    +K  ID + ++  +    +L+ GL   ++R         + Y+    
Sbjct: 148 QTQTASSAN--AEFKGPIDCIKKLVSQG---QLMRGLPIMMLRAGHGVGIYFLVYESLIA 202

Query: 194 NLVTTFGFDASE----KKTHFTASLVAGLVATTICSPADVIKTRIMNAH----QHHESTL 245
           N V   G   +E    K   F A+  AG     +  P DVIK+ + + +    +   S  
Sbjct: 203 NQVNK-GTPRTEIPPWKLCLFGAA--AGTTLWMLVYPIDVIKSVVQSDNLKKPKFSTSLF 259

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           KV S   +  GL   F+G+  +  R  P     F   E
Sbjct: 260 KVGSDLYKRGGLPVFFKGFGVTMMRATPANAATFTAFE 297

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 212 ASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARL 271
           A  + G+    +  P D  K R+  + ++  + ++V+   ++NEGL   ++G L     +
Sbjct: 30  AGTIGGIAQVLVGQPFDTTKVRLQTSMKN-TTQMEVIKDLLKNEGLLGFYKGTLIPLVGV 88

Query: 272 GPNTILIFLVVEQLRKY 288
           G    + F V E ++++
Sbjct: 89  GACVSVQFGVNEYMKRF 105

>Skud_13.331 Chr13 complement(567690..568793) [1104 bp, 367 aa] {ON}
           YMR166C (REAL)
          Length = 367

 Score = 76.6 bits (187), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 95/213 (44%), Gaps = 10/213 (4%)

Query: 32  HPLDLAKVRLQTAARPKP--TLFSMIQRILKNDGPL-GLYSGLTASILRQCTYTTARFGC 88
           H LD  K R Q A   K    + S  + I   +G   GLY G  A++L         FG 
Sbjct: 72  HSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGARRGLYCGYMAAMLGSFPSAAIFFGT 131

Query: 89  YDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ-NDSAHEPHLRR-- 145
           Y++ K  ++   ++N T+  L    +   I  F+  P++V+  R+Q     + P  +   
Sbjct: 132 YEYTKRTMIEDWQINDTVTHLSAGFLGDFISSFIYVPSEVLKTRLQLQGRFNNPFFQSGY 191

Query: 146 NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASE 205
           NY N  + +  + KEEG + L  G    L R +  +A Q   Y+  +    T    D  +
Sbjct: 192 NYSNLRNAIKTVIKEEGFQSLFFGYKATLARDLPFSALQFAFYEKLRKLAFTIEKKDGKD 251

Query: 206 KKTHFTASLV----AGLVATTICSPADVIKTRI 234
           ++   +  ++    AG +A  I +P DV+KTR+
Sbjct: 252 EELSISNEILTGACAGGLAGIITTPMDVVKTRV 284

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 85/211 (40%), Gaps = 31/211 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLF----------SMIQRILKNDGPLGLYS 69
           G +G  ++  I  P ++ K RLQ   R     F          + I+ ++K +G   L+ 
Sbjct: 155 GFLGDFISSFIYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFQSLFF 214

Query: 70  GLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCS------MISGAIGGFVG 123
           G  A++ R   ++  +F  Y+ +++     +K +     L  S        +G + G + 
Sbjct: 215 GYKATLARDLPFSALQFAFYEKLRKLAFTIEKKDGKDEELSISNEILTGACAGGLAGIIT 274

Query: 124 NPADVVNIRMQND----------SAHEPHLRRNY-----KNAIDGVTRIFKEEGVRKLLT 168
            P DVV  R+Q            S   PH+         K+ +  +  +++ EGV    +
Sbjct: 275 TPMDVVKTRVQTQQPLSSSNKAYSVSHPHVTNGRPVALSKSILLSLRTVYQSEGVLGFFS 334

Query: 169 GLGPNLVRGVLMTASQVVSYDVCKHNLVTTF 199
           G+GP  V   + ++  ++ Y +    L   F
Sbjct: 335 GVGPRFVWTSVQSSIMLLLYQMTLRGLGNAF 365

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 78/172 (45%), Gaps = 18/172 (10%)

Query: 127 DVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRK-LLTGLGPNLVRGVLMTASQV 185
           D V  R Q      P++++ Y+N I     I+ EEG R+ L  G    ++      A   
Sbjct: 75  DTVKTRQQG----APNVKK-YRNMISAYRTIWLEEGARRGLYCGYMAAMLGSFPSAAIFF 129

Query: 186 VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI----------M 235
            +Y+  K  ++  +  +  +  TH +A  +   +++ I  P++V+KTR+           
Sbjct: 130 GTYEYTKRTMIEDWQIN--DTVTHLSAGFLGDFISSFIYVPSEVLKTRLQLQGRFNNPFF 187

Query: 236 NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
            +  ++ +    + + I+ EG   +F G+  + AR  P + L F   E+LRK
Sbjct: 188 QSGYNYSNLRNAIKTVIKEEGFQSLFFGYKATLARDLPFSALQFAFYEKLRK 239

>TBLA0I00740 Chr9 complement(136063..137082) [1020 bp, 339 aa] {ON}
           Anc_7.467 YJR095W
          Length = 339

 Score = 76.3 bits (186), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 121/322 (37%), Gaps = 61/322 (18%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP-----KPTLFSMIQRILKNDGPLGLYSGLTAS 74
           GG  G+   +  HPLD  KVR+Q   +       P   +    I KN+G + LY GL A 
Sbjct: 15  GGTAGLFEALCCHPLDTIKVRMQIYKKSHLSSGNPGFLATGVNIYKNEGFVALYKGLGAV 74

Query: 75  ILRQCTYTTARFGCYDFIKENLL--PADKLNSTLYLLPCSMISGAIGG-----FVGNPAD 127
           ++        RF  Y+  + NLL  P  K  +T      + I+G   G      V NP +
Sbjct: 75  VIGIIPKMAIRFSSYEMFR-NLLTDPQTKTITT----ANTFIAGVGAGVTESIMVVNPME 129

Query: 128 VVNIRMQND----------------------------------SAHEPHLRRNYKNAIDG 153
           VV IR+Q+                                   + H   ++  Y+NAI  
Sbjct: 130 VVKIRLQSQHLVLQEAAATASATASSAAGTATATMTAAGGNHMATHAAPVK--YRNAIHA 187

Query: 154 VTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTAS 213
              I +EEGV  L  G+     R      +    Y   K  L  +               
Sbjct: 188 AYSIVREEGVATLYKGVSLTAARQATNQGANFTVYSKLKEYLQESQNTTVLPSYQTSLIG 247

Query: 214 LVAGLVATTICSPADVIKTRIMNAHQHHEST--------LKVLSSSIRNEGLGFMFRGWL 265
           L++G +     +P D IKTR+    +   ++        +++ +  ++ EG   +++G  
Sbjct: 248 LISGAIGPFTNAPLDTIKTRLQKEKKLSNTSSKGNWKRIMEIGNQLVKEEGPRALYKGIT 307

Query: 266 PSFARLGPNTILIFLVVEQLRK 287
           P   R+ P   + F V E +RK
Sbjct: 308 PRVMRVAPGQAVTFTVYEFVRK 329

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 70/152 (46%), Gaps = 11/152 (7%)

Query: 58  ILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPC------ 111
           I++ +G   LY G++ +  RQ T   A F  Y  +KE L   +  N+T  +LP       
Sbjct: 191 IVREEGVATLYKGVSLTAARQATNQGANFTVYSKLKEYL--QESQNTT--VLPSYQTSLI 246

Query: 112 SMISGAIGGFVGNPADVVNIRMQNDSA-HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGL 170
            +ISGAIG F   P D +  R+Q +        + N+K  ++   ++ KEEG R L  G+
Sbjct: 247 GLISGAIGPFTNAPLDTIKTRLQKEKKLSNTSSKGNWKRIMEIGNQLVKEEGPRALYKGI 306

Query: 171 GPNLVRGVLMTASQVVSYDVCKHNLVTTFGFD 202
            P ++R     A     Y+  +  L  T  F 
Sbjct: 307 TPRVMRVAPGQAVTFTVYEFVRKQLEDTKVFS 338

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 8/85 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILKNDGPLGLYSGL 71
           G + G +      PLD  K RLQ   +   T        +  +  +++K +GP  LY G+
Sbjct: 247 GLISGAIGPFTNAPLDTIKTRLQKEKKLSNTSSKGNWKRIMEIGNQLVKEEGPRALYKGI 306

Query: 72  TASILRQCTYTTARFGCYDFIKENL 96
           T  ++R        F  Y+F+++ L
Sbjct: 307 TPRVMRVAPGQAVTFTVYEFVRKQL 331

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 59/132 (44%), Gaps = 8/132 (6%)

Query: 112 SMISGAIGGFVG----NPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
           ++ISG   G       +P D + +RMQ     + HL       +     I+K EG   L 
Sbjct: 11  NLISGGTAGLFEALCCHPLDTIKVRMQ--IYKKSHLSSGNPGFLATGVNIYKNEGFVALY 68

Query: 168 TGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVAT-TICSP 226
            GLG  ++  +   A +  SY++ + NL+T            F A + AG+  +  + +P
Sbjct: 69  KGLGAVVIGIIPKMAIRFSSYEMFR-NLLTDPQTKTITTANTFIAGVGAGVTESIMVVNP 127

Query: 227 ADVIKTRIMNAH 238
            +V+K R+ + H
Sbjct: 128 MEVVKIRLQSQH 139

>CAGL0K02365g Chr11 (213531..216290) [2760 bp, 919 aa] {ON} highly
           similar to uniprot|Q12482 Saccharomyces cerevisiae
           YPR021c
          Length = 919

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 119/278 (42%), Gaps = 30/278 (10%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQ---RILKNDGPLGLYSGL 71
           Y +  G V G +   I +P+D  K R+Q A R      + I    +IL  +G  G+YSGL
Sbjct: 545 YNFSLGSVAGCIGATIVYPIDFVKTRMQ-AQRSLSQYKNSIDCFLKILSREGIRGVYSGL 603

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPAD 127
              ++        +    D+++  L   DK N  L LL   +ISGA  G       NP +
Sbjct: 604 GPQLIGVAPEKAIKLTVNDYMRNKL--KDK-NGKLGLL-SEIISGASAGACQVIFTNPLE 659

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           +V IR+Q       ++  N +NA     +I K  G+  L  G    L+R V  +A    +
Sbjct: 660 IVKIRLQ---VKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPT 716

Query: 188 YDVCKHNLVTTFGFDASEKKTH--------FTASLVAGLVATTICSPADVIKTRIMNAHQ 239
           Y   K +L   F FD ++K            +A  +AG+ A  + +P DVIKTR+    +
Sbjct: 717 YAHLKRDL---FNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPK 773

Query: 240 HHESTLK----VLSSSIRNEGLGFMFRGWLPSFARLGP 273
             E+  K       + +R E     F+G      R  P
Sbjct: 774 KGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSP 811

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 81/192 (42%), Gaps = 25/192 (13%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ--------TAARPKPTLFSMIQRILKNDGPLGLYSGL 71
           G   G    I T+PL++ K+RLQ         A   K T   +I+R+    G  GLY G 
Sbjct: 644 GASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRL----GLPGLYKGA 699

Query: 72  TASILRQCTYTTARFGCYDFIKENLL---PADK-----LNSTLYLLPCSMISGAIGGFVG 123
            A +LR   ++   F  Y  +K +L    P DK     LN T  LL    ++G    ++ 
Sbjct: 700 AACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLN-TWELLSAGALAGMPAAYLT 758

Query: 124 NPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTAS 183
            P DV+  R+Q D      +   YK  I     I +EE  +    G    ++R       
Sbjct: 759 TPFDVIKTRLQIDPKKGETI---YKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGF 815

Query: 184 QVVSYDVCKHNL 195
            + +Y++  HN+
Sbjct: 816 TLAAYELF-HNI 826

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 81/196 (41%), Gaps = 27/196 (13%)

Query: 104 STLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGV 163
            +LY      ++G IG  +  P D V  RMQ   +        YKN+ID   +I   EG+
Sbjct: 542 DSLYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQ-----YKNSIDCFLKILSREGI 596

Query: 164 RKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVA--- 220
           R + +GLGP L+      A ++   D  ++ L    G      K    + +++G  A   
Sbjct: 597 RGVYSGLGPQLIGVAPEKAIKLTVNDYMRNKLKDKNG------KLGLLSEIISGASAGAC 650

Query: 221 -TTICSPADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARL 271
                +P +++K R+         NA     + L++    I+  GL  +++G      R 
Sbjct: 651 QVIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQI----IKRLGLPGLYKGAAACLLRD 706

Query: 272 GPNTILIFLVVEQLRK 287
            P + + F     L++
Sbjct: 707 VPFSAIYFPTYAHLKR 722

>TPHA0E01570 Chr5 (320205..321113) [909 bp, 302 aa] {ON} Anc_5.461
           YOR130C
          Length = 302

 Score = 75.9 bits (185), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 122/283 (43%), Gaps = 18/283 (6%)

Query: 18  WYGGVGGIVACIITHPLDLAKVRLQTAARPK-PTLFSMIQRILKNDG-PLGLYSGLTASI 75
           +YG + G +  II +P D  KVRLQT +    P  +S I+   KN+G   G + G+++ +
Sbjct: 24  FYGSIAGCLGKIIEYPFDTVKVRLQTQSSTLFPNTWSCIKYTYKNEGIRRGFFQGISSPL 83

Query: 76  LRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPADVVNI 131
           +         F  Y+   + L    + N  L  L   ++SGA  G    FV  P +++  
Sbjct: 84  VGAAMENAVLFLSYNQCSKFL--ESRSNLQLSSLQNIIVSGAFAGSCASFVLTPVELIKC 141

Query: 132 RMQNDSAHEP-HLRRNYKNAI-DGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
           R+Q  + H   ++   Y N I   +  + K  GV  L  G     +R  +   +   +Y+
Sbjct: 142 RLQVLNIHNATNVTIKYSNKILPTIFDVLKSNGVFGLWKGQSSTFIRESVGGVAWFSTYE 201

Query: 190 VCKHNLVTTFGFDASEKKTHFTASLV-----AGLVATTICSPADVIKTRIMNAHQHHEST 244
           + K +L+        E K + T  L+     +GL       PAD +K+ +      H+S 
Sbjct: 202 LLKSSLLKRRQKKNPEIKDNCTWELLISGGSSGLAFNATIFPADTVKSVM---QTEHKSL 258

Query: 245 LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
            +   S +  +G+   +RG   +  R  P    +F V E L K
Sbjct: 259 TEAFKSIMLKQGIKGFYRGLGITLIRAVPANATVFYVYETLSK 301

>Kwal_23.4354 s23 (680149..681180) [1032 bp, 343 aa] {ON} YGR257C -
           Hypothetical ORF [contig 1] FULL
          Length = 343

 Score = 76.3 bits (186), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 93/197 (47%), Gaps = 19/197 (9%)

Query: 16  PWWYGGVGGIVACIITHPLDLAKVRLQTAAR--PKPTLFSMIQRILKND-------GPLG 66
           P   G +  ++A     PL+L + RLQ+  R  PK T   MI+ ++K         G   
Sbjct: 143 PLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVGYKA 202

Query: 67  LYSGLTASILRQCTYTTARFGCYDFIKENL-LPADKL-----NSTLYLLPCSMISGAIGG 120
           L+ GL  ++ R   +++  +GCY+F K N+ + ++K      NS       S + G+ GG
Sbjct: 203 LFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGG 262

Query: 121 FVG----NPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
            V     +P DV   RMQ    +    ++  KN    + ++ K EG+  L TGL P +++
Sbjct: 263 AVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALYTGLVPRVIK 322

Query: 177 GVLMTASQVVSYDVCKH 193
                A  + +Y+VCK 
Sbjct: 323 IAPSCAIMISTYEVCKR 339

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/266 (21%), Positives = 106/266 (39%), Gaps = 18/266 (6%)

Query: 39  VRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLP 98
           VR +T+     + +    +I K +G   L+ GL+ ++L         F  Y+ +++    
Sbjct: 75  VRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRDKSRL 134

Query: 99  ADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNY--KNAIDGVTR 156
            DK   TL  L C  ++  +      P ++   R+Q+     P        K+ I     
Sbjct: 135 QDKY-PTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRY 193

Query: 157 IFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLV----TTFGFDASEKKTHFTA 212
              + G + L  GL   L R V  ++     Y+  K N+      +    ++    HF  
Sbjct: 194 EISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVN 253

Query: 213 SLVAG----LVATTICSPADVIKTRIMNAH-------QHHESTLKVLSSSIRNEGLGFMF 261
           S V G     VA  +  P DV KTR+   +       +  ++  K L+   ++EGL  ++
Sbjct: 254 SFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALY 313

Query: 262 RGWLPSFARLGPNTILIFLVVEQLRK 287
            G +P   ++ P+  ++    E  ++
Sbjct: 314 TGLVPRVIKIAPSCAIMISTYEVCKR 339

>NCAS0E03120 Chr5 complement(619240..620157) [918 bp, 305 aa] {ON}
           Anc_7.228
          Length = 305

 Score = 75.5 bits (184), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 122/288 (42%), Gaps = 31/288 (10%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLF----SMIQRILKNDGPLGLYSGLTA 73
           +GGIVAC  TH    PLDL K RLQ      PTL+    S I +ILK +G   L++G+ A
Sbjct: 21  LGGIVACGPTHSSVTPLDLIKCRLQV----DPTLYRSNTSGIIQILKKEGLGKLFTGVGA 76

Query: 74  SILRQCTYTTARFGCYDFIKE---NLLPADKLNSTLYLLPCSMISGAIGGFVGN----PA 126
           + +        ++G Y+  K      L  D+  +  Y     ++S A   F  +    P 
Sbjct: 77  TCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPF 136

Query: 127 DVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
           + + ++ Q  +   P       N I+G  +++ +EG+     G+ P   R +  T  +  
Sbjct: 137 EAIKVKQQ--TTMPPWCN----NVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFT 190

Query: 187 SYDVCKHNLVTTFGFDASEKKT--HFTASLVAGLVATTICS----PADVIKTRIMNAHQH 240
           S++     +        SE       + S V G +A  +C+    PADV+ ++I N  + 
Sbjct: 191 SFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKV 250

Query: 241 HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
           +ES    L       G   ++ G       +G  T   +L+ +  + Y
Sbjct: 251 NESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAY 298

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+  I++HP D+   ++    +   ++   ++RI    G +GL++GL   IL   
Sbjct: 223 GYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIG 282

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 283 TLTSFQWLIYDSFK 296

>KLTH0E15224g Chr5 (1351301..1352212) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P32331 Saccharomyces cerevisiae
           YPR058W YMC1 Putative mitochondrial inner membrane
           transporter member of the mitochondrial carrier (MCF)
           family
          Length = 303

 Score = 75.5 bits (184), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 120/281 (42%), Gaps = 21/281 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GGI   ++  P D  KVRLQT++ P  T   +++ ++KN+G  G Y G    ++   
Sbjct: 30  GTAGGIAQVLVGQPFDTTKVRLQTSSTPT-TAVQVVKNLIKNEGLRGFYKGTLTPLVGVG 88

Query: 80  TYTTARFGCYDFIKENLL-PADKLNSTLYL---LPCSMISGAIGGFVGNPADVVNIRMQN 135
              + +FG  + +K     P   +N  L L     C +  G    F+ +P + V IR+Q 
Sbjct: 89  ACVSCQFGVNEAMKRFFRGPNSDVNKPLTLPQYYVCGLAGGIANSFLASPIEHVRIRLQT 148

Query: 136 DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNL 195
            ++       ++K  +D + ++ K  G   L+ GL P ++R     A+  ++Y+    N 
Sbjct: 149 QTSS--GTAASFKGPLDCIKKL-KSNGA--LMRGLTPTVLREAQGCATYFLTYEALVANE 203

Query: 196 VTTFGFDASE----KKTHFTASLVAGLVATTICSPADVIK----TRIMNAHQHHESTLKV 247
           V   G   S+    K   F A  ++G+    +  P DV+K    T  + +  H    + V
Sbjct: 204 VQK-GLKRSDVPAWKLCMFGA--ISGVTLWLMVYPIDVVKSIMQTDNLQSPVHGRDPIVV 260

Query: 248 LSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
                   G    F+G+ P+  R  P     F   E   ++
Sbjct: 261 AKKMYTQRGWRVFFKGFGPTMLRAAPANGATFATFELTMRF 301

>NDAI0A05240 Chr1 complement(1183362..1184267) [906 bp, 301 aa] {ON}
           Anc_3.348
          Length = 301

 Score = 75.5 bits (184), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 118/276 (42%), Gaps = 21/276 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GGI   ++  P D  KVRLQTA   +     ++  +LKN+GP G Y G    ++   
Sbjct: 28  GTAGGIAQVLVGQPFDTTKVRLQTATT-RTNAMEVVINLLKNEGPRGFYKGTLTPLVGVG 86

Query: 80  TYTTARFGCYDFIKE-----NLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ 134
              + +FG  + +K      N   ++ L+ T Y   C +  G    F+ +P + V IR+Q
Sbjct: 87  ACVSLQFGVNEAMKRFFHSLNDRKSETLSLTQYYF-CGVTGGISNSFLASPIEHVRIRLQ 145

Query: 135 NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHN 194
             +    +++  +K  +D + ++    G+ +   GL P L R      +  + Y+    N
Sbjct: 146 TQTGSGSNVQ--FKGPLDCIRQLKNAGGIMR---GLTPTLFREGHGIGTYFLIYEALVAN 200

Query: 195 LVTTFGFDASEKKTHFTASLVAGLVATTI---CSPADVIKTRIMNAHQHHESTLKVLSSS 251
            +   G   ++  +     L   L  TT+     P DVIK+ +   +  +    K + S 
Sbjct: 201 EINN-GMKRND-ISPLKLCLFGALSGTTLWLMVYPLDVIKSIMQTDNIKNPKFGKTMGSV 258

Query: 252 IR----NEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
            +     +GLG  FRG+ P+  R  P     F   E
Sbjct: 259 AKTLYAKQGLGAFFRGFGPTILRAAPANGATFATFE 294

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 87/203 (42%), Gaps = 32/203 (15%)

Query: 5   KSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQ-------- 56
           KSE+  ++ +Y ++ G  GGI    +  P++  ++RLQT         S +Q        
Sbjct: 110 KSETL-SLTQY-YFCGVTGGISNSFLASPIEHVRIRLQTQTGSG----SNVQFKGPLDCI 163

Query: 57  RILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLN--------STLYL 108
           R LKN G  G+  GLT ++ R+        G Y  I E L+ A+++N        S L L
Sbjct: 164 RQLKNAG--GIMRGLTPTLFREG----HGIGTYFLIYEALV-ANEINNGMKRNDISPLKL 216

Query: 109 LPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLT 168
                +SG     +  P DV+   MQ D+   P   +   +       ++ ++G+     
Sbjct: 217 CLFGALSGTTLWLMVYPLDVIKSIMQTDNIKNPKFGKTMGSV---AKTLYAKQGLGAFFR 273

Query: 169 GLGPNLVRGVLMTASQVVSYDVC 191
           G GP ++R      +   ++++ 
Sbjct: 274 GFGPTILRAAPANGATFATFELA 296

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 37/87 (42%), Gaps = 1/87 (1%)

Query: 202 DASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMF 261
           D+        A    G+    +  P D  K R+  A     + ++V+ + ++NEG    +
Sbjct: 17  DSGRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTATTRTNA-MEVVINLLKNEGPRGFY 75

Query: 262 RGWLPSFARLGPNTILIFLVVEQLRKY 288
           +G L     +G    L F V E ++++
Sbjct: 76  KGTLTPLVGVGACVSLQFGVNEAMKRF 102

>YPR058W Chr16 (673751..674674) [924 bp, 307 aa] {ON}
           YMC1Mitochondrial protein, putative inner membrane
           transporter with a role in oleate metabolism and
           glutamate biosynthesis; member of the mitochondrial
           carrier (MCF) family; has similarity with Ymc2p
          Length = 307

 Score = 75.5 bits (184), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 119/288 (41%), Gaps = 17/288 (5%)

Query: 7   ESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLG 66
           +  NA V      G  GGI   ++  P D  KVRLQT++ P  T   +++++L N+GP G
Sbjct: 19  QHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT-TAMEVVRKLLANEGPRG 77

Query: 67  LYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLP----CSMISGAIGGFV 122
            Y G    ++      + +FG  + +K      +   S+   LP    C +  G +  F+
Sbjct: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFL 137

Query: 123 GNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTA 182
            +P + V IR+Q  +    +    +K  ++ + ++      + LL GL P ++R      
Sbjct: 138 ASPIEHVRIRLQTQTGSGTNAE--FKGPLECIKKLRHN---KALLRGLTPTILREGHGCG 192

Query: 183 SQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTI---CSPADVIKTRIMNAHQ 239
           +  + Y+    N +        +    +   +   L  T +     P DVIK+ +   + 
Sbjct: 193 TYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNL 252

Query: 240 HHESTLKVLSSSIR----NEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
                   +SS  +    N G+G  F+G+ P+  R  P     F   E
Sbjct: 253 QKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300

>Smik_5.180 Chr5 complement(262789..263691) [903 bp, 300 aa] {ON}
           YER053C (REAL)
          Length = 300

 Score = 75.1 bits (183), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 122/279 (43%), Gaps = 20/279 (7%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           +GGI+AC  TH    PLDL K RLQ   +   +     ++I+ N+G   +Y+G  A+ + 
Sbjct: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYSSNLDGFRKIIANEGWKKVYTGFGATFVG 82

Query: 78  QCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDS 137
                  ++G Y++ K           T+YL+  S  +  +   +  P + + ++ Q  +
Sbjct: 83  YSLQGAGKYGGYEYFKHLYSNWLSPGVTVYLM-ASATAEFLADIMLCPFEAIKVKQQ--T 139

Query: 138 AHEPHLRRNYKNAIDGVTRIFKEE-GVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLV 196
              P+      N +DG  +++ E  G++    G+ P   R +  T  +  S++     + 
Sbjct: 140 TMPPYCN----NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIY 195

Query: 197 TTFGFDASEKKT--HFTASLVAGLVATTICS----PADVIKTRIMNAHQHHESTLKVLSS 250
           +       E       + S V G +A  +C+    PADV+ ++I N+ +    ++ V S 
Sbjct: 196 SVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKI-NSERKANESMSVASK 254

Query: 251 SIRNE-GLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
            I  + G   ++ G +     +G  T   +L+ +  + Y
Sbjct: 255 RIYQKIGFAGLWNGLMVRIVMIGTLTSFQWLIYDSFKAY 293

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 38/74 (51%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+   ++HP D+   ++ +  +   ++    +RI +  G  GL++GL   I+   
Sbjct: 218 GYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFAGLWNGLMVRIVMIG 277

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 278 TLTSFQWLIYDSFK 291

>KNAG0B01560 Chr2 complement(288626..289561) [936 bp, 311 aa] {ON} 
          Length = 311

 Score = 75.1 bits (183), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 117/276 (42%), Gaps = 23/276 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GGI   ++  P D  KVRLQT++    +L  +I+ +L+N+GPL  Y G    ++   
Sbjct: 40  GTSGGIAQVLVGQPFDTTKVRLQTSS-ANTSLLDVIRSLLRNEGPLAFYKGTLTPLVGVG 98

Query: 80  TYTTARFGCYDFIK---ENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQND 136
              + +FG  + +K    N      ++   Y + C M  G +  F+ +P + V IR+Q  
Sbjct: 99  LCVSVQFGVNEAMKRFFRNRNRGQPISLPQYYI-CGMTGGLVNSFLSSPIEHVRIRLQTQ 157

Query: 137 SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR-----GVLMTASQVVSYDVC 191
            +    + R ++  +D + ++ K+   R L+ GL    +R     G      + +  +  
Sbjct: 158 KSS--GINREFQGPLDCIRKLVKQ---RSLMRGLPVMFLRAGHGLGCYFLVYEALICNEV 212

Query: 192 KHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI----MNAHQHHESTLKV 247
           KH +      D    K   +   VAG        P DVIK+ I    +    +  S + V
Sbjct: 213 KHGVARC---DIPAWKLC-SYGAVAGTTLWMSIYPLDVIKSVIQTDRLRNPVYKNSMVHV 268

Query: 248 LSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
                   GL   F+G++P+  R  P     F+  E
Sbjct: 269 AKQLYARGGLAAFFKGFVPTLLRASPANAATFVTFE 304

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 35/84 (41%), Gaps = 8/84 (9%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQTAARPKP----TLFSMIQRILKNDGPLGL 67
           P W    YG V G    +  +PLD+ K  +QT     P    ++  + +++    G    
Sbjct: 222 PAWKLCSYGAVAGTTLWMSIYPLDVIKSVIQTDRLRNPVYKNSMVHVAKQLYARGGLAAF 281

Query: 68  YSGLTASILRQCTYTTARFGCYDF 91
           + G   ++LR      A F  ++F
Sbjct: 282 FKGFVPTLLRASPANAATFVTFEF 305

 Score = 29.6 bits (65), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 212 ASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARL 271
           A    G+    +  P D  K R+  +  +  S L V+ S +RNEG    ++G L     +
Sbjct: 39  AGTSGGIAQVLVGQPFDTTKVRLQTSSAN-TSLLDVIRSLLRNEGPLAFYKGTLTPLVGV 97

Query: 272 GPNTILIFLVVEQLRKY 288
           G    + F V E ++++
Sbjct: 98  GLCVSVQFGVNEAMKRF 114

>Skud_9.33 Chr9 (74594..75535) [942 bp, 313 aa] {ON} YIL134W (REAL)
          Length = 313

 Score = 75.1 bits (183), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 131/303 (43%), Gaps = 43/303 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLF----SMIQRILKN---------DGPLG 66
           G   G +  ++ HPLDL KVRLQ +A     +     ++IQ I+++         +    
Sbjct: 15  GLTAGSITTLVVHPLDLLKVRLQLSATNAQKVHYGPSTVIQEIVRSSVSNRHRTLNVVNE 74

Query: 67  LYSGLTASILRQCTYTTARFGCYDFIKENLLPA---------------DKLNSTLYLLPC 111
           LY GLT ++          FG Y   KE +                   K+NS +Y L  
Sbjct: 75  LYRGLTINLCGNAIAWGVYFGLYGVTKELIYKLVAGPEQSQLKGASNDHKMNSLIY-LSA 133

Query: 112 SMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
              SG++   + NP  V+  R+ + S        +Y +  +GV R+ + EG+R L  GL 
Sbjct: 134 GAASGSMTAILTNPIWVIKTRIMSTSKGAEG---SYTSIYNGVQRLLRTEGIRGLWKGLV 190

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTA------SLVAGLVATTICS 225
           P L  GV   A     YD  K   +     D + + +H T       + +  +++ T+  
Sbjct: 191 PALF-GVSQGALYFTVYDTLKQKRLRR--KDENGQNSHLTTLETIEITSLGKMISVTMVY 247

Query: 226 PADVIKTRIMN--AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           P  ++K+ + +  A++ +   L ++   + N+G   +++G   +  R  P+T + F V E
Sbjct: 248 PFQLLKSNLQSFKANEQNFRLLPLIRLIVANDGFVGLYKGLSANLVRAIPSTCITFCVYE 307

Query: 284 QLR 286
            L+
Sbjct: 308 NLK 310

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 82/186 (44%), Gaps = 16/186 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKP----TLFSMIQRILKNDGPLGLYSGLTASI 75
           G   G +  I+T+P+ + K R+ + ++       ++++ +QR+L+ +G  GL+ GL  ++
Sbjct: 134 GAASGSMTAILTNPIWVIKTRIMSTSKGAEGSYTSIYNGVQRLLRTEGIRGLWKGLVPAL 193

Query: 76  LRQCTYTTARFGCYDFIKENLLPADKLN------STLYLLPCSMISGAIGGFVGNPADVV 129
               +     F  YD +K+  L     N      +TL  +  + +   I   +  P  ++
Sbjct: 194 F-GVSQGALYFTVYDTLKQKRLRRKDENGQNSHLTTLETIEITSLGKMISVTMVYPFQLL 252

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
              +Q+  A+E + R      +  +  I   +G   L  GL  NLVR +  T      Y+
Sbjct: 253 KSNLQSFKANEQNFR-----LLPLIRLIVANDGFVGLYKGLSANLVRAIPSTCITFCVYE 307

Query: 190 VCKHNL 195
             KH L
Sbjct: 308 NLKHRL 313

>NDAI0E04370 Chr5 (987903..988823) [921 bp, 306 aa] {ON} Anc_7.228
          Length = 306

 Score = 75.1 bits (183), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 130/290 (44%), Gaps = 35/290 (12%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           +GGI+AC  TH    PLDL K RLQ  ++   +      +I+KN+G   L++G+ A+++ 
Sbjct: 21  LGGIIACGPTHSSVTPLDLVKCRLQVNSKLYKSNIDGALKIIKNEGISKLFTGVGATLIG 80

Query: 78  QCTYTTARFGCYDFIK--------ENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVV 129
                  ++G Y+  K        +N   A K  +++YL+  S  +      +  P + +
Sbjct: 81  YSLQGAGKYGGYELFKRFYSTTLVKNEEMAYKYRTSIYLMA-SASAEFFADIMLCPFEAI 139

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
            ++ Q  +   P       N ++G+ +++  EG++    G+ P   R +  T  +  S++
Sbjct: 140 KVKQQ--TTMPPFCN----NVVEGMKKMYAAEGIKGFYKGITPLWCRQIPYTMCKFTSFE 193

Query: 190 VCKHNLVTTFGFDASEKKTHFTA------SLVAGLVATTICS----PADVIKTRIMNAHQ 239
                +V         KK   +A      S V G +A  +C+    PADV+ ++I N  +
Sbjct: 194 ----RIVEAIYARLPTKKNDMSALQQISVSFVGGYLAGILCAVVSHPADVMVSKINNERK 249

Query: 240 HHESTLKVLSSSI-RNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
             E T+ + S  I +N G   ++ G       +G  T   +L+ +  + Y
Sbjct: 250 FGE-TMAIASKRIYKNIGFIGLWNGLTVRIFMIGTLTSFQWLIYDSFKAY 298

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+  +++HP D+   ++    +   T+    +RI KN G +GL++GLT  I    
Sbjct: 223 GYLAGILCAVVSHPADVMVSKINNERKFGETMAIASKRIYKNIGFIGLWNGLTVRIFMIG 282

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 283 TLTSFQWLIYDSFK 296

>Suva_9.55 Chr9 (92154..93095) [942 bp, 313 aa] {ON} YIL134W (REAL)
          Length = 313

 Score = 75.1 bits (183), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 129/305 (42%), Gaps = 47/305 (15%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPK-------PTLFSMI--------QRILK--ND 62
           G   G +  ++ HPLDL KVRLQ +A          PT+   I         R LK  N+
Sbjct: 15  GLTAGSITTLVVHPLDLLKVRLQLSATSAQKAHYGPPTVIKEIVRSSAHNRHRTLKVINE 74

Query: 63  GPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPA---------------DKLNSTLY 107
               LY GLT ++          FG Y   KE +  +                K+NS +Y
Sbjct: 75  ----LYRGLTINLFGNAIAWGVYFGLYGISKELIYKSLAGPEQIQHKSANNDHKMNSLIY 130

Query: 108 LLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
            L    +SG +   + NP  V+  R+ + S      R +Y +  +GV R+ + EG++ L 
Sbjct: 131 -LSAGAVSGLLTAILTNPIWVIKTRIMSTSKTA---RGSYTSIYNGVQRLLRTEGLQGLW 186

Query: 168 TGLGPNLVRGVLMTASQVVSYDVCKH-NLVTTFGFDASEKKTHFTASLVAG---LVATTI 223
            G+ P L  GV   A     YD  K   L    G   +   T+F    +     +V+ T+
Sbjct: 187 KGIVPALF-GVSQGALYFAVYDTLKQRKLRQKGGHGENGHLTNFQTIEITSFGKMVSVTL 245

Query: 224 CSPADVIKTRIMN--AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
             P  ++K+ + +  A + +   + ++   I N+G   +++G   +  R  P+T + F V
Sbjct: 246 VYPFQLLKSNLQSFRAKEQNFKFIPLIKLIITNDGFLGLYKGLSANLVRAIPSTCITFCV 305

Query: 282 VEQLR 286
            E L+
Sbjct: 306 YENLK 310

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 82/186 (44%), Gaps = 16/186 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRL----QTAARPKPTLFSMIQRILKNDGPLGLYSGLTASI 75
           G V G++  I+T+P+ + K R+    +TA     ++++ +QR+L+ +G  GL+ G+  ++
Sbjct: 134 GAVSGLLTAILTNPIWVIKTRIMSTSKTARGSYTSIYNGVQRLLRTEGLQGLWKGIVPAL 193

Query: 76  LRQCTYTTARFGCYDFIKENLLPADKLN------STLYLLPCSMISGAIGGFVGNPADVV 129
               +     F  YD +K+  L     +      +    +  +     +   +  P  ++
Sbjct: 194 F-GVSQGALYFAVYDTLKQRKLRQKGGHGENGHLTNFQTIEITSFGKMVSVTLVYPFQLL 252

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
              +Q+  A E    +N+K  I  +  I   +G   L  GL  NLVR +  T      Y+
Sbjct: 253 KSNLQSFRAKE----QNFK-FIPLIKLIITNDGFLGLYKGLSANLVRAIPSTCITFCVYE 307

Query: 190 VCKHNL 195
             KH L
Sbjct: 308 NLKHRL 313

>Smik_9.35 Chr9 (75129..76073) [945 bp, 314 aa] {ON} YIL134W (REAL)
          Length = 314

 Score = 75.1 bits (183), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 129/300 (43%), Gaps = 43/300 (14%)

Query: 23  GGIVACIITHPLDLAKVRLQTAARPKPTL----FSMIQRILKNDGPLG---------LYS 69
            G +  ++ HPLDL KVRLQ +A     +    F++I+ I+ +    G         LY 
Sbjct: 19  AGCITTLVVHPLDLLKVRLQLSATSAQKVHYGPFAVIKEIIHSSANTGRSRSKVINELYR 78

Query: 70  GLTASILRQCTYTTARFGCYDFIKENLLPA---------------DKLNSTLYLLPCSMI 114
           GL+ ++          FG Y  +K+ +  A                K+NS +Y L     
Sbjct: 79  GLSINLFGNAIAWGVYFGLYGVMKDLIYKAVEKPGQSQFQGVSNDHKINSLIY-LSAGAS 137

Query: 115 SGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNL 174
           SG +   + NP  V+  R+ + S     ++  Y +  +GV ++ ++EG+R L  GL P L
Sbjct: 138 SGLMTAILTNPIWVIKTRIMSTS---KGVQGAYTSIYNGVQQLLRKEGLRGLWKGLVPAL 194

Query: 175 VRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFT------ASLVAGLVATTICSPAD 228
             GV   A     YD  K   +       S +  H T       + +  +++ T+  P  
Sbjct: 195 F-GVSQGALYFTVYDTLKQRKLRR--KRESGQNIHLTNLETIEITSLGKMISVTLVYPFQ 251

Query: 229 VIKTRIMN--AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
           ++K+ + +  A++       ++   I N+G   +++G   +  R  P+T + F V E L+
Sbjct: 252 LLKSNLQSFKANEQKFRLFPLVKLIIANDGFAGLYKGLSTNLLRAIPSTCITFCVYENLK 311

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 22  VGGIVACIITHPLDLAKVRLQT--AARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           +G +++  + +P  L K  LQ+  A   K  LF +++ I+ NDG  GLY GL+ ++LR  
Sbjct: 238 LGKMISVTLVYPFQLLKSNLQSFKANEQKFRLFPLVKLIIANDGFAGLYKGLSTNLLRAI 297

Query: 80  TYTTARFGCYDFIKENL 96
             T   F  Y+ +K  L
Sbjct: 298 PSTCITFCVYENLKHRL 314

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 81/186 (43%), Gaps = 16/186 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAAR----PKPTLFSMIQRILKNDGPLGLYSGLTASI 75
           G   G++  I+T+P+ + K R+ + ++       ++++ +Q++L+ +G  GL+ GL  ++
Sbjct: 135 GASSGLMTAILTNPIWVIKTRIMSTSKGVQGAYTSIYNGVQQLLRKEGLRGLWKGLVPAL 194

Query: 76  LRQCTYTTARFGCYDFIKENLLPADKLN------STLYLLPCSMISGAIGGFVGNPADVV 129
               +     F  YD +K+  L   + +      + L  +  + +   I   +  P  ++
Sbjct: 195 F-GVSQGALYFTVYDTLKQRKLRRKRESGQNIHLTNLETIEITSLGKMISVTLVYPFQLL 253

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
              +Q+  A+E   R         V  I   +G   L  GL  NL+R +  T      Y+
Sbjct: 254 KSNLQSFKANEQKFR-----LFPLVKLIIANDGFAGLYKGLSTNLLRAIPSTCITFCVYE 308

Query: 190 VCKHNL 195
             KH L
Sbjct: 309 NLKHRL 314

>SAKL0A00132g Chr1 complement(9038..9973) [936 bp, 311 aa] {ON}
           highly similar to gnl|GLV|KLLA0F17864g Kluyveromyces
           lactis KLLA0F17864g and similar to YPR058W
           uniprot|P32331 Saccharomyces cerevisiae YPR058W YMC1
           Putative mitochondrial inner membrane transporter member
           of the mitochondrial carrier (MCF) family
          Length = 311

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 117/265 (44%), Gaps = 19/265 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GGI   ++  P D+ KVR+QT++   PT   +I+ ++KN+G L  Y G    ++   
Sbjct: 30  GTSGGIAQVLVGQPFDITKVRMQTSS-GSPTAIEVIKNLVKNEGLLAFYKGTLVPLIGVG 88

Query: 80  TYTTARFGCYDFIKENLLPA----DKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQN 135
              + +FG  + +K   L      D+  S L    C  +SG+   F+  P + V IR+Q 
Sbjct: 89  ACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQL 148

Query: 136 DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD--VCKH 193
            +  +   +  Y+ ++D + ++ K+   + L+ G    L+R         ++Y+  +   
Sbjct: 149 QT--KALAKAEYRGSLDCMKKLLKQ---KALMRGFTATLMRTSHGFGVYFLTYEALIMNQ 203

Query: 194 NLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQ-----HHESTLKVL 248
           N       D    K     +  +G     +  P DV+K+ IM A +     H ++  +V 
Sbjct: 204 NKNGVLRKDIPPWKVCVFGAF-SGAFFWAMTYPFDVVKS-IMQADRLVSPVHGKNVFQVA 261

Query: 249 SSSIRNEGLGFMFRGWLPSFARLGP 273
            S     G G   +G++P+  R  P
Sbjct: 262 KSIHATRGWGAFVKGFVPTMLRSLP 286

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 217 GLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTI 276
           G+    +  P D+ K R M       + ++V+ + ++NEGL   ++G L     +G    
Sbjct: 34  GIAQVLVGQPFDITKVR-MQTSSGSPTAIEVIKNLVKNEGLLAFYKGTLVPLIGVGACVS 92

Query: 277 LIFLVVEQLRKY 288
             F V E +++Y
Sbjct: 93  CQFGVNEAMKRY 104

>NDAI0C01470 Chr3 (309948..310916) [969 bp, 322 aa] {ON} Anc_5.461
          Length = 322

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 118/271 (43%), Gaps = 8/271 (2%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPK-PTLFSMIQRILKNDGPL-GLYSGLTASILR 77
           G + G +  +I +P D  KVRLQT      P  +S I+   KN+G L G + G+ + ++ 
Sbjct: 55  GSIAGAIGKLIEYPFDTIKVRLQTQESYMFPDTWSCIKYTYKNEGILHGFFQGIESPLIG 114

Query: 78  QCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ-ND 136
                   F  Y+     L      +S + +L  +  +G+   FV  P +++  ++Q ++
Sbjct: 115 AALENAILFLSYNQCASFLAHFTTFSSFVVILISATFAGSCASFVLTPIELIKCKLQISN 174

Query: 137 SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLV 196
              +      + + I  +  I KE G+  L  G     +R  + +     +Y++ K +L 
Sbjct: 175 LQMDLSDEERHTSIIPTIKHIVKERGILGLWQGQSSTFIRESIGSMIWFATYELMKRSL- 233

Query: 197 TTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEG 256
                D+++      +  +AGL       PAD +K+ +   H + + T++ +   +   G
Sbjct: 234 -RMEKDSNDTWELLISGAIAGLAFNGTVFPADTVKSIMQTEHTNLKETVQNI---LDRYG 289

Query: 257 LGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           +   +RG   +  R  P+   IF   E+L K
Sbjct: 290 VAGFYRGLGITLIRAIPSNAAIFFTYEKLTK 320

>NDAI0H03220 Chr8 complement(770078..770968) [891 bp, 296 aa] {ON}
           Anc_2.344
          Length = 296

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 82/176 (46%), Gaps = 7/176 (3%)

Query: 66  GLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNP 125
           GLYSG  A++L         FG Y+F K  ++   +LN T+  L    +   +  FV  P
Sbjct: 24  GLYSGYFAAMLGSLPSAAIFFGTYEFCKRKMIDEYELNETMSHLTSGFMGDFMSSFVYVP 83

Query: 126 ADVVNIRMQ-NDSAHEPHLRR--NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTA 182
           ++V+  R+Q     + P+ +   NY+N    +++I + EG+  L  G    LVR +  +A
Sbjct: 84  SEVLKTRLQLQGRFNNPYFQSGYNYRNLKSAISKIIQTEGIHALFFGYKATLVRDLPFSA 143

Query: 183 SQVVSYDVCKHNLVTTFGFDASEKKTHFTASLV----AGLVATTICSPADVIKTRI 234
            Q   Y+  ++        D        +  L+    AG +A  I +P DV+KTR+
Sbjct: 144 LQFAFYEKFRYYAFALEKKDILHDNLSLSNELITGACAGGLAGVITTPMDVLKTRL 199

 Score = 57.4 bits (137), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 74/160 (46%), Gaps = 13/160 (8%)

Query: 146 NYKNAIDGVTRIFKEEGV-RKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDAS 204
            YKN I     +F EEG+ R L +G    ++  +   A    +Y+ CK  ++    ++ +
Sbjct: 4   KYKNMITAYKTVFLEEGIMRGLYSGYFAAMLGSLPSAAIFFGTYEFCKRKMIDE--YELN 61

Query: 205 EKKTHFTASLVAGLVATTICSPADVIKTRI----------MNAHQHHESTLKVLSSSIRN 254
           E  +H T+  +   +++ +  P++V+KTR+            +  ++ +    +S  I+ 
Sbjct: 62  ETMSHLTSGFMGDFMSSFVYVPSEVLKTRLQLQGRFNNPYFQSGYNYRNLKSAISKIIQT 121

Query: 255 EGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQ 294
           EG+  +F G+  +  R  P + L F   E+ R Y   + +
Sbjct: 122 EGIHALFFGYKATLVRDLPFSALQFAFYEKFRYYAFALEK 161

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/222 (20%), Positives = 87/222 (39%), Gaps = 42/222 (18%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLF----------SMIQRILKNDGPLGLYS 69
           G +G  ++  +  P ++ K RLQ   R     F          S I +I++ +G   L+ 
Sbjct: 70  GFMGDFMSSFVYVPSEVLKTRLQLQGRFNNPYFQSGYNYRNLKSAISKIIQTEGIHALFF 129

Query: 70  GLTASILRQCTYTTARFGCYD---FIKENLLPADKLNSTLYL---LPCSMISGAIGGFVG 123
           G  A+++R   ++  +F  Y+   +    L   D L+  L L   L     +G + G + 
Sbjct: 130 GYKATLVRDLPFSALQFAFYEKFRYYAFALEKKDILHDNLSLSNELITGACAGGLAGVIT 189

Query: 124 NPADVVNIRMQND--------------------------SAHEPHLRRNYKNAIDGVTRI 157
            P DV+  R+Q                            +  +P      ++   G+  +
Sbjct: 190 TPMDVLKTRLQTQLEVPDTQVFTPNTAKAVNNTNNNNNSNGRKPKQVILSRSIFQGLRSV 249

Query: 158 FKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTF 199
           ++ EGV  L +G+GP  V   + ++  +V Y +    L  +F
Sbjct: 250 YQSEGVIGLFSGVGPRFVWTSIQSSIMLVLYQMTLRVLTNSF 291

>Smik_13.235 Chr13 complement(371369..372298) [930 bp, 309 aa] {ON}
           YMR056C (REAL)
          Length = 309

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 84/192 (43%), Gaps = 25/192 (13%)

Query: 15  YPWWY------GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILK 60
           Y  W+      GG  G ++ +  + LD A+ RL   AR   +        L  + ++ LK
Sbjct: 114 YGKWFAGNVFSGGAAGGLSLMFVYSLDYARTRLAADARGSRSASQRQFNGLLDVYKKTLK 173

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL--YLLPCSMISGAI 118
            DG LGLY G   S+L    Y    FG YD  K  LL      S +  +LL   +  GA 
Sbjct: 174 TDGLLGLYRGFMPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMGA- 232

Query: 119 GGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGV 178
                 P D V  RM   S         Y  A+D + +I ++EGV  L  G G N+ RGV
Sbjct: 233 -STASYPLDTVRRRMMMTSGQSV----KYDGAVDCLKKIVQQEGVYSLFKGCGANIFRGV 287

Query: 179 LMTASQVVS-YD 189
              A+ V+S YD
Sbjct: 288 --AAAGVISLYD 297

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 63/173 (36%), Gaps = 26/173 (15%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSA--HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S AI      P + V + MQN      +  L   Y   +D   R    EG+     G  
Sbjct: 22  VSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDSRYVGIVDCFKRTATHEGIVSFWRGNT 81

Query: 172 PNLVRGVLMTA---------SQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATT 222
            N++R     A           V+SYD  +      F  +       F+     GL    
Sbjct: 82  ANVLRYFPTQALNFAFKDKIKSVLSYDRARDGYGKWFAGNV------FSGGAAGGLSLMF 135

Query: 223 ICSPADVIKTRIMN--------AHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
           + S  D  +TR+          + +     L V   +++ +GL  ++RG++PS
Sbjct: 136 VYS-LDYARTRLAADARGSRSASQRQFNGLLDVYKKTLKTDGLLGLYRGFMPS 187

>Kwal_55.20868 s55 (589891..591033) [1143 bp, 380 aa] {ON} YIL006W -
           Hypothetical ORF [contig 453] FULL
          Length = 380

 Score = 75.1 bits (183), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 136/306 (44%), Gaps = 38/306 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAA-RPKPT-----LFSMIQRILKNDGPLGLYSGLTA 73
           G + G +A +   PLD+AK RLQ       P+     +   +  I++++G  GLY GL  
Sbjct: 82  GAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGLVP 141

Query: 74  SILRQCTYTTARFGCYDFIKE---NLLPA-DKLNSTLYLLPCSMISGAIGGFVGNPADVV 129
            I+         F  Y+  K+    + P+ D ++ +      ++ +G +   + NP  VV
Sbjct: 142 IIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHS----ASALTAGTVSTILTNPVWVV 197

Query: 130 NIRMQNDSAHEPHLRRN---YKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
             R+   +    H+ +N   Y +  D   +++  EG+R    GL P+L+ G+   A    
Sbjct: 198 KTRLMLQT----HVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLL-GLFHVAIHFP 252

Query: 187 SYDVCKHNLVTTFGFDASEKKTHFTASLV-----AGLVATTICSPADVIKTRI------- 234
            Y+  K  L  T     +E      A L+     + +VA+T+  P ++++TR+       
Sbjct: 253 IYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYPT 312

Query: 235 --MNAHQH--HESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEI 290
             + A Q       ++++  + ++EGL   + G+  + AR  P + +  +  E  RKY  
Sbjct: 313 DPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEYFRKYLT 372

Query: 291 GMHQHF 296
            ++ +F
Sbjct: 373 KLNDNF 378

 Score = 60.8 bits (146), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 86/190 (45%), Gaps = 24/190 (12%)

Query: 112 SMISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
           + +SGA+ GF+      P DV   R+Q    H  +    YK  +  +T I ++EG R L 
Sbjct: 78  TALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHS-NPSNYYKGILGTLTTIIRDEGARGLY 136

Query: 168 TGLGPNLVRGVLMTASQVVS-YDVCKH---NLVTTFGFDASEKKTHFTASLVAGLVATTI 223
            GL P ++ G   T     S Y+  K     +  +F F      +H  ++L AG V+T +
Sbjct: 137 KGLVP-IIMGYFPTWMIYFSVYERSKKLYPRIFPSFDF-----ISHSASALTAGTVSTIL 190

Query: 224 CSPADVIKTRIM------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTIL 277
            +P  V+KTR+M          H+ ST          EGL   + G LPS   LG   + 
Sbjct: 191 TNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSL--LGLFHVA 248

Query: 278 I-FLVVEQLR 286
           I F + E+L+
Sbjct: 249 IHFPIYEKLK 258

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 200 GFDASEKKTHFTASLVAGLVATTICSPADVIKTRIM------NAHQHHESTLKVLSSSIR 253
            FD +E  T  + ++   L   T+C P DV KTR+       N   +++  L  L++ IR
Sbjct: 71  SFDDTEI-TALSGAMAGFLAGVTVC-PLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIR 128

Query: 254 NEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           +EG   +++G +P      P  ++ F V E+ +K
Sbjct: 129 DEGARGLYKGLVPIIMGYFPTWMIYFSVYERSKK 162

>Kwal_47.17321 s47 (351236..353881) [2646 bp, 881 aa] {ON} YPR021C -
           Hypothetical ORF [contig 210] FULL
          Length = 881

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 110/235 (46%), Gaps = 27/235 (11%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQTA---ARPKPTLFSMIQRILKNDGPLGLYSGL 71
           Y +  G V G +     +P+DL K R+Q     ++ K ++   + +I   +G  G+YSGL
Sbjct: 502 YNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFV-KIFSREGIRGIYSGL 560

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPAD 127
              ++        +    D++++ L+     N+ L  LP  +ISGA  G       NP +
Sbjct: 561 GPQLVGVAPEKAIKLTVNDYVRKLLMDE---NNRL-TLPLEIISGAAAGACQVIFTNPLE 616

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           +V IR+Q  S +   L ++   A+ GV    K  G+R L  GL   L+R V  +A    +
Sbjct: 617 IVKIRLQVRSEYADSLPKSQLTAL-GVV---KSLGLRGLYKGLVACLMRDVPFSAIYFPT 672

Query: 188 YDVCKHNLVTTFGFDASEKKTH--------FTASLVAGLVATTICSPADVIKTRI 234
           Y   K ++   F +D  +K            TA  +AG+ A  + +P DVIKTR+
Sbjct: 673 YAHLKRDI---FNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRL 724

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 86/193 (44%), Gaps = 22/193 (11%)

Query: 104 STLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRN---YKNAIDGVTRIFKE 160
            ++Y      ++G IG     P D+V  RMQ         +RN   YKN+ID   +IF  
Sbjct: 499 DSIYNFLLGSVAGCIGATAVYPIDLVKTRMQ--------AQRNFSQYKNSIDCFVKIFSR 550

Query: 161 EGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKT---HFTASLVAG 217
           EG+R + +GLGP LV      A ++   D  +  L+     D + + T      +   AG
Sbjct: 551 EGIRGIYSGLGPQLVGVAPEKAIKLTVNDYVRKLLM-----DENNRLTLPLEIISGAAAG 605

Query: 218 LVATTICSPADVIKTRIMNAHQHHESTLKVLSSS---IRNEGLGFMFRGWLPSFARLGPN 274
                  +P +++K R+    ++ +S  K   ++   +++ GL  +++G +    R  P 
Sbjct: 606 ACQVIFTNPLEIVKIRLQVRSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPF 665

Query: 275 TILIFLVVEQLRK 287
           + + F     L++
Sbjct: 666 SAIYFPTYAHLKR 678

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMI----QRILKNDGPLGLYSGLTASI 75
           GG+ G+ A  +T P D+ K RLQ   R   T ++ I    + ILK +     + G  A +
Sbjct: 703 GGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYTGILHAARTILKEERFKSFFKGGGARV 762

Query: 76  LRQCTYTTARFGCYDFIKENLLP 98
           LR           Y+ I +N+ P
Sbjct: 763 LRSSPQFGFTLAAYE-IFQNMFP 784

>Kwal_23.4731 s23 (836781..837725) [945 bp, 314 aa] {ON} YIL134W
           (FLX1) - mitochondrial inner membrane carrier protein
           for FAD [contig 5] FULL
          Length = 314

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 124/299 (41%), Gaps = 35/299 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ-----TAARPKPTLFSMIQRILKNDGPL--GLYSGLT 72
           G   G +  I THPLDL K+RLQ     T +     +   I R  K D  +    Y GL 
Sbjct: 20  GLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREAYRGLG 79

Query: 73  ASILRQCTYTTARFGCYDFIKENL---------------LPADK-LNSTLYLLPCSMISG 116
            +++         FG Y F K+ +                  DK +  +LYL   ++ SG
Sbjct: 80  VNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAAL-SG 138

Query: 117 AIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
                + NP  V+  R+ + S+        YK   DG+ +++  EG      GL P+L  
Sbjct: 139 LGTAILTNPIWVIKTRIMSTSSQASE---RYKTTWDGIRKVYAHEGFSGFWRGLVPSLF- 194

Query: 177 GVLMTASQVVSYDVCKHNLVTTFGFDASEKK---THFTASLVAGLVATTICSPADVIKTR 233
           GV   A     YD  +H      G    EK     +   + V+ +++ T   P  ++K+ 
Sbjct: 195 GVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPFQLLKSN 254

Query: 234 IMN--AHQHHEST--LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
           + +  A +  +S     ++ S  + EGL  +++G   +  R  P+T + F + E LR +
Sbjct: 255 LQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYENLRHW 313

>Kpol_1006.11 s1006 complement(44933..47716) [2784 bp, 927 aa] {ON}
           complement(44933..47716) [2784 nt, 928 aa]
          Length = 927

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 66/234 (28%), Positives = 100/234 (42%), Gaps = 23/234 (9%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQT--AARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           Y +  G + G +   I +P+DL K R+Q   +            +IL  +G  GLYSG+ 
Sbjct: 536 YNFALGSIAGCIGATIVYPIDLIKTRMQAQRSVTQYKNYIDCFAKILSREGLKGLYSGIG 595

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPADV 128
             ++        +    D++++NL   D  +  L  LP  +ISGA  G       NP ++
Sbjct: 596 PQLIGVAPEKAIKLTVNDYMRKNL--RDNRSGKL-TLPNEIISGASAGACQVVFTNPLEI 652

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY 188
           V IR+Q  S +      N          I K  G+  L  G    L+R V  +A    +Y
Sbjct: 653 VKIRLQVKSEYAA---ENIAKVQQTAFSIVKSLGITGLYKGAVACLLRDVPFSAIYFPTY 709

Query: 189 DVCKHNLVTTFGFDASEKKTH--------FTASLVAGLVATTICSPADVIKTRI 234
              K +L   F FD S+K             A  +AG+ A  + +P DVIKTR+
Sbjct: 710 AHLKRDL---FNFDPSDKTKRKSLKTWELLMAGGLAGMPAAFLTTPFDVIKTRL 760

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 49/184 (26%), Positives = 78/184 (42%), Gaps = 14/184 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQR----ILKNDGPLGLYSGLTASI 75
           G   G    + T+PL++ K+RLQ  +       + +Q+    I+K+ G  GLY G  A +
Sbjct: 636 GASAGACQVVFTNPLEIVKIRLQVKSEYAAENIAKVQQTAFSIVKSLGITGLYKGAVACL 695

Query: 76  LRQCTYTTARFGCYDFIKENLL---PADKLN----STLYLLPCSMISGAIGGFVGNPADV 128
           LR   ++   F  Y  +K +L    P+DK       T  LL    ++G    F+  P DV
Sbjct: 696 LRDVPFSAIYFPTYAHLKRDLFNFDPSDKTKRKSLKTWELLMAGGLAGMPAAFLTTPFDV 755

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY 188
           +  R+Q D          Y   +     I KEE  R    G G  ++R        + +Y
Sbjct: 756 IKTRLQIDPRKG---ETKYTGIVHAAQTILKEENFRSFFKGSGARVLRSSPQFGFTLAAY 812

Query: 189 DVCK 192
           ++ K
Sbjct: 813 ELFK 816

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 84/191 (43%), Gaps = 18/191 (9%)

Query: 105 TLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
           ++Y      I+G IG  +  P D++  RMQ   +        YKN ID   +I   EG++
Sbjct: 534 SIYNFALGSIAGCIGATIVYPIDLIKTRMQAQRS-----VTQYKNYIDCFAKILSREGLK 588

Query: 165 KLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVA---- 220
            L +G+GP L+      A ++   D  + NL      D    K      +++G  A    
Sbjct: 589 GLYSGIGPQLIGVAPEKAIKLTVNDYMRKNLR-----DNRSGKLTLPNEIISGASAGACQ 643

Query: 221 TTICSPADVIKTRIMNAHQH-HESTLKVLSSS---IRNEGLGFMFRGWLPSFARLGPNTI 276
               +P +++K R+    ++  E+  KV  ++   +++ G+  +++G +    R  P + 
Sbjct: 644 VVFTNPLEIVKIRLQVKSEYAAENIAKVQQTAFSIVKSLGITGLYKGAVACLLRDVPFSA 703

Query: 277 LIFLVVEQLRK 287
           + F     L++
Sbjct: 704 IYFPTYAHLKR 714

>Skud_5.165 Chr5 complement(255149..256048) [900 bp, 299 aa] {ON}
           YER053C (REAL)
          Length = 299

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 124/283 (43%), Gaps = 28/283 (9%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           +GGI+AC  TH    PLDL K RLQ   +   +     + I+ N+G   +Y+G  A+ + 
Sbjct: 22  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLGGFRSIIANEGWRKVYTGFGATFIG 81

Query: 78  QCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDS 137
                  ++G Y++ K           T+YL+  S  +  +   +  P + + ++ Q  +
Sbjct: 82  YSLQGAGKYGGYEYFKHVYSSWLTPGVTVYLM-ASATAEFLADIMLCPFEAIKVKQQ--T 138

Query: 138 AHEPHLRRNYKNAIDGVTRIFKEE-GVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLV 196
              P       N IDG  +++ E  G++    G+ P   R +  T  +  S++     + 
Sbjct: 139 TMPPFCN----NVIDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIY 194

Query: 197 TTFGFDASEKKTHFTA------SLVAGLVATTICS----PADVIKTRIMNAHQHHESTLK 246
           +       +KK   TA      S V G +A  +C+    PADV+ ++I +  + +ES + 
Sbjct: 195 SVL----PKKKEEMTALQQISISFVGGYLAGILCAAVSHPADVMVSKINSERKANES-MS 249

Query: 247 VLSSSIRNE-GLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
           V S  I  + G   ++ G +     +G  T   +L+ +  + Y
Sbjct: 250 VASKRIYQKIGFAGLWNGLMVRIVMIGTLTSFQWLIYDSFKAY 292

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 38/74 (51%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+   ++HP D+   ++ +  +   ++    +RI +  G  GL++GL   I+   
Sbjct: 217 GYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFAGLWNGLMVRIVMIG 276

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 277 TLTSFQWLIYDSFK 290

>YPL134C Chr16 complement(298571..299503) [933 bp, 310 aa] {ON}
           ODC1Mitochondrial inner membrane transporter, exports
           2-oxoadipate and 2-oxoglutarate from the mitochondrial
           matrix to the cytosol for lysine and glutamate
           biosynthesis and lysine catabolism; suppresses, in
           multicopy, an fmc1 null mutation
          Length = 310

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 130/307 (42%), Gaps = 36/307 (11%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQ----TAARPKPT-----------LFSMIQRIL 59
           Y +  G + G+   ++ +PLD+ K R+Q    T   P              +   + +I+
Sbjct: 13  YQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIV 72

Query: 60  KNDGPLGLYSGLTASILRQCTYTTARFGCYDFIK---ENLLPADKLNSTLYLLPCSMIS- 115
           K +G   LY G+T+ IL +      +F   D  +   + + P      T  +   S  S 
Sbjct: 73  KKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASA 132

Query: 116 GAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLV 175
           GA+  FV  P ++V IR+Q+ ++        +K  I+ V     + GV  L  GL   + 
Sbjct: 133 GAVEAFVVAPFELVKIRLQDVNSQ-------FKTPIEVVKNSVVKGGVLSLFNGLEATIW 185

Query: 176 RGVLMTASQV-VSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI 234
           R VL  A    + + + K  L+        + +    A  + G V   + +P DV+K+RI
Sbjct: 186 RHVLWNAGYFGIIFQIRK--LLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRI 243

Query: 235 MNAH---QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFL----VVEQLRK 287
             +    + +  +L  +    R EG   +++G+ P   RL P   L+ +    V++  R+
Sbjct: 244 QRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDFFRE 303

Query: 288 YEIGMHQ 294
            + G  Q
Sbjct: 304 VKYGKKQ 310

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 78/192 (40%), Gaps = 10/192 (5%)

Query: 106 LYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPH--------LRRNYKNAIDGVTRI 157
           +Y      I+G     V  P DVV  RMQ     + H           +Y   +D +T+I
Sbjct: 12  IYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKI 71

Query: 158 FKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASE--KKTHFTASLV 215
            K+EG   L  G+   ++      A +    D  +      F     E  +K    +   
Sbjct: 72  VKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGAS 131

Query: 216 AGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNT 275
           AG V   + +P +++K R+ + +   ++ ++V+ +S+   G+  +F G   +  R     
Sbjct: 132 AGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIWRHVLWN 191

Query: 276 ILIFLVVEQLRK 287
              F ++ Q+RK
Sbjct: 192 AGYFGIIFQIRK 203

>KAFR0J01740 Chr10 complement(332870..333742) [873 bp, 290 aa] {ON}
           Anc_2.227 YIL134W
          Length = 290

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 119/281 (42%), Gaps = 27/281 (9%)

Query: 22  VGGIVACIIT----HPLDLAKVRLQTAARPKPT----LFSMIQRIL--KNDGPLGLYSGL 71
           + GI +  IT    HPLDL K+RLQ     KPT     +  + R L   N G   LY GL
Sbjct: 18  ISGISSAFITSFVVHPLDLVKLRLQLLPVQKPTPRLNTYRYVLRSLFKDNKGISALYRGL 77

Query: 72  TASILRQCTYTTARFGCY----DFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPAD 127
             +++         FG Y    DF+K+N    +  N +L  L    +SG I   + NP  
Sbjct: 78  GINLIGNSVAWGLYFGFYRFSKDFLKQN---TNFNNDSLIYLTSGTMSGLITSLLTNPIW 134

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           V+  RM   +  +    R     +  V  I K E  +    GL P+     L++ SQ   
Sbjct: 135 VIKTRMMATNRSQAISNR---TILSSVKSIIKNESYKSFSKGLLPS-----LLSVSQGGI 186

Query: 188 YDVCKHNLVTTFGFDASEKKTHFT-ASLVAGLVATTICSPADVIKTRIMNAH-QHHESTL 245
           Y +    +   +G +   K       S  + +V+ +I  P  VIK+ + +   ++  S++
Sbjct: 187 YFMVYDTIKKKYGLENDFKNYQIILTSSCSKMVSVSIVYPLQVIKSNLQSPQGRNFHSSM 246

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
           K+++      GL  ++ G   +  +  P T L F + E  +
Sbjct: 247 KLMAQIYNLNGLHGLYSGLATNLFKAIPTTCLTFCLYENFK 287

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 89/187 (47%), Gaps = 10/187 (5%)

Query: 115 SGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKE-EGVRKLLTGLGPN 173
           S  I  FV +P D+V +R+Q     +P  R N    +  +  +FK+ +G+  L  GLG N
Sbjct: 23  SAFITSFVVHPLDLVKLRLQLLPVQKPTPRLNTYRYV--LRSLFKDNKGISALYRGLGIN 80

Query: 174 LVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTR 233
           L+   +        Y   K  L     F+ ++   + T+  ++GL+ + + +P  VIKTR
Sbjct: 81  LIGNSVAWGLYFGFYRFSKDFLKQNTNFN-NDSLIYLTSGTMSGLITSLLTNPIWVIKTR 139

Query: 234 IMNAHQ----HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYE 289
           +M  ++     + + L  + S I+NE      +G LPS   +    I  F+V + ++K +
Sbjct: 140 MMATNRSQAISNRTILSSVKSIIKNESYKSFSKGLLPSLLSVSQGGIY-FMVYDTIKK-K 197

Query: 290 IGMHQHF 296
            G+   F
Sbjct: 198 YGLENDF 204

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 14/181 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKP----TLFSMIQRILKNDGPLGLYSGLTASI 75
           G + G++  ++T+P+ + K R+    R +     T+ S ++ I+KN+       GL  S+
Sbjct: 119 GTMSGLITSLLTNPIWVIKTRMMATNRSQAISNRTILSSVKSIIKNESYKSFSKGLLPSL 178

Query: 76  LRQCTYTTARFGCYDFIKENL-LPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ 134
           L   +     F  YD IK+   L  D  N  + L   S  S  +   +  P  V+   +Q
Sbjct: 179 L-SVSQGGIYFMVYDTIKKKYGLENDFKNYQIIL--TSSCSKMVSVSIVYPLQVIKSNLQ 235

Query: 135 NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHN 194
           +         RN+ +++  + +I+   G+  L +GL  NL + +  T      Y+  K+ 
Sbjct: 236 SPQG------RNFHSSMKLMAQIYNLNGLHGLYSGLATNLFKAIPTTCLTFCLYENFKYI 289

Query: 195 L 195
           L
Sbjct: 290 L 290

>Smik_13.371 Chr13 complement(577886..578989) [1104 bp, 367 aa] {ON}
           YMR166C (REAL)
          Length = 367

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 93/225 (41%), Gaps = 16/225 (7%)

Query: 32  HPLDLAKVRLQTAARPKP--TLFSMIQRILKNDG-PLGLYSGLTASILRQCTYTTARFGC 88
           H LD  K R Q A   K    + S  + I   +G   GLY G  A++L         FG 
Sbjct: 72  HSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGT 131

Query: 89  YDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ-NDSAHEPHLRR-- 145
           Y++ K  ++   ++N T+  L    +   I  FV  P++V+  R+Q     + P  +   
Sbjct: 132 YEYTKRIMIEDWQINDTITHLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGY 191

Query: 146 NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASE 205
           NY N  + +  + KEEG R L  G    L R +  +A Q   Y+  +      F  +  +
Sbjct: 192 NYSNLRNAIKTVIKEEGARSLFFGYKATLARDLPFSALQFAFYEKFRQ---LAFKMEKKD 248

Query: 206 KK-------THFTASLVAGLVATTICSPADVIKTRIMNAHQHHES 243
            K               AG +A  I +P DV+KTR+       +S
Sbjct: 249 DKGEELSIPNEIITGACAGGLAGIITTPMDVVKTRVQTQQPSTQS 293

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 87/211 (41%), Gaps = 31/211 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLF----------SMIQRILKNDGPLGLYS 69
           G +G  ++  +  P ++ K RLQ   R     F          + I+ ++K +G   L+ 
Sbjct: 155 GFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGARSLFF 214

Query: 70  GLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLL--PCSMISGA----IGGFVG 123
           G  A++ R   ++  +F  Y+  ++     +K +     L  P  +I+GA    + G + 
Sbjct: 215 GYKATLARDLPFSALQFAFYEKFRQLAFKMEKKDDKGEELSIPNEIITGACAGGLAGIIT 274

Query: 124 NPADVVNIRMQND----------SAHEPHLRRNYKNAID-----GVTRIFKEEGVRKLLT 168
            P DVV  R+Q            S   PH+  +   A+       +  +++ EGV    +
Sbjct: 275 TPMDVVKTRVQTQQPSTQSNKAYSVLHPHVTNSRPAALSNSISLSLRTVYQSEGVLGFFS 334

Query: 169 GLGPNLVRGVLMTASQVVSYDVCKHNLVTTF 199
           G+GP  V   + ++  ++ Y +    L  T 
Sbjct: 335 GVGPRFVWTSVQSSIMLLLYQMTLRGLGKTL 365

>TDEL0B05500 Chr2 complement(977696..978595) [900 bp, 299 aa] {ON}
           Anc_8.115 YPR011C
          Length = 299

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 129/299 (43%), Gaps = 49/299 (16%)

Query: 18  WYGGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRILKNDGPLGLYSGLTAS 74
           W GG+ G V+  +  P +  K+ LQ   +       LFS I ++ + +G  GL+ G   +
Sbjct: 10  WAGGIAGAVSRTVVSPFERVKILLQVQNSTTAYNQGLFSAIGQVYREEGLKGLFRGNGLN 69

Query: 75  ILRQCTYTTARFGCYDFIKENLLPAD-----KLNSTLYLLPCSMISGAIGGFVGNPADVV 129
            +R   Y+  +F  Y+  K++L   D     +LN+   L   ++  GA       P D+V
Sbjct: 70  CIRIFPYSAVQFVVYEACKKHLFHVDGAQGQQLNNWQRLFGGALCGGA-SVVATYPLDLV 128

Query: 130 NIRMQNDSAHEPHLRRNYKNAI------DGVTRIFKEEGVRKLLTGLGPNLVRGVLMTAS 183
             R+   +A    L ++  ++I      + ++RI++EEG  K        L RGV  T+ 
Sbjct: 129 RTRLSIQTASLQKLHKSKASSIKPPGVWELLSRIYREEGNIK-------GLYRGVWPTSL 181

Query: 184 QVVSYDVCKHNLVTTFGFDASEKKTHFTAS------------LVAGLVATTICSPADVIK 231
            VV Y            F   E+   +T               ++G VA TI  P D+++
Sbjct: 182 GVVPY--------VALNFAVYEQLKEWTPQNDLSNFYLLCMGAISGGVAQTITYPFDLLR 233

Query: 232 TRI----MNAHQ---HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
            R     M  ++   H+ S    L +  + EGL   ++G   +  ++ P+T + +LV E
Sbjct: 234 RRFQVLAMGGNELGFHYSSVTDALVTIGKTEGLAGYYKGLTANLFKVVPSTAVSWLVYE 292

 Score = 72.0 bits (175), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 88/191 (46%), Gaps = 16/191 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRL--QTAARPK-----------PTLFSMIQRILKNDGPL- 65
           G + G  + + T+PLDL + RL  QTA+  K           P ++ ++ RI + +G + 
Sbjct: 111 GALCGGASVVATYPLDLVRTRLSIQTASLQKLHKSKASSIKPPGVWELLSRIYREEGNIK 170

Query: 66  GLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNP 125
           GLY G+  + L    Y    F  Y+ +KE   P + L S  YLL    ISG +   +  P
Sbjct: 171 GLYRGVWPTSLGVVPYVALNFAVYEQLKE-WTPQNDL-SNFYLLCMGAISGGVAQTITYP 228

Query: 126 ADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQV 185
            D++  R Q  +     L  +Y +  D +  I K EG+     GL  NL + V  TA   
Sbjct: 229 FDLLRRRFQVLAMGGNELGFHYSSVTDALVTIGKTEGLAGYYKGLTANLFKVVPSTAVSW 288

Query: 186 VSYDVCKHNLV 196
           + Y+V    +V
Sbjct: 289 LVYEVVTEAMV 299

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 88/192 (45%), Gaps = 22/192 (11%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPN 173
           I+GA+   V +P + V I +Q  ++   +     +     + ++++EEG++ L  G G N
Sbjct: 14  IAGAVSRTVVSPFERVKILLQVQNSTTAY----NQGLFSAIGQVYREEGLKGLFRGNGLN 69

Query: 174 LVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH---FTASLVAGLVATTICSPADVI 230
            +R    +A Q V Y+ CK +L    G    +       F  +L  G  +     P D++
Sbjct: 70  CIRIFPYSAVQFVVYEACKKHLFHVDGAQGQQLNNWQRLFGGALCGG-ASVVATYPLDLV 128

Query: 231 KTR-------IMNAHQHHESTLK------VLSSSIRNEG-LGFMFRGWLPSFARLGPNTI 276
           +TR       +   H+   S++K      +LS   R EG +  ++RG  P+   + P   
Sbjct: 129 RTRLSIQTASLQKLHKSKASSIKPPGVWELLSRIYREEGNIKGLYRGVWPTSLGVVPYVA 188

Query: 277 LIFLVVEQLRKY 288
           L F V EQL+++
Sbjct: 189 LNFAVYEQLKEW 200

>YER053C Chr5 complement(258737..259639) [903 bp, 300 aa] {ON}
           PIC2Mitochondrial phosphate carrier, imports inorganic
           phosphate into mitochondria; functionally redundant with
           Mir1p but less abundant than Mir1p under normal
           conditions; expression is induced at high temperature
          Length = 300

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/280 (22%), Positives = 123/280 (43%), Gaps = 22/280 (7%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           +GGI+AC  TH    PLDL K RLQ   +   +     ++I+ N+G   +Y+G  A+ + 
Sbjct: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVG 82

Query: 78  QCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDS 137
                  ++G Y++ K           T+YL+  S  +  +   +  P + + ++ Q  +
Sbjct: 83  YSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLM-ASATAEFLADIMLCPFEAIKVKQQ--T 139

Query: 138 AHEPHLRRNYKNAIDGVTRIFKEE-GVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLV 196
              P       N +DG  +++ E  G++    G+ P   R +  T  +  S++     + 
Sbjct: 140 TMPPFCN----NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIY 195

Query: 197 TTFGFDASEKKT--HFTASLVAGLVATTICS----PADVIKTRIMNAHQHHESTLKVLSS 250
           +       E       + S V G +A  +C+    PADV+ ++I N+ +    ++ V S 
Sbjct: 196 SVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKI-NSERKANESMSVASK 254

Query: 251 SIRNEGLGF--MFRGWLPSFARLGPNTILIFLVVEQLRKY 288
            I  + +GF  ++ G +     +G  T   +L+ +  + Y
Sbjct: 255 RIYQK-IGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAY 293

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 38/74 (51%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+   ++HP D+   ++ +  +   ++    +RI +  G  GL++GL   I+   
Sbjct: 218 GYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIG 277

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 278 TLTSFQWLIYDSFK 291

>Kpol_376.10 s376 (16815..17729) [915 bp, 304 aa] {ON}
           (16815..17729) [915 nt, 305 aa]
          Length = 304

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 126/290 (43%), Gaps = 25/290 (8%)

Query: 8   SSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGL 67
           + NA V      G  GGI   ++  P D  KVRLQT+  P  T  ++I+ ++KN+G  G 
Sbjct: 19  NDNARVFKDLLGGTAGGIAQVLVGQPFDTTKVRLQTSTTPT-TATTVIRNLIKNEGLKGF 77

Query: 68  YSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVG 123
           Y G    ++      + +FGC + +K      +   ++   LP   +SG +GG    F+ 
Sbjct: 78  YKGTLTPLVGVGACVSIQFGCNEAMKRYFHAKNNDGASTLRLPQYYMSGFVGGVVNAFLA 137

Query: 124 NPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTAS 183
           +P + V IR+Q  ++   +    +K  ID + ++  + G   L+ GL P ++R      +
Sbjct: 138 SPIEHVRIRLQTQTSSGANAE--FKGPIDCIKKLRAQGG---LMRGLVPTMIREAHGCGT 192

Query: 184 QVVSYDVCKHNLVTTFGFDASEKKTHFTAS---LVAGLVATTI---CSPADVIKTRIMNA 237
             + Y+      +     +   K+T   A+   L   L  TT+     P DVIK+ I   
Sbjct: 193 YFLVYEALVAREI-----NKGLKRTDIAATKLCLFGALSGTTLWLMVYPLDVIKSVIQTD 247

Query: 238 HQHHESTLKVLSSSIRN----EGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           +  +      + +  RN     GL   F+G+ P+  R  P     F   E
Sbjct: 248 NIKNPKFGNNIPTVARNIYKRGGLNAFFKGFGPTMLRAAPVNGATFATFE 297

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 83/196 (42%), Gaps = 16/196 (8%)

Query: 5   KSESSNAVVKYPWWY--GGVGGIVACIITHPLDLAKVRLQT--AARPKPTLFSMIQRILK 60
           K+    + ++ P +Y  G VGG+V   +  P++  ++RLQT  ++         I  I K
Sbjct: 109 KNNDGASTLRLPQYYMSGFVGGVVNAFLASPIEHVRIRLQTQTSSGANAEFKGPIDCIKK 168

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDF-----IKENLLPADKLNSTLYLLPCSMIS 115
                GL  GL  +++R+       F  Y+      I + L   D   + L L     +S
Sbjct: 169 LRAQGGLMRGLVPTMIREAHGCGTYFLVYEALVAREINKGLKRTDIAATKLCLF--GALS 226

Query: 116 GAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTR-IFKEEGVRKLLTGLGPNL 174
           G     +  P DV+   +Q D+   P     + N I  V R I+K  G+     G GP +
Sbjct: 227 GTTLWLMVYPLDVIKSVIQTDNIKNPK----FGNNIPTVARNIYKRGGLNAFFKGFGPTM 282

Query: 175 VRGVLMTASQVVSYDV 190
           +R   +  +   ++++
Sbjct: 283 LRAAPVNGATFATFEL 298

>ZYRO0B00396g Chr2 (24056..24967) [912 bp, 303 aa] {ON} similar to
           uniprot|P32331 Saccharomyces cerevisiae YPR058W YMC1
           Putative mitochondrial inner membrane transporter member
           of the mitochondrial carrier (MCF) family
          Length = 303

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 121/276 (43%), Gaps = 21/276 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G   G+   ++  P D+ KVRLQT  R   T F++I+ ++KN+G  G Y G  A +    
Sbjct: 30  GTFSGVAQVLVGQPFDITKVRLQTH-RGHTTAFNVIKDLIKNEGFAGFYKGTLAPLAGVG 88

Query: 80  TYTTARFGCYDFIKENLLPADKLNSTLYLL----PCSMISGAIGGFVGNPADVVNIRMQN 135
              + +FG  + +K      +   +    L     C  +SGA   F+  P + V IR+Q 
Sbjct: 89  ACVSCQFGVNEAMKRYFHARNGSKTQPLTLDQYYACGAVSGAANAFLATPIEHVRIRLQL 148

Query: 136 DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD-VCKHN 194
                      Y+ AID   ++ K+    KL+ GL   L+R         ++Y+ +C  N
Sbjct: 149 QK--RALASSEYRGAIDCTKKLIKQG---KLMRGLPATLLRTSHGFGIYFLTYEYLC--N 201

Query: 195 LVTTFGFDASEKKTHFTASL--VAGLVATTICSPADVIKTRIMNAHQ----HHESTLKVL 248
           L    G    +  T        +AG +  ++  P DV+K+ +M A +     H +T+  +
Sbjct: 202 LEAARGIKKPDIPTWRVCGFGAIAGALFWSLTYPFDVVKS-VMQADRLTNPQHGNTIWQV 260

Query: 249 SSSIRNEGLGFMF-RGWLPSFARLGPNTILIFLVVE 283
           + ++  EG   +F +G+ P+  R  P     F   E
Sbjct: 261 TKTLYKEGGARVFVKGFTPTILRSLPVNGATFAAFE 296

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 78/184 (42%), Gaps = 24/184 (13%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT-----LFSMIQRILKNDGPLGLYSGLTAS 74
           G V G     +  P++  ++RLQ   R   +          ++++K      L  GL A+
Sbjct: 125 GAVSGAANAFLATPIEHVRIRLQLQKRALASSEYRGAIDCTKKLIKQGK---LMRGLPAT 181

Query: 75  ILRQCTYTTARFGCYDFIKE---NLLPADKLNS----TLYLLPCSMISGAIGGFVGNPAD 127
           +LR    T+  FG Y    E   NL  A  +      T  +     I+GA+   +  P D
Sbjct: 182 LLR----TSHGFGIYFLTYEYLCNLEAARGIKKPDIPTWRVCGFGAIAGALFWSLTYPFD 237

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTR-IFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
           VV   MQ D    P     + N I  VT+ ++KE G R  + G  P ++R + +  +   
Sbjct: 238 VVKSVMQADRLTNPQ----HGNTIWQVTKTLYKEGGARVFVKGFTPTILRSLPVNGATFA 293

Query: 187 SYDV 190
           +++V
Sbjct: 294 AFEV 297

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 212 ASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARL 271
           A   +G+    +  P D+ K R +  H+ H +   V+   I+NEG    ++G L   A +
Sbjct: 29  AGTFSGVAQVLVGQPFDITKVR-LQTHRGHTTAFNVIKDLIKNEGFAGFYKGTLAPLAGV 87

Query: 272 GPNTILIFLVVEQLRKY 288
           G      F V E +++Y
Sbjct: 88  GACVSCQFGVNEAMKRY 104

>TPHA0L00700 Chr12 (131597..132820) [1224 bp, 407 aa] {ON} Anc_7.133
           YIL006W
          Length = 407

 Score = 73.9 bits (180), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/309 (23%), Positives = 130/309 (42%), Gaps = 49/309 (15%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTA-------ARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           G V G  + I+  PLD+ K RLQ         +R    L   I  I+K++G LGLY G+ 
Sbjct: 105 GAVAGFFSGILVCPLDVTKTRLQAQGLQSAGKSRYYNGLIGTINTIVKDEGILGLYKGIG 164

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNST-LYLLPCSMISGAIGGFVGNPADVVNI 131
             ++         F  Y+  K++  P    NS  L     ++ +G++   + NP  V+  
Sbjct: 165 PILMGYLPSWMIYFSIYEVSKDSF-PKIFPNSVFLTHFFSALTAGSVSTILTNPIWVIKT 223

Query: 132 RM--QNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
           R+  QND         +YKN ID   +I+K+EG +    GL P+L  G+     Q   ++
Sbjct: 224 RLMLQNDIGKN---STHYKNTIDAFIKIYKQEGPKAFYAGLLPSLF-GLFHVGIQFPIFE 279

Query: 190 VCKHNLVTTFGFD-------------ASEKKTHFT-------------ASLVAGLVATTI 223
               NL TTF +              AS K    T             AS ++ ++A+ +
Sbjct: 280 ----NLKTTFKYKTVKISEEIDNNHGASTKNLEPTNTNSTINLDRLIMASCLSKMIASLV 335

Query: 224 CSPADVIKTRIMNAHQHHEST----LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIF 279
             P ++++TR+        S     + ++  +   EG    + G+  +  R  P +++  
Sbjct: 336 TYPHEILRTRMQLKSNLPPSVQRKIIPLIKKTYTKEGFKGFYSGFFVNLLRTVPASVITL 395

Query: 280 LVVEQLRKY 288
           +  E ++ +
Sbjct: 396 VTFEYVQNF 404

 Score = 68.2 bits (165), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 77/166 (46%), Gaps = 14/166 (8%)

Query: 114 ISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTG 169
           ISGA+ GF       P DV   R+Q          R Y   I  +  I K+EG+  L  G
Sbjct: 103 ISGAVAGFFSGILVCPLDVTKTRLQAQGLQSAGKSRYYNGLIGTINTIVKDEGILGLYKG 162

Query: 170 LGPNLVRGVLMTASQVVS-YDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPAD 228
           +GP ++ G L +     S Y+V K +      F  S   THF ++L AG V+T + +P  
Sbjct: 163 IGP-ILMGYLPSWMIYFSIYEVSKDSFPKI--FPNSVFLTHFFSALTAGSVSTILTNPIW 219

Query: 229 VIKTRIMNAHQ------HHESTLKVLSSSIRNEGLGFMFRGWLPSF 268
           VIKTR+M  +       H+++T+       + EG    + G LPS 
Sbjct: 220 VIKTRLMLQNDIGKNSTHYKNTIDAFIKIYKQEGPKAFYAGLLPSL 265

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 96/217 (44%), Gaps = 36/217 (16%)

Query: 10  NAVVKYPWWYGGVGGIVACIITHPLDLAKVRL-------QTAARPKPTLFSMIQRILKND 62
           N+V    ++     G V+ I+T+P+ + K RL       + +   K T+ + I +I K +
Sbjct: 194 NSVFLTHFFSALTAGSVSTILTNPIWVIKTRLMLQNDIGKNSTHYKNTIDAFI-KIYKQE 252

Query: 63  GPLGLYSGLTASI-----------LRQCTYTTARFGCYDFIKE----------NLLPADK 101
           GP   Y+GL  S+           + +   TT ++      +E          NL P + 
Sbjct: 253 GPKAFYAGLLPSLFGLFHVGIQFPIFENLKTTFKYKTVKISEEIDNNHGASTKNLEPTNT 312

Query: 102 LNSTL---YLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIF 158
            NST+    L+  S +S  I   V  P +++  RMQ  S   P ++R     I  + + +
Sbjct: 313 -NSTINLDRLIMASCLSKMIASLVTYPHEILRTRMQLKSNLPPSVQRK---IIPLIKKTY 368

Query: 159 KEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNL 195
            +EG +   +G   NL+R V  +   +V+++  ++ L
Sbjct: 369 TKEGFKGFYSGFFVNLLRTVPASVITLVTFEYVQNFL 405

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 48/105 (45%), Gaps = 13/105 (12%)

Query: 192 KHNLVTT------FGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIM-------NAH 238
           K NLV+        G + ++ K    +  VAG  +  +  P DV KTR+           
Sbjct: 78  KKNLVSNIKLKKMMGVELTDTKVIAISGAVAGFFSGILVCPLDVTKTRLQAQGLQSAGKS 137

Query: 239 QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           +++   +  +++ +++EG+  +++G  P      P+ ++ F + E
Sbjct: 138 RYYNGLIGTINTIVKDEGILGLYKGIGPILMGYLPSWMIYFSIYE 182

>TBLA0G02760 Chr7 complement(725291..728008) [2718 bp, 905 aa] {ON}
           Anc_8.129 YPR021C
          Length = 905

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 81/320 (25%), Positives = 130/320 (40%), Gaps = 54/320 (16%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQTA---ARPKPTLFSMIQRILKNDGPLGLYSGL 71
           Y +  G + G +     +P+DL K RLQ     ++ K + F  + +ILK +GP GLYSGL
Sbjct: 488 YNFSLGSIAGCIGATFVYPIDLIKTRLQAQRDLSKYKNS-FDCLIKILKVEGPKGLYSGL 546

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPAD 127
           +  ++        +    D ++ NL      N+    LP  +ISGA  G       NP +
Sbjct: 547 SPQLIGVAPEKAIKLTVNDKMRFNL---KNWNNGKLTLPLEVISGACAGTCQVIFTNPLE 603

Query: 128 VVNIRMQNDSAH-EPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
           +V IR+Q  S +   +L ++   AI    +I K+ G+  L  G+   L+R V  +A    
Sbjct: 604 IVKIRLQVKSEYANENLAKSQITAI----QIVKKLGLSGLYRGVTACLLRDVPFSAIYFP 659

Query: 187 SYDVCKHNLVT--------------------------------TFGFDASEKKTH--FTA 212
           +Y   K NL                                     F+ S  KT     A
Sbjct: 660 TYAHLKKNLFNFNINPDPIIDDPTLINQNSNTTNSTTNNNNSNPSKFNRSRLKTWELLVA 719

Query: 213 SLVAGLVATTICSPADVIKTRIMNAHQHHESTLK----VLSSSIRNEGLGFMFRGWLPSF 268
             +AG+ A  + +P DVIKTR+    +  E+  K     + + +R E     F+G     
Sbjct: 720 GGLAGIPAAFLTTPMDVIKTRLQMDPKKGETKYKGVFDAVRTILREESYKSFFKGSTARV 779

Query: 269 ARLGPNTILIFLVVEQLRKY 288
            R  P   +     E  +++
Sbjct: 780 LRSSPQFGVTLAAYELFKQF 799

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 45/192 (23%), Positives = 83/192 (43%), Gaps = 18/192 (9%)

Query: 104 STLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGV 163
           +++Y      I+G IG     P D++  R+Q            YKN+ D + +I K EG 
Sbjct: 485 NSIYNFSLGSIAGCIGATFVYPIDLIKTRLQAQRDLS-----KYKNSFDCLIKILKVEGP 539

Query: 164 RKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATT- 222
           + L +GL P L+      A ++   D  + NL      + +  K      +++G  A T 
Sbjct: 540 KGLYSGLSPQLIGVAPEKAIKLTVNDKMRFNLK-----NWNNGKLTLPLEVISGACAGTC 594

Query: 223 ---ICSPADVIKTRIMNAHQH-HESTLKVLSSSI---RNEGLGFMFRGWLPSFARLGPNT 275
                +P +++K R+    ++ +E+  K   ++I   +  GL  ++RG      R  P +
Sbjct: 595 QVIFTNPLEIVKIRLQVKSEYANENLAKSQITAIQIVKKLGLSGLYRGVTACLLRDVPFS 654

Query: 276 ILIFLVVEQLRK 287
            + F     L+K
Sbjct: 655 AIYFPTYAHLKK 666

>KAFR0H01000 Chr8 complement(182165..183073) [909 bp, 302 aa] {ON}
           Anc_3.348 YPR058W
          Length = 302

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 120/292 (41%), Gaps = 24/292 (8%)

Query: 5   KSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGP 64
           +++  N  V      G  GGI   ++  P D  KVR+QT++    T   +++ +LKN+G 
Sbjct: 15  ETKHDNTRVVKDLLAGTTGGIAQVLVGQPFDTTKVRVQTSST-NTTAVRVVKDLLKNEGV 73

Query: 65  LGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL---LPCSMISGAIGGF 121
           LG Y G    ++      + +FG  + +K      +    TL L     C +  G    F
Sbjct: 74  LGFYKGTLTPLIGVGACVSLQFGVNEAMKRLFRSTNNGIQTLSLSQYYTCGLAGGLTNSF 133

Query: 122 VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMT 181
           +  P + V IR+Q  +       R YK  +D + ++    G   L+ GL P L+R     
Sbjct: 134 LAAPIEHVRIRLQTQTGSGAG--REYKGPLDCIRKLKSHGG---LMRGLTPTLLREGHGC 188

Query: 182 ASQVVSYDVCKHNLVTTFGFDASEKKTHFTA------SLVAGLVATTICSPADVIKTRIM 235
            +  + Y+    N ++        K+T   A        ++G+    +  P DVIK+ + 
Sbjct: 189 GTYFLVYEALIANQIS-----QGTKRTDIPAWKLCTFGALSGVSLWIMIYPIDVIKSVMQ 243

Query: 236 NAHQHHESTLKVLSSSIRN----EGLGFMFRGWLPSFARLGPNTILIFLVVE 283
             +  +    K +SS  +N     GL    +G+ P+  R  P     F   E
Sbjct: 244 TDNLANPKYGKSISSVAKNIYAKNGLMGFLKGFGPTIVRAAPANGATFATFE 295

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 77/181 (42%), Gaps = 16/181 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQT-----AARPKPTLFSMIQRILKNDGPLGLYSGLTAS 74
           G  GG+    +  P++  ++RLQT     A R        I++ LK+ G  GL  GLT +
Sbjct: 124 GLAGGLTNSFLAAPIEHVRIRLQTQTGSGAGREYKGPLDCIRK-LKSHG--GLMRGLTPT 180

Query: 75  ILRQCTYTTARFGCYDFIKENLLPADKLNSTL---YLLPCSMISGAIGGFVGNPADVVNI 131
           +LR+       F  Y+ +  N +      + +    L     +SG     +  P DV+  
Sbjct: 181 LLREGHGCGTYFLVYEALIANQISQGTKRTDIPAWKLCTFGALSGVSLWIMIYPIDVIKS 240

Query: 132 RMQNDSAHEPHLRRNYKNAIDGVTR-IFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDV 190
            MQ D+   P     Y  +I  V + I+ + G+   L G GP +VR      +   ++++
Sbjct: 241 VMQTDNLANPK----YGKSISSVAKNIYAKNGLMGFLKGFGPTIVRAAPANGATFATFEL 296

Query: 191 C 191
            
Sbjct: 297 A 297

>Skud_4.136 Chr4 complement(242328..243251) [924 bp, 307 aa] {ON}
           YDL119C (REAL)
          Length = 307

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 81/317 (25%), Positives = 133/317 (41%), Gaps = 49/317 (15%)

Query: 3   GTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKND 62
            TKS +S+ ++      G  GG+ + +   PLDL K R+Q     K TL+  ++ I   D
Sbjct: 5   ATKSRNSSHLIG-----GFFGGLTSAVALQPLDLLKTRIQQDR--KATLWKNLKEI---D 54

Query: 63  GPLGLYSGLTASILRQCTYTTARFGCYDFIKENL--------LPADKLN------STLYL 108
            PL L+ G   S LR    +     C + ++ +L        L  D  N      S+L  
Sbjct: 55  NPLQLWRGTLPSALRTSIGSALYLSCLNVMRSSLAKNKHKVSLSVDGPNVVYNKSSSLPR 114

Query: 109 LPC--SMISGAIG----GFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEG 162
           L    ++++GA      G++  P  V+ +R ++          NY +  + +T I+ +EG
Sbjct: 115 LTMYENLLTGAFARGLVGYITMPITVIKVRYESTLF-------NYSSLNEAITHIYTKEG 167

Query: 163 VRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTF-----------GFDASEKKTHFT 211
           V     G G   +R        V+ Y+  K  L T             GF      T  T
Sbjct: 168 VSGFFRGFGATCLRDAPYAGLYVLLYEKSKQLLPTVLSTRFIHYNPEGGFTTYTSTTINT 227

Query: 212 ASLV-AGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFAR 270
            S V +  +ATT+ +P D IKTR+        ++ K  +S I+NE +  +F G      R
Sbjct: 228 ISAVLSASLATTVTAPFDTIKTRMQLEPSKFTNSFKTFTSIIKNESVLKLFSGLSMRLTR 287

Query: 271 LGPNTILIFLVVEQLRK 287
              +  + + + E+L K
Sbjct: 288 KALSAGIAWGIYEELVK 304

>CAGL0G08910g Chr7 complement(853693..854562) [870 bp, 289 aa] {ON}
           similar to uniprot|P40464 Saccharomyces cerevisiae
           YIL134w FLX1
          Length = 289

 Score = 72.8 bits (177), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 127/285 (44%), Gaps = 27/285 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ--TAARPKPTLFSMIQRILKNDGPLG--LYSGLTASI 75
           G   G V  +I HPLDL KVRLQ    +  K    ++   I+ +D  L   LY GLT ++
Sbjct: 15  GLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRELYRGLTVNL 74

Query: 76  LRQCTYTTARFGCYDFIKENLLP------ADKLNSTLYLLPCSMISGAIGGFVGNPADVV 129
           +         F  Y   K+ L+        DK  S+   L  S  SG +   + NP  V+
Sbjct: 75  VGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLTNPLWVI 134

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
             RM + +  +    +  ++ I       K +GV+ L  GL P LV GV   A     YD
Sbjct: 135 KTRMMSKANSDLTSMKVLRDLI-------KNDGVQGLWKGLVPALV-GVSQGALHFTCYD 186

Query: 190 VCKHNLVTTFGFDASEKKTHFTASL--VAGLVATTICSPADVIKTRIMNAHQHHESTLKV 247
             KH LV     D+ E     T ++  V+ +++T+   P  ++K+  + + Q  E+  K+
Sbjct: 187 TLKHKLVLK-NRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSN-LQSFQASENDFKL 244

Query: 248 LSSS----IRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
           L  S     R+  LGF ++G   +  R  P+T + F + E  + +
Sbjct: 245 LPLSKMIYSRSGLLGF-YKGLSANLLRSVPSTCITFCIYENFKSF 288

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 75/168 (44%), Gaps = 12/168 (7%)

Query: 17  WWY---GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTA 73
           W Y       G++  ++T+PL + K R+ + A    T   +++ ++KNDG  GL+ GL  
Sbjct: 111 WMYLSASASSGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLRDLIKNDGVQGLWKGLVP 170

Query: 74  SILRQCTYTTARFGCYDFIKENLLPADKLN---STLYLLPCSMISGAIGGFVGNPADVVN 130
           +++   +     F CYD +K  L+  ++ +   + L  +  + +S  +      P  ++ 
Sbjct: 171 ALV-GVSQGALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLK 229

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGV 178
             +Q+  A E   +      +     I+   G+     GL  NL+R V
Sbjct: 230 SNLQSFQASENDFK-----LLPLSKMIYSRSGLLGFYKGLSANLLRSV 272

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 2/78 (2%)

Query: 21  GVGGIVACIITHPLDLAKVRLQT--AARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQ 78
            V  +++    +P  L K  LQ+  A+     L  + + I    G LG Y GL+A++LR 
Sbjct: 212 SVSKMLSTSAVYPFQLLKSNLQSFQASENDFKLLPLSKMIYSRSGLLGFYKGLSANLLRS 271

Query: 79  CTYTTARFGCYDFIKENL 96
              T   F  Y+  K  L
Sbjct: 272 VPSTCITFCIYENFKSFL 289

>TPHA0C02010 Chr3 complement(451294..452202) [909 bp, 302 aa] {ON}
           Anc_8.445 YDL198C
          Length = 302

 Score = 73.2 bits (178), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 114/280 (40%), Gaps = 28/280 (10%)

Query: 24  GIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPL-------GLYSGLTASIL 76
           GI+   + HP+D    RL T      +L    + I K    L        LY GL  + +
Sbjct: 21  GIIEIGVFHPVDTISKRLMTNHSKVTSLGEFNKVIFKQHSELPFNKKFFTLYPGLGYAAV 80

Query: 77  RQCTYTTARFGCYDFIKENLLP----------ADKLNSTLYLLPCSMISGAIGGFVGNPA 126
            +      ++G   F+ + L             +K    L       I G IG  V  P 
Sbjct: 81  YKVLQRVYKYGGQPFVNDYLNKNYRSDFDNAFGEKTGKALRSATAGSIIG-IGEIVLLPF 139

Query: 127 DVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
           DV+ I+ Q +   E    R++        RI K+EG+  L  G G    R    + +   
Sbjct: 140 DVLKIKRQTNP--EAFRGRSF-------IRILKDEGIFNLYRGWGWTAARNAPGSFALFG 190

Query: 187 SYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMN-AHQHHESTL 245
                K  ++    +  +    +F +S+V    +  + +P DVIKTRI N + ++ ES L
Sbjct: 191 GNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNRSFENPESGL 250

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQL 285
            ++ ++I+NEG+   F+G  P     GP  +  F + + L
Sbjct: 251 TIVKNTIKNEGITAFFKGLTPKLLTTGPKLVFSFALAQSL 290

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 22  VGGIVACIITHPLDLAKVRLQTAARPKP-TLFSMIQRILKNDGPLGLYSGLTASIL 76
           VG   + I++ PLD+ K R+Q  +   P +  ++++  +KN+G    + GLT  +L
Sbjct: 219 VGASASLIVSAPLDVIKTRIQNRSFENPESGLTIVKNTIKNEGITAFFKGLTPKLL 274

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 80/209 (38%), Gaps = 13/209 (6%)

Query: 96  LLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVT 155
           + P DK  S    L  S  +G I   V +P D ++ R+  + +    L    K      +
Sbjct: 1   MAPNDKKQSGAARLLGSASAGIIEIGVFHPVDTISKRLMTNHSKVTSLGEFNKVIFKQHS 60

Query: 156 RIFKEEGVRKLLTGLGPNLVRGVLMT----ASQVVSYDVCKHNLVTTFGFDASEKKTHFT 211
            +   +    L  GLG   V  VL        Q    D    N  + F     EK     
Sbjct: 61  ELPFNKKFFTLYPGLGYAAVYKVLQRVYKYGGQPFVNDYLNKNYRSDFDNAFGEKTGKAL 120

Query: 212 ASLVAGLV---ATTICSPADVIK-TRIMNAHQHH-ESTLKVLSSSIRNEGLGFMFRGWLP 266
            S  AG +      +  P DV+K  R  N       S +++L    ++EG+  ++RGW  
Sbjct: 121 RSATAGSIIGIGEIVLLPFDVLKIKRQTNPEAFRGRSFIRIL----KDEGIFNLYRGWGW 176

Query: 267 SFARLGPNTILIFLVVEQLRKYEIGMHQH 295
           + AR  P +  +F      ++Y +G+  +
Sbjct: 177 TAARNAPGSFALFGGNAFAKEYILGLQDY 205

>NDAI0E01400 Chr5 complement(279960..280937) [978 bp, 325 aa] {ON}
           Anc_8.644
          Length = 325

 Score = 72.8 bits (177), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 3/159 (1%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G   GI+  I+  P +L K++LQ           +++  +K +G  GLY+GL ++I R  
Sbjct: 144 GASAGIIESIVIVPFELVKIKLQDVNCKFNGPVDVLKDTVKKNGIKGLYNGLESTIWRNG 203

Query: 80  TYTTARFGCYDFIKENLLPA--DKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDS 137
            +    FG    ++E LLP   +K +     L    I G +G  V  P DVV  R+Q+D+
Sbjct: 204 VWNAGYFGIIFQVRE-LLPTAKNKNDKNKNDLIAGFIGGTVGVMVNTPFDVVKSRIQSDA 262

Query: 138 AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
               +  R Y      V +I+ +EG R L  G  P ++R
Sbjct: 263 NDMVNGVRKYNWTWPSVVKIYNQEGFRALYKGFVPKVLR 301

 Score = 70.5 bits (171), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/323 (21%), Positives = 129/323 (39%), Gaps = 63/323 (19%)

Query: 14  KYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTL---------------------- 51
           +Y +  G + GI    + +PLD+ K R+Q    P P +                      
Sbjct: 12  RYQFMAGAIAGISELTVMYPLDVVKTRMQLQISP-PIMAAAAAGTSSSSTIPLSSSSKAA 70

Query: 52  -----------FSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIK---ENLL 97
                         + +I+K +G   LY G+++ +L +      +F C D  +   +NL 
Sbjct: 71  ASTISENYTGVIDCLSKIVKKEGFSRLYKGISSPMLMEAPKRATKFACNDEFQKLYKNLF 130

Query: 98  PADKLNSTLYLLPCSMISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRNYKNAIDG 153
              KL   +     S++SGA  G + +    P ++V I++Q+ +         +   +D 
Sbjct: 131 GETKLTQKI-----SILSGASAGIIESIVIVPFELVKIKLQDVNCK-------FNGPVDV 178

Query: 154 VTRIFKEEGVRKLLTGLGPNLVR-GVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTA 212
           +    K+ G++ L  GL   + R GV       + + V    L+ T      + K    A
Sbjct: 179 LKDTVKKNGIKGLYNGLESTIWRNGVWNAGYFGIIFQV--RELLPTAKNKNDKNKNDLIA 236

Query: 213 SLVAGLVATTICSPADVIKTRI-------MNAHQHHESTLKVLSSSIRNEGLGFMFRGWL 265
             + G V   + +P DV+K+RI       +N  + +  T   +      EG   +++G++
Sbjct: 237 GFIGGTVGVMVNTPFDVVKSRIQSDANDMVNGVRKYNWTWPSVVKIYNQEGFRALYKGFV 296

Query: 266 PSFARLGPNTILIFLVVEQLRKY 288
           P   RLGP   ++ +V   +  +
Sbjct: 297 PKVLRLGPGGAVLLVVFTNVMNF 319

>NDAI0G04660 Chr7 (1109224..1110156) [933 bp, 310 aa] {ON} Anc_2.621
          Length = 310

 Score = 72.8 bits (177), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 85/182 (46%), Gaps = 21/182 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILKNDGPLGLYSGL 71
           GG  G ++ +  + LD A+ RL   A+ K +        +  + ++ L +DG LGLY G 
Sbjct: 126 GGSAGGLSLLFVYSLDYARTRLAADAKSKKSGMPRKFNGILDVYKKTLNSDGILGLYRGF 185

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTL--YLLPCSM-ISGAIGGFVGNPADV 128
             S+     Y    FG YD +K  LL     NS L  +LL  ++ I+ +   +   P D 
Sbjct: 186 LPSVCGIMVYRGLYFGLYDSLKPVLLTGVLENSFLASFLLGWAVTITASTTSY---PLDT 242

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS- 187
           V  RM   S         YK A+D   +I  EEGV  L  G G N+ RGV   A+ V+S 
Sbjct: 243 VRRRMMMTSGQAI----KYKGALDCFKKIIAEEGVYSLFKGCGANIFRGV--AAAGVISL 296

Query: 188 YD 189
           YD
Sbjct: 297 YD 298

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 70/170 (41%), Gaps = 20/170 (11%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSA--HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S AI      P + V I MQN S    +  L   Y   +D   +    EG+     G  
Sbjct: 23  VSAAIAKTGAAPIERVKILMQNQSEMLKQGSLDTPYLGIVDCFKKTASHEGIISFWRGNT 82

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEK--KTHFTASLV----AGLVATTICS 225
            N++R      +Q +++   K  +   FG+   +   +  F  ++V    AG ++     
Sbjct: 83  ANVLR---YFPTQALNF-AFKDKIKAMFGYTKEKDGYRKWFVGNIVSGGSAGGLSLLFVY 138

Query: 226 PADVIKTRIMNAHQHHES--------TLKVLSSSIRNEGLGFMFRGWLPS 267
             D  +TR+    +  +S         L V   ++ ++G+  ++RG+LPS
Sbjct: 139 SLDYARTRLAADAKSKKSGMPRKFNGILDVYKKTLNSDGILGLYRGFLPS 188

>TBLA0B02440 Chr2 complement(564793..565713) [921 bp, 306 aa] {ON}
           Anc_3.348 YPR058W
          Length = 306

 Score = 72.8 bits (177), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 119/266 (44%), Gaps = 26/266 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GG+   ++  P D  KVRLQT+     ++  +++ +LK++GPLG Y G    ++   
Sbjct: 32  GTAGGVAQVLVGQPFDTTKVRLQTSTT-STSVADVVKNLLKHEGPLGFYKGTLTPLIGVG 90

Query: 80  TYTTARFGCYDFIKENLLP--ADKLNSTLYLLP---CSMISGAIGGFVGNPADVVNIRMQ 134
              + +FG  + +K        DK  STL LL    C +  G    F+ +P + V IR+Q
Sbjct: 91  ACVSVQFGVNEAMKRFFRQRNGDK-KSTLSLLQYYLCGVTGGVTNAFLASPIEHVRIRLQ 149

Query: 135 NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR------GVLMTASQVVSY 188
             ++   +    +K  +D + ++ K    + L+ GL P ++R         +    +++ 
Sbjct: 150 TQTSSGAN--AEFKGPLDCIKKLVKH---KSLMRGLTPTMLRESHGCGSYFLVYEAMIAR 204

Query: 189 DVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI----MNAHQHHEST 244
           D+  +NL  T     + K   + A  ++G     +  P DVIK+ I    +   ++  S 
Sbjct: 205 DIKFNNLQRT--EIPAWKLCSYGA--LSGTCLWLMVYPIDVIKSVIQTDTLKNPKYKNSM 260

Query: 245 LKVLSSSIRNEGLGFMFRGWLPSFAR 270
           L          GL   F+G+ P+  R
Sbjct: 261 LVATKQLYAKGGLSSFFKGFTPTMLR 286

>TDEL0H02160 Chr8 (367235..368149) [915 bp, 304 aa] {ON} Anc_7.228
           YER053C
          Length = 304

 Score = 72.8 bits (177), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 64/288 (22%), Positives = 124/288 (43%), Gaps = 25/288 (8%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           +GG++AC  TH    PLDL K RLQ   +   +     + I++N+G   +++G  A+ + 
Sbjct: 21  LGGVIACGPTHSAVTPLDLVKCRLQVNPKLYKSNVDGWKTIIRNEGFGKVFTGFGATAIG 80

Query: 78  QCTYTTARFGCYDFIK----ENLLP---ADKLNSTLYLLPCSMISGAIGGFVGNPADVVN 130
                  ++G Y+F K     N+L    A +  + +YL   S  +  I   +  P + + 
Sbjct: 81  YSLQGAGKYGGYEFFKHFYSNNVLSPELASRYTTGVYL-AASATAEFIADIMLCPFEAIK 139

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDV 190
           +R Q  +   P       N   G+++++  EG++    G+ P   R +  T  +  S++ 
Sbjct: 140 VRQQ--TTVPPFCN----NVFQGLSKVYSTEGLKGFYKGIVPLWFRQIPYTMVKFTSFEK 193

Query: 191 CKHNLVTTFGFDASEKK------THFTASLVAGLVATTICSPADVIKTRIMNAHQHHEST 244
               +        SE          FT   +AG++   +  PADV+ ++I +  +  ES 
Sbjct: 194 IVQAIYAKLPTPKSEMSPLQQISVSFTGGYLAGILCAIVSHPADVMVSKINSERKSGESM 253

Query: 245 LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGM 292
           +       +  G   ++ G +     +G  T   +L+ +   K +IG+
Sbjct: 254 MDASKRIYKVIGFNGLWNGLMVRIVMIGTLTSFQWLIYDSF-KVKIGL 300

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+  I++HP D+   ++ +  +   ++    +RI K  G  GL++GL   I+   
Sbjct: 222 GYLAGILCAIVSHPADVMVSKINSERKSGESMMDASKRIYKVIGFNGLWNGLMVRIVMIG 281

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 282 TLTSFQWLIYDSFK 295

>KLTH0F00330g Chr6 complement(27980..28891) [912 bp, 303 aa] {ON}
           similar to uniprot|P32331 Saccharomyces cerevisiae
           YPR058W YMC1 Putative mitochondrial inner membrane
           transporter member of the mitochondrial carrier (MCF)
           family
          Length = 303

 Score = 72.4 bits (176), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 119/273 (43%), Gaps = 21/273 (7%)

Query: 23  GGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYT 82
           GGI   ++  P D+ KVRLQT++    T F +I+ ++KN+G    Y G T  ++      
Sbjct: 33  GGIAQVLVGQPFDITKVRLQTSS-TSTTAFKVIKDLIKNEGVSAFYKGTTTPLIGVGLCV 91

Query: 83  TARFGCYD-----FIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDS 137
           +++FG  +     F ++N   +  L  + Y + C  +SG+   F+  P + V IR+Q  +
Sbjct: 92  SSQFGTNEAMKRYFHRKNNFQSPTLRLSEYYV-CGFVSGSANAFLATPIEHVRIRLQVQT 150

Query: 138 AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD--VCKHNL 195
             +      Y+ AID + ++  E    KL+ G  P + R         +SY+  +C    
Sbjct: 151 --KSLAEAEYRGAIDCIKKLLAEG---KLMRGFTPTISRTSHGFGVYFLSYETMICGERK 205

Query: 196 VTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQ-----HHESTLKVLSS 250
                 +    K     +L   L+   +  P DVIK+ +M   +     +  + ++V  +
Sbjct: 206 RGVARENIPAWKLCLFGALSGSLLWMMV-YPFDVIKS-VMQTDKLRKPVYGNNVVEVAKN 263

Query: 251 SIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
             R  G G   +G+ P+  R  P     F   E
Sbjct: 264 IYRERGAGAFLKGFGPTMLRSLPVNGATFTTFE 296

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 72/181 (39%), Gaps = 16/181 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ--TAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           G V G     +  P++  ++RLQ  T +  +      I  I K      L  G T +I R
Sbjct: 125 GFVSGSANAFLATPIEHVRIRLQVQTKSLAEAEYRGAIDCIKKLLAEGKLMRGFTPTISR 184

Query: 78  QCTYTTARFGCYDFIKENLLPADKLNSTLY-------LLPCSMISGAIGGFVGNPADVVN 130
               T+  FG Y    E ++  ++             L     +SG++   +  P DV+ 
Sbjct: 185 ----TSHGFGVYFLSYETMICGERKRGVARENIPAWKLCLFGALSGSLLWMMVYPFDVIK 240

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDV 190
             MQ D   +P       N ++    I++E G    L G GP ++R + +  +   ++++
Sbjct: 241 SVMQTDKLRKPVYG---NNVVEVAKNIYRERGAGAFLKGFGPTMLRSLPVNGATFTTFEM 297

Query: 191 C 191
            
Sbjct: 298 A 298

>TPHA0B01350 Chr2 complement(300788..301876) [1089 bp, 362 aa] {ON}
           Anc_7.467 YJR095W
          Length = 362

 Score = 73.2 bits (178), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 86/354 (24%), Positives = 124/354 (35%), Gaps = 77/354 (21%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAAR------PKPTLFSM 54
           MS  K+ SS A+       GG  G+   +  HPLD  KVR+Q   +        P     
Sbjct: 1   MSQKKNVSSPAI---NLVAGGTAGLFEALCCHPLDTIKVRMQIHKKISLGNIKNPGFLKT 57

Query: 55  IQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMI 114
              I +N+G + LY GL A ++        RF  Y+  +   L  DK    L     + I
Sbjct: 58  GSNIYRNEGFIALYKGLGAVVIGIIPKMAIRFSSYEQYRS--LLTDKSTGKLST-GNTFI 114

Query: 115 SGAIGGF-----VGNPADVVNIRMQNDSAHEPHLRR------------------------ 145
           +G   G      V NP +VV IR+Q      P  +                         
Sbjct: 115 AGVGAGITEAVIVVNPMEVVKIRLQAQHLAAPVKQMAQTVASPVTLAATSEGIVQTSAAT 174

Query: 146 ---------------------NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
                                 YKNAI     I KEEG   L  G+     R      + 
Sbjct: 175 TATAGAATSAATTTAATNAAPRYKNAIHAAYTIVKEEGAGTLYRGVSLTAARQATNQGAN 234

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHEST 244
              Y   K  L      +        +  LV+G +     +P D IKTR+    Q  +S 
Sbjct: 235 FTVYSKLKEYLTKKQNTEVLPSWQTSSIGLVSGAIGPFSNAPLDTIKTRL----QKDKSV 290

Query: 245 LKVLSSS-----------IRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
            K+ +SS           ++ EG+  +++G  P   R+ P   + F V E +RK
Sbjct: 291 SKIKTSSWKKIYDIGVQLVKEEGVAALYKGITPRVMRVAPGQAVTFTVYEFVRK 344

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 11/100 (11%)

Query: 16  PWWY----GGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRI----LKNDGP 64
           P W     G V G +      PLD  K RLQ   + ++ K + +  I  I    +K +G 
Sbjct: 255 PSWQTSSIGLVSGAIGPFSNAPLDTIKTRLQKDKSVSKIKTSSWKKIYDIGVQLVKEEGV 314

Query: 65  LGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNS 104
             LY G+T  ++R        F  Y+F+++ L  +  L S
Sbjct: 315 AALYKGITPRVMRVAPGQAVTFTVYEFVRKRLEDSGVLTS 354

>Smik_9.193 Chr9 (320132..321250) [1119 bp, 373 aa] {ON} YIL006W
           (REAL)
          Length = 373

 Score = 73.2 bits (178), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 125/289 (43%), Gaps = 32/289 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFS---------MIQRILKNDGPLGLYSG 70
           G   G ++ +   PLD+AK RLQ  A+   T F           +  I++++GP GLY G
Sbjct: 84  GAFAGFLSGVAVCPLDVAKTRLQ--AQGLQTKFENPYYKGILGTLSTIVRDEGPRGLYKG 141

Query: 71  LTASILRQCTYTTARFGCYDFIKE---NLLPADKLNSTLYLLPCSMIS-GAIGGFVGNPA 126
           L   +L         F  Y+F K+    + P     +      C+ I+ GA    + NP 
Sbjct: 142 LVPIVLGYFPTWMIYFSAYEFSKKFFYGIFPQFDFIAQ----SCAAITAGAASTTLTNPI 197

Query: 127 DVVNIR--MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
            VV  R  +Q++    P    +YK   D   +IF +EG + L  GL P+L+ G+   A  
Sbjct: 198 WVVKTRLMLQSNLGEHP---THYKGTFDAFRKIFSQEGYKALYAGLVPSLL-GLFHVAIH 253

Query: 185 VVSYDVCK---HNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHH 241
              Y+  K   H        ++   K    AS V+ ++A+ +  P ++++TR+       
Sbjct: 254 FPIYEDLKIRFHCYSREDNANSINLKRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIP 313

Query: 242 ESTLK----VLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
           +S  +    ++ ++   EGL   + G+  +  R  P + +  +  E  R
Sbjct: 314 DSIQRRLFPLVKATYAQEGLKGFYSGFSTNLVRTIPASAITLVSFEYFR 362

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 71/168 (42%), Gaps = 20/168 (11%)

Query: 114 ISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTG 169
           +SGA  GF+      P DV   R+Q            YK  +  ++ I ++EG R L  G
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTKFENPYYKGILGTLSTIVRDEGPRGLYKG 141

Query: 170 LGPNLVRGVLMTASQVVS-YDVCK---HNLVTTFGFDASEKKTHFTASLVAGLVATTICS 225
           L P +V G   T     S Y+  K   + +   F F A        A++ AG  +TT+ +
Sbjct: 142 LVP-IVLGYFPTWMIYFSAYEFSKKFFYGIFPQFDFIAQS-----CAAITAGAASTTLTN 195

Query: 226 PADVIKTRIM------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
           P  V+KTR+M          H++ T          EG   ++ G +PS
Sbjct: 196 PIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKIFSQEGYKALYAGLVPS 243

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 80/184 (43%), Gaps = 15/184 (8%)

Query: 23  GGIVACIITHPLDLAKVRL--QTAARPKPT----LFSMIQRILKNDGPLGLYSGLTASIL 76
            G  +  +T+P+ + K RL  Q+     PT     F   ++I   +G   LY+GL  S+L
Sbjct: 186 AGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKIFSQEGYKALYAGLVPSLL 245

Query: 77  RQCTYTTARFGCYDFIKENL---LPADKLNST--LYLLPCSMISGAIGGFVGNPADVVNI 131
               +    F  Y+ +K         D  NS     L+  S +S  I   V  P +++  
Sbjct: 246 -GLFHVAIHFPIYEDLKIRFHCYSREDNANSINLKRLIMASSVSKMIASAVTYPHEILRT 304

Query: 132 RMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
           RMQ  S     ++R     +      + +EG++   +G   NLVR +  +A  +VS++  
Sbjct: 305 RMQLKSDIPDSIQRRLFPLVKAT---YAQEGLKGFYSGFSTNLVRTIPASAITLVSFEYF 361

Query: 192 KHNL 195
           ++ +
Sbjct: 362 RNRM 365

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 216 AGLVATTICSPADVIKTRIMN-------AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSF 268
           AG ++     P DV KTR+          + +++  L  LS+ +R+EG   +++G +P  
Sbjct: 87  AGFLSGVAVCPLDVAKTRLQAQGLQTKFENPYYKGILGTLSTIVRDEGPRGLYKGLVPIV 146

Query: 269 ARLGPNTILIFLVVEQLRKYEIGMHQHF 296
               P  ++ F   E  +K+  G+   F
Sbjct: 147 LGYFPTWMIYFSAYEFSKKFFYGIFPQF 174

>YMR056C Chr13 complement(387315..388244) [930 bp, 309 aa] {ON}
           AAC1Mitochondrial inner membrane ADP/ATP translocator,
           exchanges cytosolic ADP for mitochondrially synthesized
           ATP; phosphorylated; Aac1p is a minor isoform while
           Pet9p is the major ADP/ATP translocator
          Length = 309

 Score = 72.4 bits (176), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 83/192 (43%), Gaps = 25/192 (13%)

Query: 15  YPWWY------GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILK 60
           Y  W+      GG  G ++ +  + LD A+ RL   AR   +        L  + ++ LK
Sbjct: 114 YAKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLK 173

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL--YLLPCSMISGAI 118
            DG LGLY G   S+L    Y    FG YD  K  LL      S +  +LL   +  GA 
Sbjct: 174 TDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMGA- 232

Query: 119 GGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGV 178
                 P D V  RM   S         Y  A+D + +I ++EG   L  G G N+ RGV
Sbjct: 233 -STASYPLDTVRRRMMMTSGQTI----KYDGALDCLRKIVQKEGAYSLFKGCGANIFRGV 287

Query: 179 LMTASQVVS-YD 189
              A+ V+S YD
Sbjct: 288 --AAAGVISLYD 297

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 64/168 (38%), Gaps = 16/168 (9%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSA--HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S AI      P + V + MQN      +  L   YK  +D   R    EG+     G  
Sbjct: 22  VSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSFWRGNT 81

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASL----VAGLVATTICSPA 227
            N++R     A      D  K  L      D   K   F  +L     AG ++       
Sbjct: 82  ANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAK--WFAGNLFSGGAAGGLSLLFVYSL 139

Query: 228 DVIKTRIMNAHQHHEST--------LKVLSSSIRNEGLGFMFRGWLPS 267
           D  +TR+    +  +ST        L V   +++ +GL  ++RG++PS
Sbjct: 140 DYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPS 187

>NCAS0A08210 Chr1 (1620689..1621615) [927 bp, 308 aa] {ON} Anc_2.621
          Length = 308

 Score = 72.4 bits (176), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 84/193 (43%), Gaps = 27/193 (13%)

Query: 15  YPWWY------GGVGGIVACIITHPLDLAKVRLQTAARP----KPTLFSMI----QRILK 60
           Y  W+      GG  G ++ +  + LD A+ RL   A+      P  F+ I    ++ L 
Sbjct: 113 YTKWFMGNVASGGCAGALSLLFVYSLDYARTRLAADAKSIKSGAPRKFNGILDVYKKTLF 172

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAI-- 118
            DG LGLY G   S++    Y    FG YD +K  LL     N+    LP  ++  A+  
Sbjct: 173 TDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSFENA---FLPSFLLGWAVTI 229

Query: 119 -GGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG 177
                  P D V  RM   S         YK AID   +I  +EGV  L  G G N+ RG
Sbjct: 230 SASTTSYPLDTVRRRMMMTSGQAVK----YKGAIDCFQQIVSQEGVYSLFKGCGANIFRG 285

Query: 178 VLMTASQVVS-YD 189
           V   A+ V+S YD
Sbjct: 286 V--AAAGVISLYD 296

>Kwal_23.3965 s23 complement(504354..505277) [924 bp, 307 aa] {ON}
           YGR096W - Hypothetical ORF [contig 255] FULL
          Length = 307

 Score = 72.4 bits (176), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 127/294 (43%), Gaps = 31/294 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT---LFSMIQRILKNDGPLGLYSGLTASIL 76
           G + GI A I+T PLD  K+RLQ     +     +    +R+++ +G   L+ G   ++ 
Sbjct: 21  GCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMA 80

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQND 136
               Y + +F  Y  + + LL   +L + ++      +SG        P DV+  R   +
Sbjct: 81  MYILYGSTQFTSYAILNK-LLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIAN 139

Query: 137 SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLV 196
            +      R     +     I++ EG R    G+  ++V   + T+S + +Y+  K    
Sbjct: 140 HS------RELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYESVKIFCE 193

Query: 197 TTFGFDASE-KKTHFTASLVAGLVATTICSPADVIKTRIM-----------------NAH 238
                D+S  +    +AS++AG+V+ TI  P D ++ R                    A+
Sbjct: 194 QRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAY 253

Query: 239 QHHEST--LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQ-LRKYE 289
           + + ST  L++    +  EGL  ++ G+    A+  P+T++   V E  LR+ E
Sbjct: 254 KSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWCLRRME 307

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 80/189 (42%), Gaps = 26/189 (13%)

Query: 112 SMISGAIGGF----VGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
           S+++G + G     V  P D + IR+Q   A+E      Y   +    R+ ++EGVR L 
Sbjct: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQ----YGGILVTFKRLVRQEGVRALW 72

Query: 168 TGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVA--TTICS 225
            G  P +   +L  ++Q  SY +    L           K+   A +  G+V   +  CS
Sbjct: 73  KGNVPAMAMYILYGSTQFTSYAILNKLL----------SKSQLPAQIHTGMVGALSGTCS 122

Query: 226 -----PADVIKTRIMNAHQHHESTLKVLSSSI-RNEGLGFMFRGWLPSFARLGPNTILIF 279
                P DV++TR +  H    ST+   +  I R+EG    F+G   S   +   T  I 
Sbjct: 123 AIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSIL 182

Query: 280 LVVEQLRKY 288
              E ++ +
Sbjct: 183 ATYESVKIF 191

>Skud_13.212 Chr13 complement(361929..362858) [930 bp, 309 aa] {ON}
           YMR056C (REAL)
          Length = 309

 Score = 72.4 bits (176), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 84/198 (42%), Gaps = 37/198 (18%)

Query: 15  YPWWY------GGVGGIVACIITHPLDLAKVRLQTAARPK--------PTLFSMIQRILK 60
           Y  W+      GG  G ++ +  + LD A+ RL   AR            L  + ++ LK
Sbjct: 114 YAKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSRLTLQRQFSGLLDVYKKTLK 173

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG 120
            DG LGLY G   S++    Y    FG YD  K  LL          +L  S I+  + G
Sbjct: 174 TDGVLGLYRGFMPSVVGIIVYRGLYFGLYDSFKPVLLTG--------VLESSFIASFLLG 225

Query: 121 FV--------GNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGP 172
           +V          P D V  RM   S         Y  A+D + +I ++EGV  L  G G 
Sbjct: 226 WVITVGASTASYPLDTVRRRMMMTSGQAI----KYNGAMDCLRKIVQQEGVYSLFKGCGA 281

Query: 173 NLVRGVLMTASQVVS-YD 189
           N+ RGV   A+ V+S YD
Sbjct: 282 NIFRGV--AAAGVISLYD 297

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/285 (22%), Positives = 113/285 (39%), Gaps = 29/285 (10%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAAR--PKPTLFSM---- 54
           MS T++++  +     +  GGV   +A     P++  K+ +Q       + +L S     
Sbjct: 1   MSQTETQTQKSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDSRYLGI 60

Query: 55  ---IQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPC 111
               +R  +++G +  + G TA++LR        F   D IK  L      +        
Sbjct: 61  VDCFKRTARHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSVLSYDRDRDGYAKWFAG 120

Query: 112 SMISGAIGG-----FVGNPADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRK 165
           ++ SG   G     FV    D    R+  D+      L+R +   +D   +  K +GV  
Sbjct: 121 NLFSGGAAGGLSLLFV-YSLDYARTRLAADARGSRLTLQRQFSGLLDVYKKTLKTDGVLG 179

Query: 166 LLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLV----AT 221
           L  G  P++V  ++        YD  K  L+T         ++ F AS + G V    A+
Sbjct: 180 LYRGFMPSVVGIIVYRGLYFGLYDSFKPVLLT------GVLESSFIASFLLGWVITVGAS 233

Query: 222 TICSPADVIKTRIMNAHQH---HESTLKVLSSSIRNEGLGFMFRG 263
           T   P D ++ R+M        +   +  L   ++ EG+  +F+G
Sbjct: 234 TASYPLDTVRRRMMMTSGQAIKYNGAMDCLRKIVQQEGVYSLFKG 278

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 63/168 (37%), Gaps = 16/168 (9%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSA--HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S AI      P + V + MQN      +  L   Y   +D   R  + EG+     G  
Sbjct: 22  VSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDSRYLGIVDCFKRTARHEGIVSFWRGNT 81

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASL----VAGLVATTICSPA 227
            N++R     A      D  K   V ++  D       F  +L     AG ++       
Sbjct: 82  ANVLRYFPTQALNFAFKDKIKS--VLSYDRDRDGYAKWFAGNLFSGGAAGGLSLLFVYSL 139

Query: 228 DVIKTRI--------MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
           D  +TR+        +   +     L V   +++ +G+  ++RG++PS
Sbjct: 140 DYARTRLAADARGSRLTLQRQFSGLLDVYKKTLKTDGVLGLYRGFMPS 187

>KLLA0D14036g Chr4 complement(1203522..1204817) [1296 bp, 431 aa]
           {ON} similar to uniprot|P40556 Saccharomyces cerevisiae
           YIL006W Pvruvate transporter of the mitochondrial inner
           membrane member of the mitochondrial carrier family has
           putative mouse and human orthologs
          Length = 431

 Score = 73.2 bits (178), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 130/311 (41%), Gaps = 45/311 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAA--------RPKPT------------LFSMIQRIL 59
           G + G +A +I  PLD+AK RLQ           RP  +            ++  +  I+
Sbjct: 110 GALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTTIV 169

Query: 60  KNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPC--SMISGA 117
           +++   GLY G+   +L         F  Y+  K  L      N++ +L     ++ +GA
Sbjct: 170 RDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCK--LSYPRYFNNSEFLSHSMSALTAGA 227

Query: 118 IGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG 177
           I   + NP  VV  R+   S        +YKN +D   +I+K EG++   +GL P+L  G
Sbjct: 228 ISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSLF-G 286

Query: 178 VLMTASQVVSYDVCKHNL--------------VTTFGFDASEKKTHF------TASLVAG 217
           +L  A     Y+  K  L              V       +   T+F       AS  + 
Sbjct: 287 LLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVASCGSK 346

Query: 218 LVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTIL 277
           ++A+T+  P ++++TR+        S   ++ ++   EG+   + G+L +  R  P + +
Sbjct: 347 MIASTLTYPHEILRTRLQLKSDMKPSIKSIIRTTYAKEGIRGFYSGFLTNMFRTVPASAI 406

Query: 278 IFLVVEQLRKY 288
             +  E  RK+
Sbjct: 407 TLVSFEYFRKH 417

>KNAG0L01390 Chr12 complement(247217..248143) [927 bp, 308 aa] {ON}
           Anc_7.228 YER053C
          Length = 308

 Score = 72.4 bits (176), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 64/286 (22%), Positives = 121/286 (42%), Gaps = 26/286 (9%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           +GG+VAC  TH    PLDL K RLQ +     +    ++ IL  +G   L++G+ A+ + 
Sbjct: 23  LGGVVACGPTHSSVTPLDLVKCRLQVSPGLYKSNIQGMRDILSKEGFAKLFTGVGATFIG 82

Query: 78  QCTYTTARFGCYDFIK----ENLLPADKL-----NSTLYLLPCSMISGAIGGFVGNPADV 128
                  ++G Y++ K    + L   D        ++LYLL  S  +  I   +  P + 
Sbjct: 83  YSLQGAGKYGGYEYFKHFYSQTLCGGDATRIHNNRTSLYLLA-SATAEFIADIMLCPFEA 141

Query: 129 VNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY 188
           + ++ Q        +     N  +G+++ +K EG+     G+ P   R +  T  +  S+
Sbjct: 142 IKVKQQTT------IPSFCNNVWEGLSKTYKAEGLMSFYKGIAPLWCRQIPYTMCKFTSF 195

Query: 189 DVCKHNLVTTFGFDASEKK--THFTASLVAGLVATTICS----PADVIKTRIMNAHQHHE 242
           +     + +      SE       + S V G +A  +C+    PADV+ ++I N     +
Sbjct: 196 ERIVEYIYSKLPKKKSEMNPLQQISVSFVGGYLAGILCAAVSHPADVMVSKINNERVMGQ 255

Query: 243 STLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
           S +    +  +  G   ++ G       +G  T   +L+ +  + Y
Sbjct: 256 SMMDASRAIYKRIGFVGLWNGLPVRIVMIGTLTSFQWLIYDSFKAY 301

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+   ++HP D+   ++        ++    + I K  G +GL++GL   I+   
Sbjct: 226 GYLAGILCAAVSHPADVMVSKINNERVMGQSMMDASRAIYKRIGFVGLWNGLPVRIVMIG 285

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 286 TLTSFQWLIYDSFK 299

>NCAS0C04400 Chr3 complement(902138..903088) [951 bp, 316 aa] {ON} 
          Length = 316

 Score = 72.4 bits (176), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 129/302 (42%), Gaps = 46/302 (15%)

Query: 13  VKYPWWY----GGVGGIVACIITHPLDLAKVRLQ-----------TAARPK----PTLFS 53
           VK P+ Y    G V G+   I+ +PLD+ K R Q           + A PK     ++ S
Sbjct: 9   VKLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILS 68

Query: 54  MIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLN---STLYLLP 110
            + +ILK +G   LY G++  +L +      +F   +  ++ ++   KL    ST+ LL 
Sbjct: 69  CLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLL- 127

Query: 111 CSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGL 170
               +G     +  P ++V IR+Q+  +       +Y++ I     I + +G+  +  G 
Sbjct: 128 AGTFAGITESLIVVPFELVKIRLQDAQS-------DYRSPIRCTRTIIENQGLFGIYAGF 180

Query: 171 GPNLVRGVLMTAS------QVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTIC 224
              + R  +  AS      QV  + + +    T F       +  F    +AG ++  + 
Sbjct: 181 ESTIWRNTIWNASYFGLIFQVKKF-IPRAKSTTKF----QGIRNDFLVGAIAGCMSCFLS 235

Query: 225 SPADVIKTRIMNAHQHHES-----TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIF 279
            P DV+KTR+  + +           + +    R EG+  +++G LP   R GP   L+ 
Sbjct: 236 VPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLL 295

Query: 280 LV 281
           +V
Sbjct: 296 VV 297

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 85/193 (44%), Gaps = 20/193 (10%)

Query: 112 SMISGAIGGF----VGNPADVVNIRMQ---------NDSAHEPHLRRNYKNAIDGVTRIF 158
             ISGA+ G     +  P DVV  R Q           S   P  +  + + +  +++I 
Sbjct: 16  QFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPK-QPEHSSILSCLSKIL 74

Query: 159 KEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGL 218
           KEEG + L  G+ P L+  V   A +  S +  +  ++  F            A   AG+
Sbjct: 75  KEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGI 134

Query: 219 VATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTIL- 277
             + I  P +++K R+ +A   + S ++   + I N+GL  ++ G+  +  R   NTI  
Sbjct: 135 TESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIWR---NTIWN 191

Query: 278 --IFLVVEQLRKY 288
              F ++ Q++K+
Sbjct: 192 ASYFGLIFQVKKF 204

>YIL006W Chr9 (344062..345183) [1122 bp, 373 aa] {ON}
           YIA6Mitochondrial NAD+ transporter, involved in the
           transport of NAD+ into the mitochondria (see also YEA6);
           member of the mitochondrial carrier subfamily; disputed
           role as a pyruvate transporter; has putative mouse and
           human orthologs
          Length = 373

 Score = 72.8 bits (177), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 126/293 (43%), Gaps = 40/293 (13%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFS---------MIQRILKNDGPLGLYSG 70
           G   G ++ +   PLD+AK RLQ  A+   T F           +  I++++GP GLY G
Sbjct: 84  GAFAGFLSGVAVCPLDVAKTRLQ--AQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 71  LTASILRQCTYTTARFGCYDFIKE---NLLPADKLNSTLYLLPCSMIS-GAIGGFVGNPA 126
           L   +L         F  Y+F K+    + P     +      C+ I+ GA    + NP 
Sbjct: 142 LVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQ----SCAAITAGAASTTLTNPI 197

Query: 127 DVVNIR--MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
            VV  R  +Q++    P    +YK   D   ++F +EG + L  GL P+L+ G+   A  
Sbjct: 198 WVVKTRLMLQSNLGEHP---THYKGTFDAFRKLFYQEGFKALYAGLVPSLL-GLFHVAIH 253

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTH-------FTASLVAGLVATTICSPADVIKTRIMNA 237
              Y+    +L   F   + E  T+         AS V+ ++A+ +  P ++++TR+   
Sbjct: 254 FPIYE----DLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLK 309

Query: 238 HQHHESTLKVLSSSIR----NEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
               +S  + L   I+     EGL   + G+  +  R  P + +  +  E  R
Sbjct: 310 SDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFR 362

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 72/170 (42%), Gaps = 20/170 (11%)

Query: 112 SMISGAIGGFVGN----PADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
           + +SGA  GF+      P DV   R+Q            Y+  +  ++ I ++EG R L 
Sbjct: 80  TALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLY 139

Query: 168 TGLGPNLVRGVLMTASQVVS-YDVCK---HNLVTTFGFDASEKKTHFTASLVAGLVATTI 223
            GL P +V G   T     S Y+  K   H +   F F A        A++ AG  +TT+
Sbjct: 140 KGLVP-IVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQS-----CAAITAGAASTTL 193

Query: 224 CSPADVIKTRIM------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
            +P  V+KTR+M          H++ T          EG   ++ G +PS
Sbjct: 194 TNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPS 243

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 81/184 (44%), Gaps = 15/184 (8%)

Query: 23  GGIVACIITHPLDLAKVRL--QTAARPKPT----LFSMIQRILKNDGPLGLYSGLTASIL 76
            G  +  +T+P+ + K RL  Q+     PT     F   +++   +G   LY+GL  S+L
Sbjct: 186 AGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLL 245

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNST-----LYLLPCSMISGAIGGFVGNPADVVNI 131
               +    F  Y+ +K       + N+T       L+  S +S  I   V  P +++  
Sbjct: 246 -GLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRT 304

Query: 132 RMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
           RMQ  S     ++R     I      + +EG++   +G   NLVR +  +A  +VS++  
Sbjct: 305 RMQLKSDIPDSIQRRLFPLIKAT---YAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYF 361

Query: 192 KHNL 195
           ++ L
Sbjct: 362 RNRL 365

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 216 AGLVATTICSPADVIKTRIMN-------AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSF 268
           AG ++     P DV KTR+          + ++   +  LS+ +R+EG   +++G +P  
Sbjct: 87  AGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIV 146

Query: 269 ARLGPNTILIFLVVEQLRKYEIGMHQHF 296
               P  ++ F V E  +K+  G+   F
Sbjct: 147 LGYFPTWMIYFSVYEFSKKFFHGIFPQF 174

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT----LFSMIQRILKNDGPLGLYSGLTASI 75
             V  ++A  +T+P ++ + R+Q  +    +    LF +I+     +G  G YSG T ++
Sbjct: 285 SSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNL 344

Query: 76  LRQCTYTTARFGCYDFIKENL 96
           +R    +      +++ +  L
Sbjct: 345 VRTIPASAITLVSFEYFRNRL 365

>YGR096W Chr7 (676621..677565) [945 bp, 314 aa] {ON}
           TPC1Mitochondrial membrane transporter that mediates
           uptake of the essential cofactor thiamine pyrophosphate
           (ThPP) into mitochondria; expression appears to be
           regulated by carbon source; member of the mitochondrial
           carrier family
          Length = 314

 Score = 72.0 bits (175), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 121/301 (40%), Gaps = 41/301 (13%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQT--AARPKP---TLFSMIQRILKNDGPLGLYSGLTAS 74
           G V G++A  IT P+D  K+RLQ   A   KP    +  + + ++KN+G    + G    
Sbjct: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPG 82

Query: 75  ILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRM- 133
            L   TY +A+F  Y      L P   L + L+ L     +G     V  P DV+  R+ 
Sbjct: 83  SLLYVTYGSAQFSSYSLFNRYLTPFG-LEARLHSLVVGAFAGITSSIVSYPFDVLRTRLV 141

Query: 134 QNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDV--- 190
            N+  H   + R  ++       I+K EG+     G   ++    L  +    +Y+    
Sbjct: 142 ANNQMHSMSITREVRD-------IWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRI 194

Query: 191 -CKHNLVTTFGFDASEKKT-HFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVL 248
            C  N  TT      E  T + +A  + G++A  I  P + I+ R+   +  H       
Sbjct: 195 YCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRH 254

Query: 249 SSS----------------IRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGM 292
           SS                 ++ EG+  ++RG L + ++  P T + F        YE  +
Sbjct: 255 SSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFW------GYETAI 308

Query: 293 H 293
           H
Sbjct: 309 H 309

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 212 ASLVAGLVATTICSPADVIKTRIM-----NAHQHHESTLKVLSSSIRNEGLGFMFRGWLP 266
           A  V+GL+A +I +P D IK R+               ++V  S I+NEG+   ++G +P
Sbjct: 22  AGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIP 81

>Suva_5.158 Chr5 complement(234718..235620) [903 bp, 300 aa] {ON}
           YER053C (REAL)
          Length = 300

 Score = 72.0 bits (175), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 120/279 (43%), Gaps = 20/279 (7%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           +GGI+AC  TH    PLDL K RLQ   +   +     ++I+  +G   +Y+G+ A+ + 
Sbjct: 23  LGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLDGFRKIVATEGWKKVYTGVGATFIG 82

Query: 78  QCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDS 137
                  ++G Y++ K           T+YL+  S  +  +   +  P + + ++ Q  +
Sbjct: 83  YSLQGAGKYGGYEYFKHLYSGWLTPGVTVYLM-ASATAEFLADIMLCPFEAIKVKQQ--T 139

Query: 138 AHEPHLRRNYKNAIDGVTRIFKEE-GVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLV 196
              P       N IDG  +++ E  G++    G+ P   R +  T  +  S++     + 
Sbjct: 140 TMPPFCN----NVIDGWKKMYAESGGMKSFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIY 195

Query: 197 TTFGFDASEK------KTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSS 250
           +       E          F    +AG++   I  PADV+ ++I +  + +ES + V S 
Sbjct: 196 SVLPKKKEEMNPLQQISVSFVGGYLAGILCAAISHPADVMVSKINSERKGNES-MSVASK 254

Query: 251 SIRNE-GLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
            I  + G   ++ G +     +G  T   +L+ +  + Y
Sbjct: 255 RIYQKIGFAGLWNGLMVRIVMIGTLTSFQWLIYDSFKAY 293

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+   I+HP D+   ++ +  +   ++    +RI +  G  GL++GL   I+   
Sbjct: 218 GYLAGILCAAISHPADVMVSKINSERKGNESMSVASKRIYQKIGFAGLWNGLMVRIVMIG 277

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 278 TLTSFQWLIYDSFK 291

>NDAI0A04420 Chr1 (1002320..1003192) [873 bp, 290 aa] {ON}
          Length = 290

 Score = 71.6 bits (174), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 112/271 (41%), Gaps = 6/271 (2%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQT-AARPKPTLFSMIQRILKNDGPL-GLYSGLTASILR 77
           G + G    +I +P D  KVRLQT  ++  PT +S I+    ++G L G + G+ + I  
Sbjct: 22  GSIAGAFGKVIEYPFDTVKVRLQTQGSKMFPTTWSCIKYTYNHEGVLKGFFQGIGSPIFG 81

Query: 78  QCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ-ND 136
                   F  Y+     L     +++   +L     +G+   FV  P +++  ++Q ++
Sbjct: 82  AALENATLFVSYNQSSMFLERHTNVSAMNNILISGAFAGSCASFVLTPVELIKCKLQVSN 141

Query: 137 SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLV 196
              +   +  +   I  +T I +E G+  L  G     +R  L   +   +Y++ K  L 
Sbjct: 142 LMKDVQGQVRHTKIIPTLTHILRERGILGLWQGQSSTFIRESLGGVAWFATYEIMKKTLK 201

Query: 197 TTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEG 256
           +  G + S+      +   AGL       PAD +K+ +        S +  +   +   G
Sbjct: 202 SRHGGEDSKTWELLVSGASAGLAFNGSIFPADTVKSMM---QTERISLMNAVKKVLTTHG 258

Query: 257 LGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           +   +RG   +  R  P    +F V E L K
Sbjct: 259 IPGFYRGLGITLIRAIPANATVFYVYETLSK 289

>TPHA0G03460 Chr7 complement(738514..739410) [897 bp, 298 aa] {ON}
           Anc_2.525 YBR291C
          Length = 298

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 121/280 (43%), Gaps = 18/280 (6%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP---KPTLFSMIQRILKNDGPLGLYSGLTASIL 76
           G + G +   IT+P + AK RLQ +++          ++ +I +  G   +Y G    I+
Sbjct: 18  GALAGAIEGSITYPFEFAKTRLQLSSKAVNVTKNPIKLLYQIGRFQGIGAMYIGCPVFIV 77

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNPADVVNI 131
                 + RF  +D IK+ L   D L   +   P  +I+G   G     F   P + V  
Sbjct: 78  GNTAKASIRFLGFDMIKDML--KDPLTGEVSG-PRGVIAGLGAGLMESVFAVTPFEHVKT 134

Query: 132 RMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDV 190
            M +D  +  P    N K  +     + + EG+R L +G+ P  +R    +A ++  Y+ 
Sbjct: 135 LMIDDKRSPTPKYSNNGKGVLRNYGNLLRAEGLRGLYSGVIPVSMRQAANSAVRLGCYNK 194

Query: 191 CKHNLVTTFGFDASEKKTH----FTASLVAGLVATTICSPADVIKTRIMN-AHQHHESTL 245
            K  +V  +     +K       F     +G+V      P D +KTR+ +  H  +++TL
Sbjct: 195 IK-TIVQKYTSTPVDKPLSSGLTFVVGAFSGIVTVYSTMPIDTVKTRMQSLEHSKYKNTL 253

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQL 285
                  +NEGL   ++G  P   RL  +  ++F V E++
Sbjct: 254 DCFVKVYKNEGLKIFWKGATPRLGRLILSGGIVFTVYEKV 293

>KLTH0B08712g Chr2 complement(706712..707746) [1035 bp, 344 aa] {ON}
           similar to uniprot|P53320 Saccharomyces cerevisiae
           YGR257C MTM1 Mitochondrial protein of the mitochondrial
           carrier family involved in activating mitochondrial
           Sod2p probably by facilitating insertion of an essential
           manganese cofactor
          Length = 344

 Score = 72.0 bits (175), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 88/197 (44%), Gaps = 19/197 (9%)

Query: 16  PWWYGGVGGIVACIITHPLDLAKVRLQTAAR--PKPTLFSMIQRILKND-------GPLG 66
           P   G +  ++A     PL+L + RLQ+  R  P  T   M++ ++K         G   
Sbjct: 144 PLLCGAIARVLAATTVAPLELFRTRLQSIPRSSPNSTAAMMVKDLIKESRYEISRVGYKA 203

Query: 67  LYSGLTASILRQCTYTTARFGCYDFIKENLLP------ADKLNSTLYLLPCSMISGAIGG 120
           L+ GL  ++ R   +++  +GCY+F K N+         +  N+       S + G+ GG
Sbjct: 204 LFRGLEITLWRDVPFSSIYWGCYEFYKSNISIKSERSIVNSSNTNWNHFVNSFVGGSFGG 263

Query: 121 FVG----NPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
            V     +P DV   RMQ    +    +   KN    + +I K EG+  L TGL P +++
Sbjct: 264 AVAAILTHPFDVGKTRMQISFLNNTPGKSPSKNMFKYLNQIRKSEGLGALYTGLVPRVIK 323

Query: 177 GVLMTASQVVSYDVCKH 193
                A  + +Y+VCK 
Sbjct: 324 IAPSCAIMISTYEVCKR 340

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/274 (21%), Positives = 112/274 (40%), Gaps = 28/274 (10%)

Query: 36  LAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKEN 95
            A V  QT++    + +    +I + +G   L+ GL+ +++         F  Y+ +++N
Sbjct: 73  FADVHCQTSSVNYNSTWDAFTKIARIEGARSLWRGLSITLVMAVPANMVYFIGYESLRDN 132

Query: 96  LLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVT 155
               +K  S L  L C  I+  +      P ++   R+Q+     P+       A   V 
Sbjct: 133 SFLQNKY-SRLNPLLCGAIARVLAATTVAPLELFRTRLQSIPRSSPN-----STAAMMVK 186

Query: 156 RIFKEE-------GVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVT----TFGFDAS 204
            + KE        G + L  GL   L R V  ++     Y+  K N+      +    ++
Sbjct: 187 DLIKESRYEISRVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNISIKSERSIVNSSN 246

Query: 205 EKKTHFTASLV----AGLVATTICSPADVIKTRIMNAHQHH-------ESTLKVLSSSIR 253
               HF  S V     G VA  +  P DV KTR+  +  ++       ++  K L+   +
Sbjct: 247 TNWNHFVNSFVGGSFGGAVAAILTHPFDVGKTRMQISFLNNTPGKSPSKNMFKYLNQIRK 306

Query: 254 NEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           +EGLG ++ G +P   ++ P+  ++    E  ++
Sbjct: 307 SEGLGALYTGLVPRVIKIAPSCAIMISTYEVCKR 340

>KAFR0B01980 Chr2 complement(383570..384541) [972 bp, 323 aa] {ON}
           Anc_8.115 YPR011C
          Length = 323

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 128/293 (43%), Gaps = 30/293 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT---LFSMIQRILKNDGPLGLYSGLTASIL 76
           GG+ G V+  +  P +  K+ LQ  +   P    +F  I ++ K +   GL+ G   + +
Sbjct: 23  GGIAGAVSRTVVSPFERVKILLQVQSTRAPYNNGVFKAISQVYKEENVKGLFRGNGLNCI 82

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCS-MISGAIGG----FVGNPADVVNI 131
           R   Y+  +F  YD+ K+N+   DK ++   L     +ISGA+ G        P D++  
Sbjct: 83  RVFPYSAVQFVVYDYCKKNIFHVDKNSAVAQLTNVQRLISGALCGGCSIIATYPLDLLKT 142

Query: 132 RMQNDSAHEPHLRRNYKNA--------IDGVTRIFKEEG-VRKLLTGLGPNLVRGVLMTA 182
           R+   +++  +L RN K A            +++++EEG V  L  G+ P  +  +   A
Sbjct: 143 RLSIQTSNLENL-RNSKAANTLKPPGFWQLFSKVYREEGKVFGLFRGIWPTSLGIIPYVA 201

Query: 183 SQVVSYDVCKHNL-----VTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI--- 234
                Y+  +  L     V        +     T   ++G VA T+  P D+++ R    
Sbjct: 202 LNFTIYEQLREYLPKEEDVNNLKSSLKQNTYMLTIGAISGGVAQTLTYPFDLLRRRFQIL 261

Query: 235 -MNAHQ---HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
            M  ++   ++      L +  R EGL   ++G   +  ++ P+T + +LV E
Sbjct: 262 TMGNNELGFYYTGIYDALKTIARTEGLRGYYKGLEANLLKVVPSTAVSWLVYE 314

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 91/199 (45%), Gaps = 34/199 (17%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAI-DGVTRIFKEEGVRKLLTGLGP 172
           I+GA+   V +P + V I +Q  S   P     Y N +   +++++KEE V+ L  G G 
Sbjct: 25  IAGAVSRTVVSPFERVKILLQVQSTRAP-----YNNGVFKAISQVYKEENVKGLFRGNGL 79

Query: 173 NLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICS------- 225
           N +R    +A Q V YD CK N+   F  D +      T   V  L++  +C        
Sbjct: 80  NCIRVFPYSAVQFVVYDYCKKNI---FHVDKNSAVAQLTN--VQRLISGALCGGCSIIAT 134

Query: 226 -PADVIKTRIMNAHQHHE--------STLK------VLSSSIRNEGLGF-MFRGWLPSFA 269
            P D++KTR+     + E        +TLK      + S   R EG  F +FRG  P+  
Sbjct: 135 YPLDLLKTRLSIQTSNLENLRNSKAANTLKPPGFWQLFSKVYREEGKVFGLFRGIWPTSL 194

Query: 270 RLGPNTILIFLVVEQLRKY 288
            + P   L F + EQLR+Y
Sbjct: 195 GIIPYVALNFTIYEQLREY 213

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 85/194 (43%), Gaps = 24/194 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRL--QTAA-------------RPKPTLFSMIQRILKNDGP 64
           G + G  + I T+PLDL K RL  QT+              +P P  + +  ++ + +G 
Sbjct: 123 GALCGGCSIIATYPLDLLKTRLSIQTSNLENLRNSKAANTLKP-PGFWQLFSKVYREEGK 181

Query: 65  L-GLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNS-------TLYLLPCSMISG 116
           + GL+ G+  + L    Y    F  Y+ ++E L   + +N+         Y+L    ISG
Sbjct: 182 VFGLFRGIWPTSLGIIPYVALNFTIYEQLREYLPKEEDVNNLKSSLKQNTYMLTIGAISG 241

Query: 117 AIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR 176
            +   +  P D++  R Q  +     L   Y    D +  I + EG+R    GL  NL++
Sbjct: 242 GVAQTLTYPFDLLRRRFQILTMGNNELGFYYTGIYDALKTIARTEGLRGYYKGLEANLLK 301

Query: 177 GVLMTASQVVSYDV 190
            V  TA   + Y++
Sbjct: 302 VVPSTAVSWLVYEM 315

>KLLA0D15015g Chr4 (1267803..1268756) [954 bp, 317 aa] {ON} similar
           to uniprot|P53257 Saccharomyces cerevisiae YGR096W TPC1
           Tpc1p is a transporter that catalyzes the uptake of the
           essential cofactor thiamine pyrophosphate (ThPP) into
           mitochondria it is located in the mitochondrial membrane
           and its expression appears to be regulated by carbon
           source
          Length = 317

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 127/298 (42%), Gaps = 44/298 (14%)

Query: 18  WY-----GGVGGIVACIITHPLDLAKVR--LQTAARPK-PTLFSMIQRILKNDGPLGLYS 69
           WY     G V G+ A + T P+D  K+R  LQ     K   + S ++ I+K +G   L+ 
Sbjct: 18  WYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWK 77

Query: 70  GLTASILRQCTYTTARFGCYDFIKENLLPAD--KLNSTLYLLPCSMISGAIGGFVGNPAD 127
           G   +      Y   +FG Y +   N+  A   + +     L    ++G     V  P D
Sbjct: 78  GNIPATAMYVVYGAVQFGSYSWF-NNVWSAKFPRFSQQGQTLTVGALAGMTSSVVSYPLD 136

Query: 128 VVNIRM-QNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
           ++  R+  N ++H   +    +       +++  EGVR   TG+   +    L TA   +
Sbjct: 137 LLRTRLIANRTSHRTSVAEECR-------QMWLNEGVRGFFTGISTAMTTVTLSTAIMFL 189

Query: 187 SYD----VCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTR--IMNAHQ- 239
           +Y+    VC+++    +    S      ++ ++AG V+ T+  P D ++ R  +MN+ + 
Sbjct: 190 TYETVNIVCENHEKEFWSRPVSA-----SSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRT 244

Query: 240 ---------HHE----STLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQ 284
                    +HE    S+  ++   +R EG+  ++RG      +  P T +   V E+
Sbjct: 245 VHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYER 302

>Smik_2.244 Chr2 (434608..435597) [990 bp, 329 aa] {ON} YBR104W
           (REAL)
          Length = 329

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 134/313 (42%), Gaps = 35/313 (11%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK 60
           ++G K  S N V+K   + G VGGI   ++  P D  KVRLQTA     TL  +++ ++K
Sbjct: 23  VNGKKELSPNRVLK-DIFAGTVGGIAQVLVGQPFDTTKVRLQTATTRTTTL-DVLRNLVK 80

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKE-----------NLLPADKLNSTLYLL 109
           N+G    Y G    +L      + +FG  + +K            ++ P +   S    L
Sbjct: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPHISPQNVDLSRSNTL 140

Query: 110 P------CSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGV 163
           P      C +  G +  F+ +P + + IR+Q  +++     R +K   D + ++  + G 
Sbjct: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGD--REFKGPWDCIKKLKAQGG- 197

Query: 164 RKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASE----KKTHFTASLVAGLV 219
             L+ GL P ++R      +  + Y+      + T G   +E    K   F A   +G +
Sbjct: 198 --LMRGLFPTMIRAGHGLGTYFLVYEALVAKEIGT-GLTRNEIPPWKLCLFGA--FSGTM 252

Query: 220 ATTICSPADVIKTRIMNAH----QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNT 275
                 P DV+K+ I N      ++  S   V  +    EG+   F+G+ P+  R  P  
Sbjct: 253 LWLTVYPLDVVKSIIQNDDLRTPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVN 312

Query: 276 ILIFLVVEQLRKY 288
              FL  E + ++
Sbjct: 313 GATFLTFELVMRF 325

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 79/201 (39%), Gaps = 29/201 (14%)

Query: 112 SMISGAIGG----FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
            + +G +GG     VG P D   +R+Q  +     L        D +  + K EGV    
Sbjct: 37  DIFAGTVGGIAQVLVGQPFDTTKVRLQTATTRTTTL--------DVLRNLVKNEGVFAFY 88

Query: 168 TG-LGPNLVRGVLMTASQVVS---------YDVCKHNLVTTFGFDASEKKT-----HFTA 212
            G L P L  G+ ++    V+         Y+  K+  ++    D S   T     ++  
Sbjct: 89  KGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPHISPQNVDLSRSNTLPLSQYYVC 148

Query: 213 SLVAGLVATTICSPADVIKTRIMNAHQHH-ESTLKVLSSSIRN-EGLGFMFRGWLPSFAR 270
            L  G+V + + SP + I+ R+     +  +   K     I+  +  G + RG  P+  R
Sbjct: 149 GLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIR 208

Query: 271 LGPNTILIFLVVEQLRKYEIG 291
            G      FLV E L   EIG
Sbjct: 209 AGHGLGTYFLVYEALVAKEIG 229

>TPHA0D03980 Chr4 (836589..837581) [993 bp, 330 aa] {ON} Anc_3.435
           YGR096W
          Length = 330

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 86/200 (43%), Gaps = 25/200 (12%)

Query: 15  YPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPT-LFSMIQRILKNDGPLGLYSGLTA 73
           Y    G + GI +  I++P D+ + R       +   L++ I+ I +N+G LG + G+ +
Sbjct: 123 YSTLVGALTGITSSTISYPFDVLRTRFAANQSTRNLRLYATIKDIFRNEGTLGFFRGINS 182

Query: 74  SILRQCTYTTARFGCYDFIK----ENLLPADKLNSTLYLLPCSM-----------ISGAI 118
           SIL         FG Y+ IK    E L   +  +S    +P              +SG I
Sbjct: 183 SILAITLSNAIIFGTYESIKIYSEEQLTLLENTSSNSCYVPYKFAYQILNGSAGSLSGLI 242

Query: 119 GGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGV---------TRIFKEEGVRKLLTG 169
              V  P D +  R+Q  + H  HL   +KN               +I ++EG   L  G
Sbjct: 243 SKLVTYPLDTIRRRIQVSTPHSIHLLAEHKNVYKSYFKMNFIAVGMKIMRDEGKLSLFRG 302

Query: 170 LGPNLVRGVLMTASQVVSYD 189
           LG NL++ V  +A  + +Y+
Sbjct: 303 LGINLIKTVPNSAIYLYAYE 322

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 117/311 (37%), Gaps = 58/311 (18%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP----------KPTLFSMIQRILKNDGPLGLYS 69
           GG+ G+ A  +T PLD  K+RLQ   +              L SMI R+ K +G LG + 
Sbjct: 23  GGLAGLTARSLTAPLDTVKIRLQLLYKSIELDPRIKVNNSILTSMITRMYKKEGILGFWK 82

Query: 70  GLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVG------ 123
           G     L    Y   +FG Y +I         LN     LP  + S  +G   G      
Sbjct: 83  GNVPGSLMYIIYGATQFGSYTYINSLFSHNHVLNQ----LPSQVYSTLVGALTGITSSTI 138

Query: 124 -NPADVVNIRM-QNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMT 181
             P DV+  R   N S     L    K+       IF+ EG      G+  +++   L  
Sbjct: 139 SYPFDVLRTRFAANQSTRNLRLYATIKD-------IFRNEGTLGFFRGINSSILAITLSN 191

Query: 182 ASQVVSYDVCK---HNLVTTFGFDASE----------KKTHFTASLVAGLVATTICSPAD 228
           A    +Y+  K      +T     +S           +  + +A  ++GL++  +  P D
Sbjct: 192 AIIFGTYESIKIYSEEQLTLLENTSSNSCYVPYKFAYQILNGSAGSLSGLISKLVTYPLD 251

Query: 229 VIKTRIMNAHQH-------HESTLK---------VLSSSIRNEGLGFMFRGWLPSFARLG 272
            I+ RI  +  H       H++  K         V    +R+EG   +FRG   +  +  
Sbjct: 252 TIRRRIQVSTPHSIHLLAEHKNVYKSYFKMNFIAVGMKIMRDEGKLSLFRGLGINLIKTV 311

Query: 273 PNTILIFLVVE 283
           PN+ +     E
Sbjct: 312 PNSAIYLYAYE 322

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 84/196 (42%), Gaps = 21/196 (10%)

Query: 109 LPCSMISGAIGGFVGN----PADVVNIRMQ---NDSAHEPHLRRNYKNAIDGVTRIFKEE 161
           +  S+++G + G        P D V IR+Q        +P ++ N       +TR++K+E
Sbjct: 16  VAMSIVAGGLAGLTARSLTAPLDTVKIRLQLLYKSIELDPRIKVNNSILTSMITRMYKKE 75

Query: 162 GVRKLLTGLGPNLVRGVLMTASQVVSY----DVCKHNLVTTFGFDASEKKTHFTASLVA- 216
           G+     G  P  +  ++  A+Q  SY     +  HN V       ++  +   ++LV  
Sbjct: 76  GILGFWKGNVPGSLMYIIYGATQFGSYTYINSLFSHNHV------LNQLPSQVYSTLVGA 129

Query: 217 --GLVATTICSPADVIKTRIM-NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGP 273
             G+ ++TI  P DV++TR   N    +      +    RNEG    FRG   S   +  
Sbjct: 130 LTGITSSTISYPFDVLRTRFAANQSTRNLRLYATIKDIFRNEGTLGFFRGINSSILAITL 189

Query: 274 NTILIFLVVEQLRKYE 289
           +  +IF   E ++ Y 
Sbjct: 190 SNAIIFGTYESIKIYS 205

>TBLA0B07250 Chr2 (1718541..1719506) [966 bp, 321 aa] {ON} Anc_2.344
           YMR166C
          Length = 321

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/319 (25%), Positives = 128/319 (40%), Gaps = 57/319 (17%)

Query: 16  PWWYGGVGGIVACIIT----HPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGL 71
           P  +  + G+++C+I     HPLD  K R Q +++   +L+S   ++ + +G  G YSG 
Sbjct: 17  PLHHNTIAGVLSCLIADTTMHPLDTLKTRQQGSSQ-NVSLYSYFIKLSRQEGFRGFYSGY 75

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGN------- 124
           +A++          F  Y+FIK  L P ++        P S +   IGG +G+       
Sbjct: 76  SAALSGSIPSAAVFFTTYEFIKRELRPYNE--------PISFL---IGGLMGDLLSSVVY 124

Query: 125 -PADVVNIRMQ-NDSAHEPHLRR--NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180
            P++V+  R+Q       P   +  NY+N    +  I+K EG      G G  L R +  
Sbjct: 125 VPSEVIKTRLQLQGKFSNPFYVKNYNYRNFRSAIKSIWKVEGRSTFFWGYGATLGRDLPF 184

Query: 181 TASQVVSYDVCK--------HNLVTTFGFDASEKKT---------HFTASLVAGLVATTI 223
           +A Q   Y+  +         N    FG + S                   +AG +A  I
Sbjct: 185 SALQFAFYEELRKFCIYLKNQNQTNPFGLNISNNNKNDNYLPLSLELLTGGIAGGLAGAI 244

Query: 224 CSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTIL------ 277
            +P DV+KTR       + S  + L S    +G   +F G       +G   +       
Sbjct: 245 TTPLDVVKTRKQTQSNFNGSLYQNLLSIKTTQGYSGLFSG-------IGARCVWTSVQSS 297

Query: 278 IFLVVEQLRKYEIGMHQHF 296
           I LVV Q    EI    HF
Sbjct: 298 IMLVVYQFLLREIDSPHHF 316

>NDAI0A07670 Chr1 (1765057..1765971) [915 bp, 304 aa] {ON}
          Length = 304

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 81/194 (41%), Gaps = 27/194 (13%)

Query: 1   MSGTKSESSNAVVKYPWWY------GGVGGIVACIITHPLDLAKVRL--------QTAAR 46
           M G K E       Y  W+      GG+ G ++ +  + LD A+ RL        +  AR
Sbjct: 100 MFGFKKEDG-----YGKWFAGNLASGGMAGGLSLLFVYSLDFARTRLAADSKSSKKGGAR 154

Query: 47  PKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
               L  + ++ LK+DG  GLY G   S++    Y    FG YD +K  LL      S L
Sbjct: 155 QFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSVKPLLLTGSLEGSFL 214

Query: 107 --YLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
             +LL   + +GA       P D V  RM   S         Y  A D   +I   EGV 
Sbjct: 215 ASFLLGWVVTTGA--STASYPLDTVRRRMMMTSGQAVK----YNGAFDCFKKIVAAEGVA 268

Query: 165 KLLTGLGPNLVRGV 178
            L  G G N++RGV
Sbjct: 269 SLFKGCGANILRGV 282

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/280 (23%), Positives = 104/280 (37%), Gaps = 30/280 (10%)

Query: 6   SESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQ---------TAARPKPTLFSMIQ 56
           SE S +     +  GGV   VA     P++  K+ +Q         T       +    +
Sbjct: 2   SEKSQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMIKQGTLDHKYSGIVDCFK 61

Query: 57  RILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISG 116
           R  K +G +  + G TA+++R        F   D IK  +    K +        ++ SG
Sbjct: 62  RTAKQEGIISFWRGNTANVIRYFPTQALNFAFKDRIKL-MFGFKKEDGYGKWFAGNLASG 120

Query: 117 AIGG-----FVGNPADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGL 170
            + G     FV    D    R+  DS + +    R +   ID   +  K +GV  L  G 
Sbjct: 121 GMAGGLSLLFV-YSLDFARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGF 179

Query: 171 GPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICS----P 226
            P++V  V+        YD  K  L+T         +  F AS + G V TT  S    P
Sbjct: 180 LPSVVGIVVYRGLYFGLYDSVKPLLLT------GSLEGSFLASFLLGWVVTTGASTASYP 233

Query: 227 ADVIKTRIMNAHQH---HESTLKVLSSSIRNEGLGFMFRG 263
            D ++ R+M        +          +  EG+  +F+G
Sbjct: 234 LDTVRRRMMMTSGQAVKYNGAFDCFKKIVAAEGVASLFKG 273

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 71/169 (42%), Gaps = 19/169 (11%)

Query: 114 ISGAIGGFVGNPADVVN--IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S A+     +P + V   I+ QN+   +  L   Y   +D   R  K+EG+     G  
Sbjct: 18  VSAAVAKTAASPIERVKLLIQNQNEMIKQGTLDHKYSGIVDCFKRTAKQEGIISFWRGNT 77

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH-FTASLVAGLVATTI----CSP 226
            N++R      +Q +++   K  +   FGF   +     F  +L +G +A  +       
Sbjct: 78  ANVIR---YFPTQALNF-AFKDRIKLMFGFKKEDGYGKWFAGNLASGGMAGGLSLLFVYS 133

Query: 227 ADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
            D  +TR+            +     + V   +++++G+  ++RG+LPS
Sbjct: 134 LDFARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPS 182

>Kpol_1067.4 s1067 complement(7468..8511) [1044 bp, 347 aa] {ON}
           complement(7468..8511) [1044 nt, 348 aa]
          Length = 347

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 90/193 (46%), Gaps = 20/193 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRILK-------NDGPLGLYS 69
           G +  ++A     PL+L K RLQ   T+++   +L  +I+ +LK       + G   L+ 
Sbjct: 152 GALARVIAASSVAPLELLKTRLQSIPTSSKNTKSLL-LIKDLLKETRNEVQSTGYKALFK 210

Query: 70  GLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSM----ISGAIGGFVGNP 125
           GL  ++ R   ++   +G Y+F K NL+  D  +S ++    S     ISG I   + +P
Sbjct: 211 GLEITLWRDVPFSAIYWGTYEFCKRNLMIKDSSSSNIFHFMNSFIHGTISGTIAALITHP 270

Query: 126 ADVVNIRMQ-----NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180
            DV   R+Q     ND+     + +  KN    +  I K EG+R L  GL P + +    
Sbjct: 271 FDVGKTRLQISLVNNDNNTLTKVEKPSKNLFRFLNNIKKNEGIRALYAGLMPRIFKIAPS 330

Query: 181 TASQVVSYDVCKH 193
            A  + +Y++ K 
Sbjct: 331 CAIMISTYELSKR 343

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/261 (21%), Positives = 109/261 (41%), Gaps = 24/261 (9%)

Query: 42  QTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADK 101
            T+ R   TL +M + I   +G   L+ GL+ ++          F  Y++I++ + P   
Sbjct: 84  NTSIRYSGTLEAM-RNIAHVEGIHSLWRGLSLTLFMAIPANIVYFTGYEYIRD-ISPLKS 141

Query: 102 LNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNY--KNAIDGVTRIFK 159
              T   + C  ++  I      P +++  R+Q+      + +     K+ +       +
Sbjct: 142 SLPTFNPVICGALARVIAASSVAPLELLKTRLQSIPTSSKNTKSLLLIKDLLKETRNEVQ 201

Query: 160 EEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKT-HFTASLVAGL 218
             G + L  GL   L R V  +A    +Y+ CK NL+     D+S     HF  S + G 
Sbjct: 202 STGYKALFKGLEITLWRDVPFSAIYWGTYEFCKRNLMIK---DSSSSNIFHFMNSFIHGT 258

Query: 219 VATTICS----PADVIKTRIM------------NAHQHHESTLKVLSSSIRNEGLGFMFR 262
           ++ TI +    P DV KTR+                +  ++  + L++  +NEG+  ++ 
Sbjct: 259 ISGTIAALITHPFDVGKTRLQISLVNNDNNTLTKVEKPSKNLFRFLNNIKKNEGIRALYA 318

Query: 263 GWLPSFARLGPNTILIFLVVE 283
           G +P   ++ P+  ++    E
Sbjct: 319 GLMPRIFKIAPSCAIMISTYE 339

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 45/104 (43%), Gaps = 14/104 (13%)

Query: 5   KSESSNAVVKY--PWWYGGVGGIVACIITHPLDLAKVRLQTA------------ARPKPT 50
           K  SS+ +  +   + +G + G +A +ITHP D+ K RLQ +             +P   
Sbjct: 240 KDSSSSNIFHFMNSFIHGTISGTIAALITHPFDVGKTRLQISLVNNDNNTLTKVEKPSKN 299

Query: 51  LFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKE 94
           LF  +  I KN+G   LY+GL   I +           Y+  K 
Sbjct: 300 LFRFLNNIKKNEGIRALYAGLMPRIFKIAPSCAIMISTYELSKR 343

>NDAI0B02420 Chr2 complement(604848..607550) [2703 bp, 900 aa] {ON}
           Anc_8.129 YPR021C
          Length = 900

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 55/202 (27%), Positives = 92/202 (45%), Gaps = 18/202 (8%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQT-AARPKPTLFSMIQRIL 59
           +SG ++   N  + Y    G   G+   I+T+PL++ K+RLQ  ++  +   + +I+ + 
Sbjct: 580 LSG-RNNRGNLKLSYEILSGATAGLCQTIVTNPLEIIKIRLQVKSSNSEINAWKIIKHLK 638

Query: 60  KNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLL---PADKLN----STLYLLPCS 112
            N    GLY G+TA +LR   ++   F  Y  +K++L    P DK       T  LL   
Sbjct: 639 FN----GLYKGITACLLRDVPFSAIYFPTYAHLKKDLFKFDPNDKFKKKRLKTWELLTAG 694

Query: 113 MISGAIGGFVGNPADVVNIRMQNDSAHEPHLRR-NYKNAIDGVTRIFKEEGVRKLLTGLG 171
            I+G    F+  P DV+  R+Q     EP      YK        IF+EE  +    G G
Sbjct: 695 AIAGMPAAFLTTPFDVIKTRLQI----EPKPGEVAYKGIFHAFKTIFEEESFKSFFKGGG 750

Query: 172 PNLVRGVLMTASQVVSYDVCKH 193
             ++R        + +Y++ K+
Sbjct: 751 ARVLRSSPQFGFTLAAYEIFKN 772

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 64/230 (27%), Positives = 104/230 (45%), Gaps = 31/230 (13%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRILKNDGPLGLYSGLTASIL 76
           G + G +   I +P+D  K R+Q   +  + K ++  +I+ + KN G   LYSGLT  ++
Sbjct: 502 GSIAGCIGATIVYPIDFIKTRMQAQRSLTKYKNSVDCLIKIVSKN-GIRSLYSGLTPQLI 560

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGF----VGNPADVVNIR 132
                   +    D ++  L  + + N     L   ++SGA  G     V NP +++ IR
Sbjct: 561 GVAPEKAIKLTINDLMRNKL--SGRNNRGNLKLSYEILSGATAGLCQTIVTNPLEIIKIR 618

Query: 133 MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCK 192
           +Q  S+          N+     +I K      L  G+   L+R V  +A    +Y   K
Sbjct: 619 LQVKSS----------NSEINAWKIIKHLKFNGLYKGITACLLRDVPFSAIYFPTYAHLK 668

Query: 193 HNLVTTFGFDASEK------KTH--FTASLVAGLVATTICSPADVIKTRI 234
            +L   F FD ++K      KT    TA  +AG+ A  + +P DVIKTR+
Sbjct: 669 KDL---FKFDPNDKFKKKRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRL 715

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 8/174 (4%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPN 173
           I+G IG  +  P D +  RMQ   +        YKN++D + +I  + G+R L +GL P 
Sbjct: 504 IAGCIGATIVYPIDFIKTRMQAQRS-----LTKYKNSVDCLIKIVSKNGIRSLYSGLTPQ 558

Query: 174 LVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTR 233
           L+      A ++   D+ ++ L         +      +   AGL  T + +P ++IK R
Sbjct: 559 LIGVAPEKAIKLTINDLMRNKLSGRNNRGNLKLSYEILSGATAGLCQTIVTNPLEIIKIR 618

Query: 234 IMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           +     + E     +   ++  GL   ++G      R  P + + F     L+K
Sbjct: 619 LQVKSSNSEINAWKIIKHLKFNGL---YKGITACLLRDVPFSAIYFPTYAHLKK 669

 Score = 32.7 bits (73), Expect = 1.2,   Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 209 HFTASLVAGLVATTICSPADVIKTRIMNAHQ---HHESTLKVLSSSIRNEGLGFMFRGWL 265
           +F+   +AG +  TI  P D IKTR M A +    +++++  L   +   G+  ++ G  
Sbjct: 498 NFSLGSIAGCIGATIVYPIDFIKTR-MQAQRSLTKYKNSVDCLIKIVSKNGIRSLYSGLT 556

Query: 266 PSFARLGPNTILIFLVVEQLR 286
           P    + P   +   + + +R
Sbjct: 557 PQLIGVAPEKAIKLTINDLMR 577

>Kwal_23.5757 s23 complement(1307213..1308136) [924 bp, 307 aa] {ON}
           YER053C - sequence similarity to mitochondrial phosphate
           transporters [contig 11] FULL
          Length = 307

 Score = 70.9 bits (172), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 116/280 (41%), Gaps = 20/280 (7%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           +GG+VAC  TH    PLDL K R Q  A    +     ++I++++G   +++G+ A+ + 
Sbjct: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIG 83

Query: 78  QCTYTTARFGCYDFIK---ENLLPADKLNS--TLYLLPCSMISGAIGGFVGNPADVVNIR 132
                  ++G Y+F K     L+  +  +S  T   L  S  +  I      P + + +R
Sbjct: 84  YSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVR 143

Query: 133 MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCK 192
            Q  +A  P   RN     D  +++   EG   L  G+ P   R +  T  +  S++   
Sbjct: 144 QQ--TAVPPPFARN---VFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIV 198

Query: 193 HNLVTTFGFDASEKK------THFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLK 246
             +         E          F    +AG++   +  PADV+ +++ N  +  ESTL+
Sbjct: 199 EMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQ 258

Query: 247 VLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
             S      G   ++ G       +G  T   +L+ +  +
Sbjct: 259 ATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFK 298

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+  +++HP D+   ++    +   +      RI    G  GL++GL   IL   
Sbjct: 225 GYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIG 284

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 285 TLTSFQWLIYDSFK 298

>KNAG0D02230 Chr4 (382941..385628) [2688 bp, 895 aa] {ON} Anc_8.129
           YPR021C
          Length = 895

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 79/181 (43%), Gaps = 10/181 (5%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G   G    I T+P+++ K+RLQ  +           +I+K+ G  GLY G+TA ++R  
Sbjct: 607 GASAGTCQVIFTNPIEIVKIRLQVKSESVANASLTASQIIKSLGIKGLYKGVTACLMRDV 666

Query: 80  TYTTARFGCYDFIKENLL---PADKLN----STLYLLPCSMISGAIGGFVGNPADVVNIR 132
            ++   F  Y  +K+++    P DK       T  LL    ++G    F+  P DV+  R
Sbjct: 667 PFSAIYFPTYAHLKKDIFNFDPKDKTKRNRLKTWELLVAGALAGMPAAFLTTPFDVIKTR 726

Query: 133 MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCK 192
           +Q D          YK        I KEE +R    G G  ++R        + +Y++ K
Sbjct: 727 LQVDPRKG---ETRYKGIFHAAKTILKEESIRSFFKGGGARVLRSSPQFGFTLAAYELFK 783

Query: 193 H 193
           +
Sbjct: 784 N 784

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 121/273 (44%), Gaps = 34/273 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRILKNDGPLGLYSGLTASIL 76
           G   G +   + +P+D  K R+Q   + ++ K +L  +I +++K +G  GLYSGL   ++
Sbjct: 513 GSAAGCIGATVVYPIDFIKTRMQVQRSLSKYKNSLDCLI-KVVKTEGVRGLYSGLGFQLI 571

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPADVVNIR 132
                   +    DF+++ L+  DK    L+     ++SGA  G       NP ++V IR
Sbjct: 572 GVAPEKAIKLTVNDFLRKKLI--DK-QGNLHAF-AEVLSGASAGTCQVIFTNPIEIVKIR 627

Query: 133 MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCK 192
           +Q  S        +  NA    ++I K  G++ L  G+   L+R V  +A    +Y   K
Sbjct: 628 LQVKS-------ESVANASLTASQIIKSLGIKGLYKGVTACLMRDVPFSAIYFPTYAHLK 680

Query: 193 HNLVTTFGFDASEKKTH--------FTASLVAGLVATTICSPADVIKTRIMNAHQHHEST 244
            ++   F FD  +K             A  +AG+ A  + +P DVIKTR+    +  E+ 
Sbjct: 681 KDI---FNFDPKDKTKRNRLKTWELLVAGALAGMPAAFLTTPFDVIKTRLQVDPRKGETR 737

Query: 245 LK----VLSSSIRNEGLGFMFRGWLPSFARLGP 273
            K       + ++ E +   F+G      R  P
Sbjct: 738 YKGIFHAAKTILKEESIRSFFKGGGARVLRSSP 770

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 77/177 (43%), Gaps = 15/177 (8%)

Query: 115 SGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNL 174
           +G IG  V  P D +  RMQ   +        YKN++D + ++ K EGVR L +GLG  L
Sbjct: 516 AGCIGATVVYPIDFIKTRMQVQRSLSK-----YKNSLDCLIKVVKTEGVRGLYSGLGFQL 570

Query: 175 VRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATT----ICSPADVI 230
           +      A ++   D  +  L+   G        H  A +++G  A T      +P +++
Sbjct: 571 IGVAPEKAIKLTVNDFLRKKLIDKQG------NLHAFAEVLSGASAGTCQVIFTNPIEIV 624

Query: 231 KTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           K R+    +   +     S  I++ G+  +++G      R  P + + F     L+K
Sbjct: 625 KIRLQVKSESVANASLTASQIIKSLGIKGLYKGVTACLMRDVPFSAIYFPTYAHLKK 681

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 2/81 (2%)

Query: 209 HFTASLVAGLVATTICSPADVIKTR--IMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLP 266
           +F     AG +  T+  P D IKTR  +  +   ++++L  L   ++ EG+  ++ G   
Sbjct: 509 NFILGSAAGCIGATVVYPIDFIKTRMQVQRSLSKYKNSLDCLIKVVKTEGVRGLYSGLGF 568

Query: 267 SFARLGPNTILIFLVVEQLRK 287
               + P   +   V + LRK
Sbjct: 569 QLIGVAPEKAIKLTVNDFLRK 589

>YPR011C Chr16 complement(583062..584042) [981 bp, 326 aa] {ON}
           Putative transporter, member of the mitochondrial
           carrier family; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 326

 Score = 70.5 bits (171), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 132/292 (45%), Gaps = 31/292 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPT---LFSMIQRILKNDGPLGLYSGLTASIL 76
           GGV G V+  +  P +  K+ LQ  +        +FS I+++   +G  GL+ G   + +
Sbjct: 29  GGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCI 88

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCS-MISGAIGG----FVGNPADVVNI 131
           R   Y+  +F  Y+  K+ L   +  N    L     + SGA+ G        P D++  
Sbjct: 89  RIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKT 148

Query: 132 RMQNDSAHEPHLRRNYKNAID---GVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY 188
           R+   +A+   L R+   +I    G+ ++  E    +L  GL   L RGV  T+  VV Y
Sbjct: 149 RLSIQTANLSSLNRSKAKSISKPPGIWQLLSE--TYRLEGGL-RGLYRGVWPTSLGVVPY 205

Query: 189 ---DVCKHNLVTTFGFDASEKKTHFTASL-------VAGLVATTICSPADVIKTRI---- 234
              +   +  +  FG ++S+ +  + ++L       ++G VA TI  P D+++ R     
Sbjct: 206 VALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLA 265

Query: 235 MNAHQ---HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           M  ++    + S    L +  R EG+   ++G   +  ++ P+T + +LV E
Sbjct: 266 MGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317

 Score = 63.9 bits (154), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 93/198 (46%), Gaps = 28/198 (14%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPN 173
           ++GA+   V +P + V I +Q  S+   + R         + +++ EEG + L  G G N
Sbjct: 31  VAGAVSRTVVSPFERVKILLQVQSSTTSYNR----GIFSSIRQVYHEEGTKGLFRGNGLN 86

Query: 174 LVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH----FTASLVAG--LVATTICSPA 227
            +R    +A Q V Y+ CK  L    G +  E+ T+    F+ +L  G  +VAT    P 
Sbjct: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATY---PL 143

Query: 228 DVIKTRI----MNAHQHHESTLK----------VLSSSIRNE-GLGFMFRGWLPSFARLG 272
           D+IKTR+     N    + S  K          +LS + R E GL  ++RG  P+   + 
Sbjct: 144 DLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGVV 203

Query: 273 PNTILIFLVVEQLRKYEI 290
           P   L F V EQLR++ +
Sbjct: 204 PYVALNFAVYEQLREFGV 221

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 85/193 (44%), Gaps = 25/193 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRL--QTA-------------ARPKPTLFSMIQRILKNDGP 64
           G + G  + + T+PLDL K RL  QTA             ++P P ++ ++    + +G 
Sbjct: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKP-PGIWQLLSETYRLEGG 187

Query: 65  L-GLYSGLTASILRQCTYTTARFGCYDFIKE------NLLPADKLNSTLYLLPCSMISGA 117
           L GLY G+  + L    Y    F  Y+ ++E      +  P+ K  S LY L    ISG 
Sbjct: 188 LRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWK--SNLYKLTIGAISGG 245

Query: 118 IGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG 177
           +   +  P D++  R Q  +     L   Y +  D +  I + EGV     GL  NL + 
Sbjct: 246 VAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKV 305

Query: 178 VLMTASQVVSYDV 190
           V  TA   + Y+V
Sbjct: 306 VPSTAVSWLVYEV 318

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 7/84 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTL-------FSMIQRILKNDGPLGLYSGLT 72
           G + G VA  IT+P DL + R Q  A     L       +  +  I + +G  G Y GL 
Sbjct: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299

Query: 73  ASILRQCTYTTARFGCYDFIKENL 96
           A++ +    T   +  Y+ + +++
Sbjct: 300 ANLFKVVPSTAVSWLVYEVVCDSV 323

>YBR104W Chr2 (449667..450656) [990 bp, 329 aa] {ON}
           YMC2Mitochondrial protein, putative inner membrane
           transporter with a role in oleate metabolism and
           glutamate biosynthesis; member of the mitochondrial
           carrier (MCF) family; has similarity with Ymc1p
          Length = 329

 Score = 70.5 bits (171), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 76/306 (24%), Positives = 130/306 (42%), Gaps = 35/306 (11%)

Query: 8   SSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGL 67
           SSN V+K   + G +GGI   ++  P D  KVRLQTA     TL  +++ ++KN+G    
Sbjct: 30  SSNRVLK-DIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTTL-EVLRNLVKNEGVFAF 87

Query: 68  YSGLTASILRQCTYTTARFGCYDFIKE-----------NLLPADKLNSTLYLLP------ 110
           Y G    +L      + +FG  + +K            N+   D   S    LP      
Sbjct: 88  YKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYV 147

Query: 111 CSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGL 170
           C +  G +  F+ +P + + IR+Q  +++     R +K   D + ++  + G   L+ GL
Sbjct: 148 CGLTGGVVNSFLASPIEQIRIRLQTQTSNGGD--REFKGPWDCIKKLKAQGG---LMRGL 202

Query: 171 GPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASE----KKTHFTASLVAGLVATTICSP 226
            P ++R      +  + Y+      + T G   +E    K   F A   +G +      P
Sbjct: 203 FPTMIRAGHGLGTYFLVYEALVAREIGT-GLTRNEIPPWKLCLFGA--FSGTMLWLTVYP 259

Query: 227 ADVIKTRIMNAH----QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVV 282
            DV+K+ I N      ++  S   V  +    EG+   F+G+ P+  R  P     FL  
Sbjct: 260 LDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTF 319

Query: 283 EQLRKY 288
           E + ++
Sbjct: 320 ELVMRF 325

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 80/201 (39%), Gaps = 29/201 (14%)

Query: 112 SMISGAIGG----FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
            + +G IGG     VG P D   +R+Q  +     L        + +  + K EGV    
Sbjct: 37  DIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTTL--------EVLRNLVKNEGVFAFY 88

Query: 168 TG-LGPNLVRGVLMTASQVVS---------YDVCKHNLVTTFGFDASEKKT-----HFTA 212
            G L P L  G+ ++    V+         Y+  K+  +++   D S   T     ++  
Sbjct: 89  KGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVC 148

Query: 213 SLVAGLVATTICSPADVIKTRIMNAHQHH-ESTLKVLSSSIRN-EGLGFMFRGWLPSFAR 270
            L  G+V + + SP + I+ R+     +  +   K     I+  +  G + RG  P+  R
Sbjct: 149 GLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIR 208

Query: 271 LGPNTILIFLVVEQLRKYEIG 291
            G      FLV E L   EIG
Sbjct: 209 AGHGLGTYFLVYEALVAREIG 229

>KAFR0C00210 Chr3 complement(34033..34956) [924 bp, 307 aa] {ON}
           Anc_3.316 YBL030C
          Length = 307

 Score = 70.1 bits (170), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 81/194 (41%), Gaps = 27/194 (13%)

Query: 1   MSGTKSESSNAVVKYPWWY------GGVGGIVACIITHPLDLAKVRLQTAARPKPT---- 50
           M G K E       Y  W+      GG+ G ++ +  + LD A+ RL   A+   T    
Sbjct: 103 MFGFKKEEG-----YGKWFAGNLASGGLAGGLSLMFVYSLDYARTRLAADAKSTKTGGSR 157

Query: 51  ----LFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
               L  + ++ LK+DG  GLY G   S+     Y    FG YD  K  LL      S L
Sbjct: 158 QFNGLIDVYKKTLKSDGVAGLYRGFLPSVAGIIVYRGLYFGLYDSTKPLLLTGSLEGSFL 217

Query: 107 --YLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
             +LL  ++ +GA       P D V  RM   S         Y  A D   +I   EGV+
Sbjct: 218 ASFLLGWAVTTGA--STCSYPLDTVRRRMMMTSGQAVK----YNGAFDCCRQIVAAEGVK 271

Query: 165 KLLTGLGPNLVRGV 178
            L  G G N++RGV
Sbjct: 272 SLFKGCGANILRGV 285

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 70/171 (40%), Gaps = 19/171 (11%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSA--HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S AI     +P + V + +QN      +  L   Y   +D   R  K EG+     G  
Sbjct: 21  VSAAIAKTAASPIERVKLLIQNQDEMIKQGSLDHRYNGIVDCFRRTAKSEGIIAFWRGNT 80

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH-FTASL----VAGLVATTICSP 226
            N++R      +Q +++   K  +   FGF   E     F  +L    +AG ++      
Sbjct: 81  ANVIR---YFPTQALNF-AFKDKIKAMFGFKKEEGYGKWFAGNLASGGLAGGLSLMFVYS 136

Query: 227 ADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFA 269
            D  +TR+            +     + V   +++++G+  ++RG+LPS A
Sbjct: 137 LDYARTRLAADAKSTKTGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVA 187

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 103/281 (36%), Gaps = 32/281 (11%)

Query: 5   KSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPT---------LFSMI 55
           K   SN ++ +    GGV   +A     P++  K+ +Q                 +    
Sbjct: 6   KQMESNFLIDF--LMGGVSAAIAKTAASPIERVKLLIQNQDEMIKQGSLDHRYNGIVDCF 63

Query: 56  QRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMIS 115
           +R  K++G +  + G TA+++R        F   D IK  +    K          ++ S
Sbjct: 64  RRTAKSEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKA-MFGFKKEEGYGKWFAGNLAS 122

Query: 116 GAIGG-----FVGNPADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTG 169
           G + G     FV    D    R+  D+ + +    R +   ID   +  K +GV  L  G
Sbjct: 123 GGLAGGLSLMFV-YSLDYARTRLAADAKSTKTGGSRQFNGLIDVYKKTLKSDGVAGLYRG 181

Query: 170 LGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATT---ICS- 225
             P++   ++        YD  K  L+T         +  F AS + G   TT    CS 
Sbjct: 182 FLPSVAGIIVYRGLYFGLYDSTKPLLLT------GSLEGSFLASFLLGWAVTTGASTCSY 235

Query: 226 PADVIKTRIMNAHQH---HESTLKVLSSSIRNEGLGFMFRG 263
           P D ++ R+M        +          +  EG+  +F+G
Sbjct: 236 PLDTVRRRMMMTSGQAVKYNGAFDCCRQIVAAEGVKSLFKG 276

>Kwal_27.11419 s27 (794064..794960) [897 bp, 298 aa] {ON} YDL119C -
           Hypothetical ORF [contig 27] FULL
          Length = 298

 Score = 70.1 bits (170), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 118/295 (40%), Gaps = 40/295 (13%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G VGG+ + +I  P DL K RLQ        L  +++ I   + P  L+ G   S LR  
Sbjct: 14  GFVGGLTSAVILQPFDLLKTRLQQ--NKSSNLLDVVRSI---ETPGQLWKGTLPSALRTS 68

Query: 80  TYTTARFGCYDFIKENLLP------ADKLNSTLYLLPCSM----ISGAIG----GFVGNP 125
             +       + ++  +        A K  S+ +L   SM    ISGAI     G    P
Sbjct: 69  VGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVATMP 128

Query: 126 ADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQV 185
             V+ +R ++          NYK+  +  T I++ EG+R L +G G  ++R        V
Sbjct: 129 ITVLKVRFEST-------MYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLYV 181

Query: 186 VSYDVCK-------------HNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKT 232
           + Y+  K             HN    F    S       A   A L ATTI SP D IKT
Sbjct: 182 LFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASL-ATTITSPFDTIKT 240

Query: 233 RIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           R+      +   ++   S IR E    +F G     +R   +  + + + E+L K
Sbjct: 241 RMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGIYEELVK 295

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 207 KTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLP 266
           ++HF    V GL +  I  P D++KTR+    Q+  S L  +  SI  E  G +++G LP
Sbjct: 8   RSHFIGGFVGGLTSAVILQPFDLLKTRL---QQNKSSNLLDVVRSI--ETPGQLWKGTLP 62

Query: 267 SFARLGPNTILIFLVVEQLR 286
           S  R    + L    +  +R
Sbjct: 63  SALRTSVGSALFLSTLNIVR 82

>YBL030C Chr2 complement(163041..163997) [957 bp, 318 aa] {ON}
           PET9Major ADP/ATP carrier of the mitochondrial inner
           membrane, exchanges cytosolic ADP for mitochondrially
           synthesized ATP; also imports heme and ATP;
           phosphorylated; required for viability in many lab
           strains that carry a sal1 mutation
          Length = 318

 Score = 70.1 bits (170), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 81/194 (41%), Gaps = 27/194 (13%)

Query: 1   MSGTKSESSNAVVKYPWWY------GGVGGIVACIITHPLDLAKVRL--------QTAAR 46
           M G K E       Y  W+      GG  G ++ +  + LD A+ RL        +  AR
Sbjct: 114 MFGFKKEEG-----YAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGAR 168

Query: 47  PKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
               L  + ++ LK+DG  GLY G   S++    Y    FG YD +K  LL      S L
Sbjct: 169 QFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFL 228

Query: 107 --YLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
             +LL   + +GA       P D V  RM   S         Y  A D + +I   EGV 
Sbjct: 229 ASFLLGWVVTTGA--STCSYPLDTVRRRMMMTSGQAVK----YDGAFDCLRKIVAAEGVG 282

Query: 165 KLLTGLGPNLVRGV 178
            L  G G N++RGV
Sbjct: 283 SLFKGCGANILRGV 296

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 101/266 (37%), Gaps = 30/266 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ---------TAARPKPTLFSMIQRILKNDGPLGLYSG 70
           GGV   VA     P++  K+ +Q         T  R    +    +R    +G +  + G
Sbjct: 30  GGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWRG 89

Query: 71  LTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNP 125
            TA+++R        F   D IK  +    K          ++ SG   G     FV   
Sbjct: 90  NTANVIRYFPTQALNFAFKDKIKA-MFGFKKEEGYAKWFAGNLASGGAAGALSLLFV-YS 147

Query: 126 ADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
            D    R+  DS + +    R +   ID   +  K +GV  L  G  P++V  V+     
Sbjct: 148 LDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLY 207

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATT---ICS-PADVIKTRIMNAHQH 240
              YD  K  L+T         +  F AS + G V TT    CS P D ++ R+M     
Sbjct: 208 FGMYDSLKPLLLT------GSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQ 261

Query: 241 ---HESTLKVLSSSIRNEGLGFMFRG 263
              ++     L   +  EG+G +F+G
Sbjct: 262 AVKYDGAFDCLRKIVAAEGVGSLFKG 287

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 69/169 (40%), Gaps = 19/169 (11%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSA--HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S A+     +P + V + +QN      +  L R Y   +D   R   +EGV     G  
Sbjct: 32  VSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWRGNT 91

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH-FTASLV----AGLVATTICSP 226
            N++R      +Q +++   K  +   FGF   E     F  +L     AG ++      
Sbjct: 92  ANVIR---YFPTQALNF-AFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSLLFVYS 147

Query: 227 ADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
            D  +TR+            +     + V   +++++G+  ++RG+LPS
Sbjct: 148 LDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPS 196

>Kpol_1019.4 s1019 complement(8405..9343) [939 bp, 312 aa] {ON}
           complement(8405..9343) [939 nt, 313 aa]
          Length = 312

 Score = 70.1 bits (170), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 79/198 (39%), Gaps = 23/198 (11%)

Query: 9   SNAVVKYPWWY------GGVGGIVACIITHPLDLAKVRLQTAARPKPTL----------F 52
           +  V  Y  W+      GG  G ++    + LD A+ RL   AR    L           
Sbjct: 108 TKEVDGYGKWFAGNLFSGGAAGALSLSFVYSLDYARTRLAADARASHELKGQQRQFNGLL 167

Query: 53  SMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCS 112
            + ++ +  DG +GLY G   S++    Y    FG YD +K  LL     NS +      
Sbjct: 168 DVYKKTMATDGFVGLYRGFVPSVIGIIVYRGLYFGLYDSLKPILLTGKMANSFIASFALG 227

Query: 113 MISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGP 172
            +   +   +  P D V  RM   S         YK A D  T+I   EG + L  G G 
Sbjct: 228 WVITTVASTISYPLDTVRRRMMMTSGQTI----KYKGAYDCFTQILTTEGPKSLFKGCGA 283

Query: 173 NLVRGVLMTASQVVS-YD 189
           N+ R V   A+ V+S YD
Sbjct: 284 NIFRSV--AAAGVISLYD 299

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/264 (21%), Positives = 97/264 (36%), Gaps = 23/264 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ---------TAARPKPTLFSMIQRILKNDGPLGLYSG 70
           GG+   +A     P++  K+ +Q         T  R    +    +R  K  G L  + G
Sbjct: 20  GGISAAIAKTGAAPIERVKLMMQNQDEMVKQGTLDRKYEGIIDCFKRTAKTQGVLSFWRG 79

Query: 71  LTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNP 125
            TA+++R        F   D IK       +++        ++ SG   G     FV   
Sbjct: 80  NTANVIRYFPTQALNFAFKDHIKGMFGYTKEVDGYGKWFAGNLFSGGAAGALSLSFV-YS 138

Query: 126 ADVVNIRMQNDSAHEPHLR---RNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTA 182
            D    R+  D+     L+   R +   +D   +    +G   L  G  P+++  ++   
Sbjct: 139 LDYARTRLAADARASHELKGQQRQFNGLLDVYKKTMATDGFVGLYRGFVPSVIGIIVYRG 198

Query: 183 SQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQH-- 240
                YD  K  L+T  G  A+     F    V   VA+TI  P D ++ R+M       
Sbjct: 199 LYFGLYDSLKPILLT--GKMANSFIASFALGWVITTVASTISYPLDTVRRRMMMTSGQTI 256

Query: 241 -HESTLKVLSSSIRNEGLGFMFRG 263
            ++      +  +  EG   +F+G
Sbjct: 257 KYKGAYDCFTQILTTEGPKSLFKG 280

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 72/172 (41%), Gaps = 22/172 (12%)

Query: 114 ISGAIGGFVGNPADVVNIRMQN--DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           IS AI      P + V + MQN  +   +  L R Y+  ID   R  K +GV     G  
Sbjct: 22  ISAAIAKTGAAPIERVKLMMQNQDEMVKQGTLDRKYEGIIDCFKRTAKTQGVLSFWRGNT 81

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGF--DASEKKTHFTASL----VAGLVATTICS 225
            N++R      +Q +++   K ++   FG+  +       F  +L     AG ++ +   
Sbjct: 82  ANVIR---YFPTQALNF-AFKDHIKGMFGYTKEVDGYGKWFAGNLFSGGAAGALSLSFVY 137

Query: 226 PADVIKTRI-MNAHQHHE---------STLKVLSSSIRNEGLGFMFRGWLPS 267
             D  +TR+  +A   HE           L V   ++  +G   ++RG++PS
Sbjct: 138 SLDYARTRLAADARASHELKGQQRQFNGLLDVYKKTMATDGFVGLYRGFVPS 189

>KNAG0A07830 Chr1 (1244679..1245653) [975 bp, 324 aa] {ON} Anc_3.463
           YPR128C
          Length = 324

 Score = 70.1 bits (170), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 123/286 (43%), Gaps = 43/286 (15%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPK---------PTL----------FSMIQRILK 60
           G V   +A  + +PLDL+K  +Q+  R +         PT+             +  ILK
Sbjct: 10  GAVSSALANAVVYPLDLSKTLIQSQTRKETATESQGKGPTIAHPEKKYRNVIDCMVDILK 69

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDF---------IKENLLPADKLN-STLYLLP 110
             GP GLY GLTAS +         F  Y           +++NL+   KL  STL  L 
Sbjct: 70  QKGPRGLYQGLTASTVGTFVMNFCYFFWYTLFRQRYINMKLRQNLVSHRKLALSTLEELA 129

Query: 111 CSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGL 170
             +++ A+     +P  V+  R Q  ++H+P   +     I+ + +++KE      +T  
Sbjct: 130 IGVVAAAMSQVFTSPIAVIATRQQ--TSHDPEQAK----MINVIKQVYKESNGD--ITAF 181

Query: 171 GPNLVRGVLMTASQVV---SYDVCKHNLV---TTFGFDASEKKTHFTASLVAGLVATTIC 224
              L  G+++T +  +   SY   K  L     T G D      +FT  +++ +++T   
Sbjct: 182 WKGLKVGLMLTLNPSITYASYQRLKKILFHRGETSGSDTLTVSQNFTLGVISKMISTLAT 241

Query: 225 SPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFAR 270
            P  V K  +  A    ++  +VL    ++EGL  +++G +P   +
Sbjct: 242 QPLIVAKASLQRAGSKFKTFQEVLLHYYKDEGLHGLWKGVIPQLVK 287

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 75/173 (43%), Gaps = 24/173 (13%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARP-KPTLFSMIQRILK-NDGPL-----GLYSGLT 72
           G V   ++ + T P+ +   R QT+  P +  + ++I+++ K ++G +     GL  GL 
Sbjct: 131 GVVAAAMSQVFTSPIAVIATRQQTSHDPEQAKMINVIKQVYKESNGDITAFWKGLKVGLM 190

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYL-----LPCSMISGAIGGFVGNPAD 127
            ++    TY +     Y  +K+ L    + + +  L         +IS  I      P  
Sbjct: 191 LTLNPSITYAS-----YQRLKKILFHRGETSGSDTLTVSQNFTLGVISKMISTLATQPLI 245

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180
           V    +Q   +        +K   + +   +K+EG+  L  G+ P LV+GVL+
Sbjct: 246 VAKASLQRAGS-------KFKTFQEVLLHYYKDEGLHGLWKGVIPQLVKGVLV 291

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 35/75 (46%)

Query: 3   GTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKND 62
           G  S S    V   +  G +  +++ + T PL +AK  LQ A     T   ++    K++
Sbjct: 213 GETSGSDTLTVSQNFTLGVISKMISTLATQPLIVAKASLQRAGSKFKTFQEVLLHYYKDE 272

Query: 63  GPLGLYSGLTASILR 77
           G  GL+ G+   +++
Sbjct: 273 GLHGLWKGVIPQLVK 287

>NCAS0I01330 Chr9 complement(239364..240377) [1014 bp, 337 aa] {ON}
           Anc_3.316 YBL030C
          Length = 337

 Score = 70.1 bits (170), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 81/194 (41%), Gaps = 27/194 (13%)

Query: 1   MSGTKSESSNAVVKYPWWY------GGVGGIVACIITHPLDLAKVRL--------QTAAR 46
           M G K E       Y  W+      GG  G ++ +  + LD A+ RL        +  +R
Sbjct: 133 MFGFKKEDG-----YGKWFAGNLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSR 187

Query: 47  PKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
               L  + ++ LK+DG  GLY G   S++    Y    FG YD IK  LL      S L
Sbjct: 188 QFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFL 247

Query: 107 --YLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
             +LL   + +GA       P D V  +M   S         YK A D   +I   EGV 
Sbjct: 248 ASFLLGWVVTTGA--STCSYPLDTVRRKMMMTSGQAVK----YKGAFDCFKKIVAAEGVA 301

Query: 165 KLLTGLGPNLVRGV 178
            L  G G N++RGV
Sbjct: 302 SLFKGCGANILRGV 315

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 109/285 (38%), Gaps = 33/285 (11%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQ---------TAARPKPTL 51
           MS  K +S+ A+    +  GGV   VA     P++  K+ +Q         T       +
Sbjct: 33  MSTEKPQSNFAI---DFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGI 89

Query: 52  FSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPC 111
               +R  + +G +  + G TA+++R        F   D IK  +    K +        
Sbjct: 90  VDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKL-MFGFKKEDGYGKWFAG 148

Query: 112 SMISGAIGG-----FVGNPADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRK 165
           ++ SG   G     FV    D    R+  DS + +    R +   ID   +  K +GV  
Sbjct: 149 NLASGGAAGGLSLLFV-YSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAG 207

Query: 166 LLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATT--- 222
           L  G  P++V  ++        YD  K  L+T         +  F AS + G V TT   
Sbjct: 208 LYRGFLPSVVGIIVYRGLYFGLYDSIKPVLLT------GSLEGSFLASFLLGWVVTTGAS 261

Query: 223 ICS-PADVIKTRIMNAHQH---HESTLKVLSSSIRNEGLGFMFRG 263
            CS P D ++ ++M        ++         +  EG+  +F+G
Sbjct: 262 TCSYPLDTVRRKMMMTSGQAVKYKGAFDCFKKIVAAEGVASLFKG 306

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 71/169 (42%), Gaps = 19/169 (11%)

Query: 114 ISGAIGGFVGNPADVVN--IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S A+     +P + V   I+ QN+   +  L   YK  +D   R  ++EG+     G  
Sbjct: 51  VSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIISFWRGNT 110

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH-FTASLVAGLVATTI----CSP 226
            N++R      +Q +++   K  +   FGF   +     F  +L +G  A  +       
Sbjct: 111 ANVIR---YFPTQALNF-AFKDKIKLMFGFKKEDGYGKWFAGNLASGGAAGGLSLLFVYS 166

Query: 227 ADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
            D  +TR+            +     + V   +++++G+  ++RG+LPS
Sbjct: 167 LDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPS 215

>TPHA0C01180 Chr3 (272119..273048) [930 bp, 309 aa] {ON} Anc_7.228
           YER053C
          Length = 309

 Score = 69.7 bits (169), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 123/289 (42%), Gaps = 32/289 (11%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLF-SMIQ---RILKNDGPLG-LYSGLT 72
           +GGI+AC  TH    PLDL K RLQ      PTL+ S +Q    I+  +G    +++G+ 
Sbjct: 24  LGGIIACGPTHSSVTPLDLVKCRLQV----DPTLYKSNLQGWKTIVSTEGGFSKVFTGVG 79

Query: 73  ASILRQCTYTTARFGCYDFIKEN------LLPADKLNSTLYL-LPCSMISGAIGGFVGNP 125
           A+ +        ++G Y+F K        + P    N ++++ L  S  +  +   +  P
Sbjct: 80  ATFIGYSLQGAGKYGGYEFFKHYYSTLSFVTPEFVQNHSVWIYLGASATAEFLADIMLCP 139

Query: 126 ADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQV 185
            + + ++ Q  +   P       N   G ++I+ +EG++    G+ P   R +  T  + 
Sbjct: 140 LEAIKVKQQ--TTMPPFCN----NVFQGFSKIYTQEGLKAFYKGIVPLWFRQIPYTMVKF 193

Query: 186 VSYDVCKHNLVTTFGFDASEKK------THFTASLVAGLVATTICSPADVIKTRIMNAHQ 239
            S++     +        SE          FT   +AG++   +  PADV+ ++I N  +
Sbjct: 194 TSFEKIVEAIYAKLPVKKSELSPLQQISVSFTGGYLAGILCAIVSHPADVMVSKINNGRK 253

Query: 240 HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKY 288
             ES  +  +   +  G   ++ G       +G  T   +L+ +  + Y
Sbjct: 254 ATESMSQATNRIYKQIGFKGLWNGLPVRIVMIGTLTSFQWLIYDSFKAY 302

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + GI+  I++HP D+   ++    +   ++     RI K  G  GL++GL   I+   
Sbjct: 227 GYLAGILCAIVSHPADVMVSKINNGRKATESMSQATNRIYKQIGFKGLWNGLPVRIVMIG 286

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 287 TLTSFQWLIYDSFK 300

>Suva_2.89 Chr2 complement(163097..164053) [957 bp, 318 aa] {ON}
           YBL030C (REAL)
          Length = 318

 Score = 69.7 bits (169), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 81/194 (41%), Gaps = 27/194 (13%)

Query: 1   MSGTKSESSNAVVKYPWWY------GGVGGIVACIITHPLDLAKVRL--------QTAAR 46
           M G K E       Y  W+      GG  G ++ +  + LD A+ RL        +  AR
Sbjct: 114 MFGFKKEEG-----YGKWFAGNLASGGAAGALSLMFVYSLDYARTRLAADSKSSKKGGAR 168

Query: 47  PKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
               L  + ++ LK+DG  GLY G   S++    Y    FG YD +K  LL      S L
Sbjct: 169 QFNGLVDVYRKTLKSDGIAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPVLLTGSLEGSFL 228

Query: 107 --YLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
             +LL   + +GA       P D V  RM   S         Y  A D + +I   EGV 
Sbjct: 229 ASFLLGWVVTTGA--STCSYPLDTVRRRMMMTSGQAIK----YDGAFDCMRKIIAAEGVS 282

Query: 165 KLLTGLGPNLVRGV 178
            L  G G N++RGV
Sbjct: 283 SLFKGCGANILRGV 296

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 101/266 (37%), Gaps = 30/266 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ---------TAARPKPTLFSMIQRILKNDGPLGLYSG 70
           GGV   VA     P++  K+ +Q         T  R    +    +R  + +G +  + G
Sbjct: 30  GGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYGGILECFKRTAQQEGIISFWRG 89

Query: 71  LTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNP 125
            TA+++R        F   D IK  +    K          ++ SG   G     FV   
Sbjct: 90  NTANVIRYFPTQALNFAFKDKIKA-MFGFKKEEGYGKWFAGNLASGGAAGALSLMFV-YS 147

Query: 126 ADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
            D    R+  DS + +    R +   +D   +  K +G+  L  G  P++V  V+     
Sbjct: 148 LDYARTRLAADSKSSKKGGARQFNGLVDVYRKTLKSDGIAGLYRGFLPSVVGIVVYRGLY 207

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATT---ICS-PADVIKTRIMNAHQH 240
              YD  K  L+T         +  F AS + G V TT    CS P D ++ R+M     
Sbjct: 208 FGLYDSLKPVLLT------GSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQ 261

Query: 241 ---HESTLKVLSSSIRNEGLGFMFRG 263
              ++     +   I  EG+  +F+G
Sbjct: 262 AIKYDGAFDCMRKIIAAEGVSSLFKG 287

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 70/169 (41%), Gaps = 19/169 (11%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSA--HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S A+     +P + V + +QN      +  L R Y   ++   R  ++EG+     G  
Sbjct: 32  VSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYGGILECFKRTAQQEGIISFWRGNT 91

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH-FTASLV----AGLVATTICSP 226
            N++R      +Q +++   K  +   FGF   E     F  +L     AG ++      
Sbjct: 92  ANVIR---YFPTQALNF-AFKDKIKAMFGFKKEEGYGKWFAGNLASGGAAGALSLMFVYS 147

Query: 227 ADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
            D  +TR+            +     + V   +++++G+  ++RG+LPS
Sbjct: 148 LDYARTRLAADSKSSKKGGARQFNGLVDVYRKTLKSDGIAGLYRGFLPS 196

>KLTH0F15400g Chr6 (1257203..1258039) [837 bp, 278 aa] {ON} similar
           to uniprot|Q12375 Saccharomyces cerevisiae YOR130C ORT1
           Ornithine transporter of the mitochondrial inner
           membrane exports ornithine from mitochondria as part of
           arginine biosynthesis human ortholog is associated with
           hyperammonaemia- hyperornithinaemia-homocitrullinuria
           (HHH) syndrome
          Length = 278

 Score = 68.9 bits (167), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 106/269 (39%), Gaps = 7/269 (2%)

Query: 19  YGGVGGIVACIITHPLDLAKVRLQTA-ARPKPTLFSMIQRILKNDGPL-GLYSGLTASIL 76
           YG + G    +I +PLD  KVRLQT  A   PT +S I+    N+G L G Y G+++ ++
Sbjct: 12  YGSIAGAAGKVIEYPLDTIKVRLQTQPAHLFPTSWSCIKYTYANEGFLKGFYQGVSSPLV 71

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQND 136
                    F  ++  +  L   + L+     +     +GA   +V  P ++V   +Q  
Sbjct: 72  GAALENAVLFVTFNRAQNFLKQYESLSPLSLTVWSGAFAGACTSYVLTPVELVKCTLQ-- 129

Query: 137 SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLV 196
            ++  + + ++      V  I  + G+  L  G     +R     A    +Y+  K  L 
Sbjct: 130 VSNLKNSKTSHSKVWPTVKHIVSQNGISGLWRGQSSTFIRECAGGAVWFTTYESVKQYLA 189

Query: 197 TTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEG 256
                  ++     TA   AG+       PAD IK+    A   H   +      +   G
Sbjct: 190 NKRNDTENQTWELLTAGASAGVAFNASVFPADTIKS---TAQTEHLGIVNATKRILARNG 246

Query: 257 LGFMFRGWLPSFARLGPNTILIFLVVEQL 285
              ++RG   +  R  P   ++F   E L
Sbjct: 247 PAGLYRGLGITLIRAAPANAVVFYTYETL 275

>Smik_4.42 Chr4 complement(81864..82766) [903 bp, 300 aa] {ON}
           YDL198C (REAL)
          Length = 300

 Score = 69.3 bits (168), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 116/280 (41%), Gaps = 28/280 (10%)

Query: 24  GIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKND---GPLG-----LYSGLTASI 75
           GI+   + HP+D    RL +    K T    + R++  D    PLG     L+ GL  + 
Sbjct: 21  GIMEIAVFHPVDTISKRLMSN-HTKITSNHELNRVIFRDHFSEPLGKRLFTLFPGLGYAA 79

Query: 76  LRQCTYTTARFGCYDFIKENL---LPADKLNSTLYLLPCSMISGAIGGFVGN------PA 126
             +      ++G   F  E L      D  N        +M S A G  +G       P 
Sbjct: 80  SYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIGIGEIVLLPL 139

Query: 127 DVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
           DV+ I+ Q +    P   +       G  +I K+EG+  L  G G    R    + +   
Sbjct: 140 DVLKIKRQTN----PEAFKG-----RGFIKILKDEGLFNLYRGWGWTAARNAPGSFALFG 190

Query: 187 SYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAH-QHHESTL 245
                K  ++    +  +    +F +S+V    +  + +P DVIKTRI N +  + ES L
Sbjct: 191 GNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNKNFDNPESGL 250

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQL 285
           K++ ++++NEG+   F+G  P     GP  +  F + + L
Sbjct: 251 KIVKNTLKNEGITAFFKGLTPKLLTTGPKLVFSFALAQSL 290

 Score = 35.8 bits (81), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 22  VGGIVACIITHPLDLAKVRLQTAARPKP-TLFSMIQRILKNDGPLGLYSGLTASIL 76
           VG   + I++ PLD+ K R+Q      P +   +++  LKN+G    + GLT  +L
Sbjct: 219 VGACSSLIVSAPLDVIKTRIQNKNFDNPESGLKIVKNTLKNEGITAFFKGLTPKLL 274

>KLLA0B08503g Chr2 complement(753498..754409) [912 bp, 303 aa] {ON}
           similar to uniprot|P32331 Saccharomyces cerevisiae
           YPR058W YMC1 Putative mitochondrial inner membrane
           transporter member of the mitochondrial carrier (MCF)
           family
          Length = 303

 Score = 69.3 bits (168), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 124/278 (44%), Gaps = 21/278 (7%)

Query: 5   KSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGP 64
           +S   N  V      G  GGI   ++  P D  KVRLQT+      +  +I+ ++KN+GP
Sbjct: 15  ESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAV-KVIKDLIKNEGP 73

Query: 65  LGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNST-LYLLP---CSMISGAIGG 120
           +G Y G    ++      + +FG  + +K      D+  S  L LL    C +  G    
Sbjct: 74  MGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNS 133

Query: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180
           F+ +P + + IR+Q  +         +K  ID + ++ +  G  +L+ GL P ++R    
Sbjct: 134 FLASPIEHIRIRLQTQTGSGA--TAEFKGPIDCIKKL-RVNG--QLMRGLTPTMLRESHG 188

Query: 181 TASQVVSYDVCKHNLVTTFGFDASE----KKTHFTASLVAGLVATTICSPADVIK----T 232
                ++Y+    + V + G    +    K   F A+  +G +  T+  P DVIK    T
Sbjct: 189 CGVYFLTYEALIGHQVKS-GIQRKDIPAWKLCLFGAA--SGTLLWTMVYPLDVIKSVMQT 245

Query: 233 RIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFAR 270
             +   ++  + L V  + I  +G+  +F+G+ P+  R
Sbjct: 246 DNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 212 ASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARL 271
           A    G+    +  P D  K R+  + +   + +KV+   I+NEG    ++G L     +
Sbjct: 29  AGTAGGIAQVLVGQPFDTTKVRLQTS-ETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGV 87

Query: 272 GPNTILIFLVVEQLRKY 288
           G    L F V E ++++
Sbjct: 88  GACVSLQFGVNEAMKRF 104

>KNAG0A02470 Chr1 complement(246025..246927) [903 bp, 300 aa] {ON}
           Anc_8.445 YDL198C
          Length = 300

 Score = 69.3 bits (168), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 114/279 (40%), Gaps = 26/279 (9%)

Query: 24  GIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDG--PLG-----LYSGLTASIL 76
           GI+   + HP+D    RL +      +L  +   I K     PLG     L+ GL  +  
Sbjct: 21  GILEIGVFHPVDTISKRLMSNHTQVASLHELNTVIFKGAAAEPLGARFLSLFPGLGYAAC 80

Query: 77  RQCTYTTARFGCYDFIKENL---LPADKLNSTLYLLPCSMISGAIGGFVGN------PAD 127
            +      ++G   F  E L      D  ++       +M S A G  +G       P D
Sbjct: 81  YKVLQRVYKYGGQPFANEFLNKHFKKDFDSAFGTKTGKAMRSAAAGSMIGIGEIVLLPLD 140

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           V+ I+ Q +         ++K    G  RI ++EG+  L  G G    R    + +    
Sbjct: 141 VLKIKRQTNP-------ESFKG--RGFVRILRDEGLLNLYRGWGWTAARNAPGSFALFGG 191

Query: 188 YDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAH-QHHESTLK 246
               K  L+    +  +    +F +S+V    +  + +P DVIKTRI N +    ES  K
Sbjct: 192 NAFAKEYLLGLSDYSQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDSPESGFK 251

Query: 247 VLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQL 285
           ++ ++++NEG+   F+G  P     GP  +  F + + L
Sbjct: 252 IVRNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSL 290

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 22  VGGIVACIITHPLDLAKVRLQTAARPKP-TLFSMIQRILKNDGPLGLYSGLTASIL 76
           VG   + I++ PLD+ K R+Q      P + F +++  LKN+G    + GLT  +L
Sbjct: 219 VGASASLIVSAPLDVIKTRIQNRNFDSPESGFKIVRNTLKNEGVTAFFKGLTPKLL 274

>Suva_13.229 Chr13 complement(368562..369515) [954 bp, 317 aa] {ON}
           YMR056C (REAL)
          Length = 317

 Score = 69.3 bits (168), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 83/198 (41%), Gaps = 31/198 (15%)

Query: 15  YPWWY------GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------------LFSM 54
           Y  W+      GG  G ++ +  + LD A+ RL   AR   +              L  +
Sbjct: 116 YAKWFAGNLFSGGAAGGLSLMFVYSLDYARTRLAADARGSKSKSQPQSQSQRQFSGLLDV 175

Query: 55  IQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL--YLLPCS 112
            ++ LK DG LGLY G   S+     Y    FG YD  K  LL      S +  +LL   
Sbjct: 176 YKKTLKTDGVLGLYRGFLPSVFGIVVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWV 235

Query: 113 MISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGP 172
           +  GA       P D V  RM   S         Y  A+D + +I ++EGV  L  G G 
Sbjct: 236 ITVGA--STASYPLDTVRRRMMMTSGQAV----KYDGAMDCMRKIVQQEGVYSLFKGCGA 289

Query: 173 NLVRGVLMTASQVVS-YD 189
           N+ RGV   A+ V+S YD
Sbjct: 290 NIFRGV--AAAGVISLYD 305

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 61/272 (22%), Positives = 103/272 (37%), Gaps = 35/272 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAAR--PKPTLFSM-------IQRILKNDGPLGLYSG 70
           GGV   +A     P++  K+ +Q       + +L S         +R   ++G L  + G
Sbjct: 22  GGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDSRYLGIADCFKRTAAHEGILSFWRG 81

Query: 71  LTASILRQCTYTTARFGCYDFIKENL-LPADKLNSTLYLLPCSMISGAIGG----FVGNP 125
            TA++LR        F   D IK  L    D+     +        GA GG    FV   
Sbjct: 82  NTANVLRYFPTQALNFAFKDKIKSLLSYDRDRDGYAKWFAGNLFSGGAAGGLSLMFV-YS 140

Query: 126 ADVVNIRMQNDS-------AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGV 178
            D    R+  D+         +   +R +   +D   +  K +GV  L  G  P++   V
Sbjct: 141 LDYARTRLAADARGSKSKSQPQSQSQRQFSGLLDVYKKTLKTDGVLGLYRGFLPSVFGIV 200

Query: 179 LMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLV----ATTICSPADVIKTRI 234
           +        YD  K  L+T         +  F AS + G V    A+T   P D ++ R+
Sbjct: 201 VYRGLYFGLYDSFKPVLLT------GALEGSFVASFLLGWVITVGASTASYPLDTVRRRM 254

Query: 235 MNAHQH---HESTLKVLSSSIRNEGLGFMFRG 263
           M        ++  +  +   ++ EG+  +F+G
Sbjct: 255 MMTSGQAVKYDGAMDCMRKIVQQEGVYSLFKG 286

>KLLA0E13443g Chr5 complement(1184806..1187526) [2721 bp, 906 aa]
           {ON} similar to uniprot|Q12482 Saccharomyces cerevisiae
           YPR021C AGC1 Mitochondrial transporter acts both as a
           glutamate uniporter and as an aspartate-glutamate
           exchanger involved in nitrogen metabolism ornithine
           synthesis and the malate-aspartate NADH shuttle
          Length = 906

 Score = 70.1 bits (170), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 114/274 (41%), Gaps = 33/274 (12%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRILKNDGPLGLYSGLTASIL 76
           G + G +   + +P+DL K R+Q    + + K ++   + +I +  G  GLYSGL   ++
Sbjct: 511 GSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSI-DCVVKIFQTKGIRGLYSGLGPQLI 569

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQND 136
                   +    DF+++  +   +       +     +GA      NP ++V IR+Q  
Sbjct: 570 GVAPEKAIKLTVNDFMRQYFMNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMR 629

Query: 137 SAH-----EPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
           S +      P L         G   I ++ G+R L  G    L+R V  +A    +Y   
Sbjct: 630 SDYVGENARPQL---------GAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHL 680

Query: 192 KHNLVTTFGFDASEKKTH--------FTASLVAGLVATTICSPADVIKTRIMNAHQHHES 243
           K ++   F FD ++K             A  +AG+ A  + +P DVIKTR+    +  E+
Sbjct: 681 KKDV---FNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGET 737

Query: 244 T----LKVLSSSIRNEGLGFMFRGWLPSFARLGP 273
           T    +    + ++ E +   F+G      R  P
Sbjct: 738 TYTGVIHAARTILKEESIKSFFKGGPARVLRSSP 771

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 72/174 (41%), Gaps = 27/174 (15%)

Query: 18  WY-----GGVGGIVACIITHPLDLAKVRLQ-------TAARPKPTLFSMIQRILKNDGPL 65
           WY     G   G    + T+PL++ K+RLQ         ARP+     +I+++    G  
Sbjct: 598 WYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENARPQLGAVGIIRQL----GLR 653

Query: 66  GLYSGLTASILRQCTYTTARFGCYDFIKE---NLLPADKLN----STLYLLPCSMISGAI 118
           GLY G  A +LR   ++   F  Y  +K+   N  P DK       T  LL    I+G  
Sbjct: 654 GLYKGAAACLLRDVPFSAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMP 713

Query: 119 GGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGP 172
             ++  P DV+  R+Q D          Y   I     I KEE ++    G GP
Sbjct: 714 AAYLTTPFDVIKTRLQIDPRKG---ETTYTGVIHAARTILKEESIKSFFKG-GP 763

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 83/186 (44%), Gaps = 28/186 (15%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRN---YKNAIDGVTRIFKEEGVRKLLTGL 170
           I+G IG  V  P D+V  RMQ         +RN   YKN+ID V +IF+ +G+R L +GL
Sbjct: 513 IAGCIGATVVYPIDLVKTRMQ--------AQRNSVQYKNSIDCVVKIFQTKGIRGLYSGL 564

Query: 171 GPNLV-----RGVLMTASQVV-SYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTIC 224
           GP L+     + + +T +  +  Y + K   +  +            +   AG       
Sbjct: 565 GPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKWY--------QEILSGATAGACQVVFT 616

Query: 225 SPADVIKTRI-MNAHQHHESTLKVLSSS--IRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
           +P +++K R+ M +    E+    L +   IR  GL  +++G      R  P + + F  
Sbjct: 617 NPLEIVKIRLQMRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPT 676

Query: 282 VEQLRK 287
              L+K
Sbjct: 677 YAHLKK 682

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMI----QRILKNDGPLGLYSGLTASI 75
           GG+ G+ A  +T P D+ K RLQ   R   T ++ +    + ILK +     + G  A +
Sbjct: 707 GGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKGGPARV 766

Query: 76  LR---QCTYTTARFGCY 89
           LR   Q  +T A F  +
Sbjct: 767 LRSSPQFGFTLAAFEMF 783

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 43/83 (51%), Gaps = 4/83 (4%)

Query: 209 HFTASLVAGLVATTICSPADVIKTRIMNAHQH---HESTLKVLSSSIRNEGLGFMFRGWL 265
           +FT   +AG +  T+  P D++KTR M A ++   +++++  +    + +G+  ++ G  
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTR-MQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGLG 565

Query: 266 PSFARLGPNTILIFLVVEQLRKY 288
           P    + P   +   V + +R+Y
Sbjct: 566 PQLIGVAPEKAIKLTVNDFMRQY 588

>NCAS0H02170 Chr8 complement(423631..424548) [918 bp, 305 aa] {ON} 
          Length = 305

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 120/293 (40%), Gaps = 33/293 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQT-AARPKPTLFSMIQRILKNDGPL-GLYSGLTASILR 77
           G + G +   I +P D  KVRLQT  A   P+ +S I+   +N+G L G Y G+ + ++ 
Sbjct: 19  GSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCIKYTYENEGILEGFYQGIESPLIG 78

Query: 78  QCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDS 137
                   F  Y+     L    + ++ L +L  +  +G+   FV  P +++  ++Q  +
Sbjct: 79  AALENAILFLAYNQCSSFLNAFTEFSAFLIILISAGFAGSCASFVLTPVELIKCKLQISN 138

Query: 138 AHEPHLRRN--------------------YKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG 177
            H   L  N                    +   I  +  I KE+G+  L  G     +R 
Sbjct: 139 LHYS-LHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQGQSSTFIRE 197

Query: 178 VLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFT---ASLVAGLVATTICSPADVIKTRI 234
            + +     +Y++ K  L        SE  T +    +   AGL       PAD +K+ I
Sbjct: 198 SIGSVVWFATYELMKQTLRD----PKSEVNTTWQLLISGATAGLAFNGSVFPADTVKS-I 252

Query: 235 MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
           M     H + ++ + S +  +G+   +RG   +  R  P+   +F   E+L K
Sbjct: 253 M--QTEHLALMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYTYEKLSK 303

>Kpol_1043.20 s1043 complement(39128..40237) [1110 bp, 369 aa] {ON}
           complement(39128..40237) [1110 nt, 370 aa]
          Length = 369

 Score = 69.3 bits (168), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 99/231 (42%), Gaps = 15/231 (6%)

Query: 30  ITHPLDLAKVRLQTAAR--PKPTLFSMIQRILKNDGPL-GLYSGLTASILRQCTYTTARF 86
           + H LD  K R Q A        ++   + I   +G + GLY G  A+++         F
Sbjct: 68  VMHSLDTVKTRQQGAPNVLKYRNMWGAYRSIFIEEGLMRGLYGGYFAAMVGSFPSAAIFF 127

Query: 87  GCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ-----NDSAHEP 141
           G Y+F K  ++    +N T   L   ++   +   V  P++V+  R+Q     N++  + 
Sbjct: 128 GTYEFSKRKMIYEWGVNETTTYLISGLLGDLVSSIVYVPSEVLKTRLQLQGRYNNTYFDS 187

Query: 142 HLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGF 201
               NY+N  D +  I K EG   L  G    L R +  +A Q   Y+  +         
Sbjct: 188 GY--NYRNLRDAIKTIVKTEGFSTLFFGYKATLARDLPFSALQFAFYEKFRQLAFNIENK 245

Query: 202 DASEKKTHFTASLV----AGLVATTICSPADVIKTRIMNAHQHHESTLKVL 248
           +  E     T+ ++    AG +A  I +P DV+KTR+    Q ++  L+V+
Sbjct: 246 NIKEDALSITSEILTGASAGGLAGIITTPLDVVKTRV-QTQQSYKGELRVI 295

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 94/216 (43%), Gaps = 31/216 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFS----------MIQRILKNDGPLGLYS 69
           G +G +V+ I+  P ++ K RLQ   R   T F            I+ I+K +G   L+ 
Sbjct: 153 GLLGDLVSSIVYVPSEVLKTRLQLQGRYNNTYFDSGYNYRNLRDAIKTIVKTEGFSTLFF 212

Query: 70  GLTASILRQCTYTTARFGCYD------FIKENL-LPADKLNSTLYLLPCSMISGAIGGFV 122
           G  A++ R   ++  +F  Y+      F  EN  +  D L+ T  +L  +  +G + G +
Sbjct: 213 GYKATLARDLPFSALQFAFYEKFRQLAFNIENKNIKEDALSITSEILTGAS-AGGLAGII 271

Query: 123 GNPADVVNIRMQNDSAHEPHLRRNYKNA-------------IDGVTRIFKEEGVRKLLTG 169
             P DVV  R+Q   +++  LR    NA             I  +  +++ EG+    +G
Sbjct: 272 TTPLDVVKTRVQTQQSYKGELRVIDLNATTQSKPSTLTNSMIQSLRTVYRTEGITGYFSG 331

Query: 170 LGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASE 205
           +GP  +   + ++  ++ Y V    +  +FG    E
Sbjct: 332 VGPRFIWTSVQSSIMLLLYQVLLRGIDNSFGVSQPE 367

>NCAS0B04620 Chr2 (842926..845583) [2658 bp, 885 aa] {ON} 
          Length = 885

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 122/278 (43%), Gaps = 40/278 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRILKNDGPLGLYSGLTASIL 76
           G V G +   + +P+D  K R+Q   +  + K ++  ++ +I   +G  GLYSGL   ++
Sbjct: 505 GSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLV-KIFGKEGIRGLYSGLGPQLI 563

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPADVVNIR 132
                   +    DF++++L+  DK  +    L   ++SGA  G       NP ++V IR
Sbjct: 564 GVAPEKAIKLTVNDFMRKSLV--DKKGNLQ--LGAEVLSGATAGACQVVFTNPLEIVKIR 619

Query: 133 MQNDSAHEPHLRRNYKNAIDGVTR-----IFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           +Q        ++  Y NA+   ++     I KE  +  L  G+G  L+R V  +A    +
Sbjct: 620 LQ--------VKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPT 671

Query: 188 YDVCKHNLVTTFGFDASEKKTH--------FTASLVAGLVATTICSPADVIKTRIM---- 235
           Y   K N+   F FD ++K            TA  +AG+ A  + +P DVIKTR+     
Sbjct: 672 YAHLKKNV---FQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPG 728

Query: 236 NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGP 273
                +   L  + + ++ E     F+G      R  P
Sbjct: 729 VGETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSP 766

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 82/188 (43%), Gaps = 20/188 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAAR------PKPTLFSMIQRILKNDGPLGLYSGLTA 73
           G   G    + T+PL++ K+RLQ  +       PK  L +   +I+K    +GLY G+ A
Sbjct: 599 GATAGACQVVFTNPLEIVKIRLQVKSEYTNAMIPKSQLTAF--QIIKELKLIGLYKGVGA 656

Query: 74  SILRQCTYTTARFGCYDFIKENLL---PADKLN----STLYLLPCSMISGAIGGFVGNPA 126
            +LR   ++   F  Y  +K+N+    P DK       T  LL    ++G    F+  P 
Sbjct: 657 CLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPF 716

Query: 127 DVVNIRMQNDSAHEPHL-RRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQV 185
           DV+  R+Q     EP +    Y   +  V  I KEE  R    G    ++R        +
Sbjct: 717 DVIKTRLQ----IEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTL 772

Query: 186 VSYDVCKH 193
            +Y++ K+
Sbjct: 773 AAYELFKN 780

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 4/82 (4%)

Query: 209 HFTASLVAGLVATTICSPADVIKTRIMNAHQ---HHESTLKVLSSSIRNEGLGFMFRGWL 265
           +F+   VAG +  T+  P D IKTR M A +    +++++  L      EG+  ++ G  
Sbjct: 501 NFSLGSVAGCIGATLVYPIDFIKTR-MQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLG 559

Query: 266 PSFARLGPNTILIFLVVEQLRK 287
           P    + P   +   V + +RK
Sbjct: 560 PQLIGVAPEKAIKLTVNDFMRK 581

>KNAG0H00750 Chr8 complement(118017..118943) [927 bp, 308 aa] {ON}
           Anc_3.348 YPR058W
          Length = 308

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 119/283 (42%), Gaps = 24/283 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GGI   ++  P D  KVRLQT A+ + T   +++ +L+ +GP G Y G    ++   
Sbjct: 32  GTAGGIAQVLVGQPFDTTKVRLQT-AKVRTTAMDVVKNLLEKEGPRGFYKGTLTPLVGVG 90

Query: 80  TYTTARFGCYDFIK--------ENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNI 131
              + +FG  + +K        E  + A  L+   Y L C +  G    F+ +P + V I
Sbjct: 91  ACVSLQFGVNEAMKRFFRSQNAEKGITATTLSLPQYYL-CGLTGGLTNSFLASPIEHVRI 149

Query: 132 RMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
           R+Q   +        +K  +D + ++ +  G   L+ GL P L+R      +  + Y+  
Sbjct: 150 RLQTQVSSGAG--AEFKGPLDCIKKL-RSHG--SLMRGLTPTLLREGHGCGTYFLVYEAL 204

Query: 192 KHNLVTTFGFDASEKKTHFTASLVAGLVATTI---CSPADVIKTRIMN----AHQHHEST 244
             N +   G   +E  T +   L   L  TT+     P DVIK+ +        +   + 
Sbjct: 205 VANEINK-GLKRTEVPT-WKLCLFGALSGTTLWIMVYPIDVIKSVMQTDGLVTRKCGNNM 262

Query: 245 LKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRK 287
            +V     +  G+G   +G+ P+  R  P     F   E + +
Sbjct: 263 GQVAKHIFKTHGIGGFLKGFGPTILRAAPANGATFATFELMMR 305

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 74/200 (37%), Gaps = 39/200 (19%)

Query: 112 SMISGAIGG----FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLL 167
            +++G  GG     VG P D   +R+Q               A+D V  + ++EG R   
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTAKVR--------TTAMDVVKNLLEKEGPRGFY 79

Query: 168 TG-LGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTAS-----------LV 215
            G L P      L+     VS     +  +  F F +   +   TA+           L 
Sbjct: 80  KGTLTP------LVGVGACVSLQFGVNEAMKRF-FRSQNAEKGITATTLSLPQYYLCGLT 132

Query: 216 AGLVATTICSPADVIKTRIMN-----AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFAR 270
            GL  + + SP + ++ R+       A    +  L  +   +R+ G   + RG  P+  R
Sbjct: 133 GGLTNSFLASPIEHVRIRLQTQVSSGAGAEFKGPLDCIKK-LRSHG--SLMRGLTPTLLR 189

Query: 271 LGPNTILIFLVVEQLRKYEI 290
            G      FLV E L   EI
Sbjct: 190 EGHGCGTYFLVYEALVANEI 209

>SAKL0B07524g Chr2 (647326..648243) [918 bp, 305 aa] {ON} highly
           similar to uniprot|P32331 Saccharomyces cerevisiae
           YPR058W YMC1 Putative mitochondrial inner membrane
           transporter member of the mitochondrial carrier (MCF)
           family
          Length = 305

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 115/278 (41%), Gaps = 23/278 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GG+   +I  P D  KVRLQT++ P  T   ++++++KN+G  G Y G    ++   
Sbjct: 30  GTAGGVSQVLIGQPFDTTKVRLQTSSVPT-TALDVVKKLVKNEGFRGFYKGTLTPLVGVG 88

Query: 80  TYTTARFGCYDFIKE-------NLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIR 132
              + +FG  + +K        N  P + L    Y L C    G    F+ +P + V IR
Sbjct: 89  ACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYL-CGFAGGTANSFLASPIEHVRIR 147

Query: 133 MQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCK 192
           +Q  +      +  +   +D + ++        L+ GL P ++R         ++Y+   
Sbjct: 148 LQTQTGTGAAAQ--FHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFLTYEALI 202

Query: 193 HNLVTTFGFDASEKKTHFTASLVAGLVATTI---CSPADVIKTRIMNAH----QHHESTL 245
            N +   G   SE  T +   L      TT+     P DVIK+ +        +  ++ L
Sbjct: 203 ANELHK-GVSRSEIPT-WKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNML 260

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
           +V  +     GL   F+G+ P+  R  P     F   E
Sbjct: 261 QVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298

>KAFR0B05170 Chr2 (1062776..1063693) [918 bp, 305 aa] {ON} Anc_2.621
           YMR056C
          Length = 305

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 81/193 (41%), Gaps = 26/193 (13%)

Query: 15  YPWWY------GGVGGIVACIITHPLDLAKVRL----QTAARPKPT-----LFSMIQRIL 59
           Y  W+      GG  G ++    + LD A+ RL    + AAR         L  + ++ L
Sbjct: 109 YSKWFMGNLLSGGTAGAISLAFVYSLDYARTRLAADGKNAARSSHQRQFNGLLDVYKKTL 168

Query: 60  KNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL--YLLPCSMISGA 117
           K+DG LGLY G   S+     Y    FG YD  K  LL      S L  +LL   +  GA
Sbjct: 169 KSDGILGLYRGFVPSVAGIIVYRGLYFGLYDSFKPVLLTGKLERSFLASFLLGWVVTVGA 228

Query: 118 IGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG 177
                  P D V  RM   S  +      Y  + D   +I   EGV  L  G G N+ RG
Sbjct: 229 --STCSYPIDTVRRRMMMTSGQQV----KYNGSFDCFKQIISHEGVTSLFKGCGANIFRG 282

Query: 178 VLMTASQVVS-YD 189
           V   A+ V+S YD
Sbjct: 283 V--AAAGVISLYD 293

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 104/268 (38%), Gaps = 32/268 (11%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTA----------ARPKPTLFSMIQRILKNDGPLGLYS 69
           GGV   VA     P++  K+ +Q            AR K  +    +R  KN+G +  + 
Sbjct: 15  GGVSAAVAKTCAAPIERVKLLMQNQDEMMKQGSLDARYKGIV-DCFERTAKNEGTISFWR 73

Query: 70  GLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVG----NP 125
           G TA+++R        F   D IK       + +        +++SG   G +       
Sbjct: 74  GNTANVIRYFPTQALNFAFKDKIKAMFGFQRERDGYSKWFMGNLLSGGTAGAISLAFVYS 133

Query: 126 ADVVNIRMQND---SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTA 182
            D    R+  D   +A   H +R +   +D   +  K +G+  L  G  P++   ++   
Sbjct: 134 LDYARTRLAADGKNAARSSH-QRQFNGLLDVYKKTLKSDGILGLYRGFVPSVAGIIVYRG 192

Query: 183 SQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVAT---TICS-PADVIKTRIM--- 235
                YD  K  L+T       + +  F AS + G V T   + CS P D ++ R+M   
Sbjct: 193 LYFGLYDSFKPVLLT------GKLERSFLASFLLGWVVTVGASTCSYPIDTVRRRMMMTS 246

Query: 236 NAHQHHESTLKVLSSSIRNEGLGFMFRG 263
                +  +       I +EG+  +F+G
Sbjct: 247 GQQVKYNGSFDCFKQIISHEGVTSLFKG 274

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 71/173 (41%), Gaps = 21/173 (12%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSA--HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S A+      P + V + MQN      +  L   YK  +D   R  K EG      G  
Sbjct: 17  VSAAVAKTCAAPIERVKLLMQNQDEMMKQGSLDARYKGIVDCFERTAKNEGTISFWRGNT 76

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEK--KTHFTASLV----AGLVATTICS 225
            N++R      +Q +++   K  +   FGF          F  +L+    AG ++     
Sbjct: 77  ANVIR---YFPTQALNF-AFKDKIKAMFGFQRERDGYSKWFMGNLLSGGTAGAISLAFVY 132

Query: 226 PADVIKTRIM--------NAHQHH-ESTLKVLSSSIRNEGLGFMFRGWLPSFA 269
             D  +TR+         ++HQ      L V   +++++G+  ++RG++PS A
Sbjct: 133 SLDYARTRLAADGKNAARSSHQRQFNGLLDVYKKTLKSDGILGLYRGFVPSVA 185

>TBLA0A01000 Chr1 (227434..228561) [1128 bp, 375 aa] {ON} Anc_7.133
           YIL006W
          Length = 375

 Score = 69.3 bits (168), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 124/297 (41%), Gaps = 41/297 (13%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAA--------RPKPTLFSMIQRILKNDGPLGLYSGL 71
           G + G ++ I   PLD+AK RLQ           +    L + ++ I+ ++G  G+Y GL
Sbjct: 78  GALAGFLSGIAVCPLDVAKTRLQAQGLQVTNLENKYYHGLINTLRTIVYDEGIRGIYKGL 137

Query: 72  TASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMIS-GAIGGFVGNPADVVN 130
           T  IL         F  Y+  K+   P    N+       S IS G +     NP  VV 
Sbjct: 138 TPIILGYFPTWMIYFSVYERCKK-FYPIYFNNNDFISNSFSAISAGTVSTIATNPIWVVK 196

Query: 131 IRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDV 190
            R+   + H    R +YK  +D    I+++EG+R L  GL P+ + G+   A     ++ 
Sbjct: 197 TRLMLQT-HIARTRTHYKGTLDAFVTIYQQEGIRALYAGLIPSFL-GLFHVAIHFPVFEQ 254

Query: 191 CKHNLVTTFGFDASEKK---------------THFTASLVAGLVATTICSPADVIKTRIM 235
            K        F+  EKK                   AS ++ ++A++I  P ++++TR+ 
Sbjct: 255 LKEK------FNCYEKKLIPNTSEYEYSINLERLIMASCISKMMASSITYPHEILRTRMQ 308

Query: 236 ------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
                 N+ Q     + ++ +    EGL   + G+  +  R  P + +  +  E  R
Sbjct: 309 LKSDLPNSLQRR--IIPLIKTIYIQEGLRGFYSGFTTNLVRTVPASAITMVSFEYFR 363

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 41/87 (47%), Gaps = 9/87 (10%)

Query: 210 FTASLVAGLVATTICSPADVIKTRIMN--------AHQHHESTLKVLSSSIRNEGLGFMF 261
           F+ +L   L    +C P DV KTR+           ++++   +  L + + +EG+  ++
Sbjct: 76  FSGALAGFLSGIAVC-PLDVAKTRLQAQGLQVTNLENKYYHGLINTLRTIVYDEGIRGIY 134

Query: 262 RGWLPSFARLGPNTILIFLVVEQLRKY 288
           +G  P      P  ++ F V E+ +K+
Sbjct: 135 KGLTPIILGYFPTWMIYFSVYERCKKF 161

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 22  VGGIVACIITHPLDLAKVRLQTAARPKPTL----FSMIQRILKNDGPLGLYSGLTASILR 77
           +  ++A  IT+P ++ + R+Q  +    +L      +I+ I   +G  G YSG T +++R
Sbjct: 288 ISKMMASSITYPHEILRTRMQLKSDLPNSLQRRIIPLIKTIYIQEGLRGFYSGFTTNLVR 347

Query: 78  QCTYTTARFGCYDFIKENLLPAD 100
               +      +++ +  L   D
Sbjct: 348 TVPASAITMVSFEYFRSVLTALD 370

>Smik_2.85 Chr2 complement(156794..157747) [954 bp, 318 aa] {ON}
           YBL030C (REAL)
          Length = 318

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 81/194 (41%), Gaps = 27/194 (13%)

Query: 1   MSGTKSESSNAVVKYPWWY------GGVGGIVACIITHPLDLAKVRL--------QTAAR 46
           M G K E       Y  W+      GG  G ++ +  + LD A+ RL        +  AR
Sbjct: 114 MFGFKKEEG-----YTKWFAGNLASGGAAGALSLMFVYSLDYARTRLAADSKSSKKGGAR 168

Query: 47  PKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
               L  + ++ LK+DG  GLY G   S++    Y    FG YD +K  LL      S L
Sbjct: 169 QFNGLVDVYKKTLKSDGIAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFL 228

Query: 107 --YLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
             +LL   + +GA       P D V  RM   S         Y  A D + +I   EGV 
Sbjct: 229 ASFLLGWVVTTGA--STCSYPLDTVRRRMMMTSGQAVK----YDGAFDCMRKIVAAEGVS 282

Query: 165 KLLTGLGPNLVRGV 178
            L  G G N++RGV
Sbjct: 283 SLFKGCGANILRGV 296

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 108/292 (36%), Gaps = 42/292 (14%)

Query: 8   SSNAVVKYP----------------WWYGGVGGIVACIITHPLDLAKVRLQ--------- 42
           SSNA VK P                +  GGV   VA     P++  K+ +Q         
Sbjct: 2   SSNAQVKTPLPSASAPKKESNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQG 61

Query: 43  TAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKL 102
           T  +    +    +R  K +G +  + G TA+++R        F   D IK       + 
Sbjct: 62  TLDKKYAGILDCFKRTAKQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEE 121

Query: 103 NSTLYL---LPCSMISGAIGGFVGNPADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIF 158
             T +    L     +GA+        D    R+  DS + +    R +   +D   +  
Sbjct: 122 GYTKWFAGNLASGGAAGALSLMFVYSLDYARTRLAADSKSSKKGGARQFNGLVDVYKKTL 181

Query: 159 KEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGL 218
           K +G+  L  G  P++V  V+        YD  K  L+T         +  F AS + G 
Sbjct: 182 KSDGIAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLT------GSLEGSFLASFLLGW 235

Query: 219 VATT---ICS-PADVIKTRIMNAHQH---HESTLKVLSSSIRNEGLGFMFRG 263
           V TT    CS P D ++ R+M        ++     +   +  EG+  +F+G
Sbjct: 236 VVTTGASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCMRKIVAAEGVSSLFKG 287

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 71/169 (42%), Gaps = 19/169 (11%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSA--HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S A+     +P + V + +QN      +  L + Y   +D   R  K+EG+     G  
Sbjct: 32  VSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDKKYAGILDCFKRTAKQEGIISFWRGNT 91

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH-FTASLV----AGLVATTICSP 226
            N++R      +Q +++   K  +   FGF   E  T  F  +L     AG ++      
Sbjct: 92  ANVIR---YFPTQALNF-AFKDKIKAMFGFKKEEGYTKWFAGNLASGGAAGALSLMFVYS 147

Query: 227 ADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
            D  +TR+            +     + V   +++++G+  ++RG+LPS
Sbjct: 148 LDYARTRLAADSKSSKKGGARQFNGLVDVYKKTLKSDGIAGLYRGFLPS 196

>Kwal_27.12599 s27 (1294737..1295651) [915 bp, 304 aa] {ON} YPR058W
           (YMC1) - putative mitochondrial carrier protein [contig
           260] FULL
          Length = 304

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 121/281 (43%), Gaps = 21/281 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GG+   ++  P D  KVRLQT+  P  T   ++++++KN+G  G Y G    ++   
Sbjct: 31  GTAGGMAQVLVGQPFDTTKVRLQTSTTPT-TAVEVVKKLVKNEGLRGFYKGTLTPLVGVG 89

Query: 80  TYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG----FVGNPADVVNIRMQN 135
              + +FG  + +K     +         LP   I G +GG    F+ +P + V IR+Q 
Sbjct: 90  ACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQT 149

Query: 136 DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNL 195
            +A        +K  +D + ++ +  G   L+ GL P ++R     A+  ++Y+    N 
Sbjct: 150 QTAS--GTVAEFKGPLDCINKL-RANGA--LMRGLSPTILREAQGCATYFLTYEALVANQ 204

Query: 196 VTTFGFDASE----KKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSS 251
           +   G   S+    K   F A  V+G+       P DVIK+ +   +  +    K +   
Sbjct: 205 IGK-GIARSDVPAWKLCLFGA--VSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQV 261

Query: 252 IR--NEGLGF--MFRGWLPSFARLGPNTILIFLVVEQLRKY 288
            R  N   G+   F+G+ P+  R  P     F   E   ++
Sbjct: 262 ARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAMRF 302

>TBLA0A06630 Chr1 complement(1618156..1619103) [948 bp, 315 aa] {ON}
           Anc_3.348 YPR058W
          Length = 315

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 119/302 (39%), Gaps = 31/302 (10%)

Query: 1   MSGTKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILK 60
           +S T+    N  +      G  GGI   ++  P D  KVRLQT+  P  T   +++ + K
Sbjct: 19  ISATQPAHDNTRIIKDLLAGTAGGIGQVVVGQPFDTTKVRLQTSKTPT-TALHVLRDLFK 77

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIK-----ENLLPADKLNSTLYLLPCSMIS 115
           N+GPL LY G+   ++        +FG  + +K     +N      L+   Y L C +  
Sbjct: 78  NEGPLALYKGMLTPLVGAGACVAVQFGTNEALKRFFRHQNADGRVNLHLWQYYL-CGLGG 136

Query: 116 GAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTR-------IFKEEGVRKLLT 168
           G    F+  P + V IR+Q   A       N KN  D +T        I +      L+ 
Sbjct: 137 GIANAFLACPMEHVRIRLQVQKAPI-----NAKNVTDAITHFNGPLDCINQLWARGALMR 191

Query: 169 GLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTI---CS 225
           GL   L+R         ++Y+     LV   G    E    + + L  G   + +     
Sbjct: 192 GLPAMLIRAGHGLGVYFLTYEA----LVAHSGVPRKELPA-WKSCLYGGCAGSMLWLAVY 246

Query: 226 PADVIKTRI----MNAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
           P DV+K+ I    +N  ++ ++  KV        G    FRG+ P+  R  P     F  
Sbjct: 247 PLDVVKSVIQTDSLNKPRYSDNIWKVAKQLYSYGGSKAFFRGFGPTMLRAAPANGATFCA 306

Query: 282 VE 283
            E
Sbjct: 307 FE 308

>Skud_2.73 Chr2 complement(146857..147813) [957 bp, 318 aa] {ON}
           YBL030C (REAL)
          Length = 318

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 81/194 (41%), Gaps = 27/194 (13%)

Query: 1   MSGTKSESSNAVVKYPWWY------GGVGGIVACIITHPLDLAKVRL--------QTAAR 46
           M G K E       Y  W+      GG  G ++ +  + LD A+ RL        +  AR
Sbjct: 114 MFGFKKEEG-----YTKWFAGNLASGGAAGALSLMFVYSLDYARTRLAADSKSSKKGGAR 168

Query: 47  PKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
               L  + ++ LK+DG  GLY G   S++    Y    FG YD +K  LL      S L
Sbjct: 169 QFNGLVDVYKKTLKSDGLAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPVLLTGSLEGSFL 228

Query: 107 --YLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
             +LL   + +GA       P D V  RM   S         Y  A D + +I   EGV 
Sbjct: 229 ASFLLGWVVTTGA--STCSYPLDTVRRRMMMTSGQAVK----YDGAFDCLRKIVAAEGVP 282

Query: 165 KLLTGLGPNLVRGV 178
            L  G G N++RGV
Sbjct: 283 SLFKGCGANILRGV 296

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 70/169 (41%), Gaps = 19/169 (11%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSA--HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S A+     +P + V + +QN      +  L + Y   +D   R   +EG+     G  
Sbjct: 32  VSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDKKYAGILDCFKRTATQEGIISFWRGNT 91

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH-FTASLV----AGLVATTICSP 226
            N++R      +Q +++   K  +   FGF   E  T  F  +L     AG ++      
Sbjct: 92  ANVIR---YFPTQALNF-AFKDKIKAMFGFKKEEGYTKWFAGNLASGGAAGALSLMFVYS 147

Query: 227 ADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
            D  +TR+            +     + V   +++++GL  ++RG+LPS
Sbjct: 148 LDYARTRLAADSKSSKKGGARQFNGLVDVYKKTLKSDGLAGLYRGFLPS 196

>KNAG0J02390 Chr10 (452558..453472) [915 bp, 304 aa] {ON} Anc_3.316
           YBL030C
          Length = 304

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 79/194 (40%), Gaps = 27/194 (13%)

Query: 1   MSGTKSESSNAVVKYPWWY------GGVGGIVACIITHPLDLAKVRLQTAARPKPT---- 50
           M G K E       Y  W+      GG  G ++ +  + LD A+ RL   A+        
Sbjct: 100 MFGFKKEEG-----YAKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGER 154

Query: 51  ----LFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
               L  + ++ LK+DG  GLY G   S++    Y    FG YD +K  LL      S L
Sbjct: 155 QFNGLIDVYKKTLKSDGISGLYRGFMPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFL 214

Query: 107 --YLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVR 164
             +LL   + +GA       P D +  RM   S         Y  A D   +I   EGV 
Sbjct: 215 ASFLLGWVVTTGA--STCSYPLDTIRRRMMMTSGQAVK----YNGAFDAFRKIVAAEGVT 268

Query: 165 KLLTGLGPNLVRGV 178
            L  G G N++RGV
Sbjct: 269 SLFKGCGANILRGV 282

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 106/281 (37%), Gaps = 30/281 (10%)

Query: 4   TKSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQ---------TAARPKPTLFSM 54
           + ++ SN  V +    GGV   VA  +  P++  K+ +Q         +  R    +   
Sbjct: 2   SDNKQSNFAVDF--LMGGVSAAVAKTVASPIERVKLLIQNQDEMIKQGSLDRRYNGIVDC 59

Query: 55  IQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMI 114
            +R  + +G +  + G TA+++R        F   D IK       +     +       
Sbjct: 60  FKRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYAKWFAGNLAS 119

Query: 115 SGAIGG----FVGNPADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTG 169
            GA GG    FV    D    R+  D+ + +    R +   ID   +  K +G+  L  G
Sbjct: 120 GGAAGGLSLLFV-YSLDYARTRLAADAKSSKKGGERQFNGLIDVYKKTLKSDGISGLYRG 178

Query: 170 LGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATT---ICS- 225
             P++V  V+        YD  K  L+T         +  F AS + G V TT    CS 
Sbjct: 179 FMPSVVGIVVYRGLYFGMYDSLKPLLLT------GSLEGSFLASFLLGWVVTTGASTCSY 232

Query: 226 PADVIKTRIMNAHQH---HESTLKVLSSSIRNEGLGFMFRG 263
           P D I+ R+M        +          +  EG+  +F+G
Sbjct: 233 PLDTIRRRMMMTSGQAVKYNGAFDAFRKIVAAEGVTSLFKG 273

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 71/169 (42%), Gaps = 19/169 (11%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSA--HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S A+   V +P + V + +QN      +  L R Y   +D   R  ++EG+     G  
Sbjct: 18  VSAAVAKTVASPIERVKLLIQNQDEMIKQGSLDRRYNGIVDCFKRTAQQEGIISFWRGNT 77

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH-FTASLVAGLVATTI----CSP 226
            N++R      +Q +++   K  +   FGF   E     F  +L +G  A  +       
Sbjct: 78  ANVIR---YFPTQALNF-AFKDKIKLMFGFKKEEGYAKWFAGNLASGGAAGGLSLLFVYS 133

Query: 227 ADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
            D  +TR+            +     + V   +++++G+  ++RG++PS
Sbjct: 134 LDYARTRLAADAKSSKKGGERQFNGLIDVYKKTLKSDGISGLYRGFMPS 182

>TDEL0B02940 Chr2 (526265..527374) [1110 bp, 369 aa] {ON} Anc_8.552
           YBR192W
          Length = 369

 Score = 69.3 bits (168), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 123/302 (40%), Gaps = 53/302 (17%)

Query: 31  THPLDLAKVRLQT--------------AARPKPTLFS--------------MIQRILKND 62
           T P DL K RLQ+              AA   P  F+              ++ ++ +N+
Sbjct: 65  TCPFDLVKTRLQSDVYQSVYKSSVSREAATTGPRAFNYVVQAGTHFKETFGILNKVYRNE 124

Query: 63  GPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPA-DKLNSTLYL-LPCSMISGAIGG 120
           G   L+ GL  +++      +  F  Y   K+    A +  N + ++ L  +  +G    
Sbjct: 125 GFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYSRAFNNGNESAWIHLMAAATAGWATS 184

Query: 121 FVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLM 180
              NP  +V  R+Q D A    + RNYKN+ D +  I   EG+R L  GL  + + G + 
Sbjct: 185 TATNPIWMVKTRLQLDKA---GVTRNYKNSWDCIKSILHNEGIRGLYKGLSASYL-GSVE 240

Query: 181 TASQVVSYD----VCKHNLVTTFGFDASEKKT----------HFTASLVAGLVATTICSP 226
           +  Q + Y+    + K   +  FG     +K              ++ +A  VA+ I  P
Sbjct: 241 SILQWLLYEQMKRLLKERSIERFGHSDDRRKATSEKIKEWCQRSGSAGLAKFVASIITYP 300

Query: 227 ADVIKTRIM-----NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLV 281
            +V++TR+      N    +   ++     I+ EG   M+ G  P   R  PN+I++F  
Sbjct: 301 HEVVRTRLRQAPLENGKLKYTGLIQSFRVIIKEEGFASMYSGLTPHLMRTVPNSIIMFGT 360

Query: 282 VE 283
            E
Sbjct: 361 WE 362

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 86/189 (45%), Gaps = 28/189 (14%)

Query: 125 PADVVNIRMQND---SAHEPHLRR------------------NYKNAIDGVTRIFKEEGV 163
           P D+V  R+Q+D   S ++  + R                  ++K     + ++++ EG 
Sbjct: 67  PFDLVKTRLQSDVYQSVYKSSVSREAATTGPRAFNYVVQAGTHFKETFGILNKVYRNEGF 126

Query: 164 RKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTI 223
           R L  GLGPNLV  +   +    +Y   K      F         H  A+  AG   +T 
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFFTYGTTKDMYSRAFNNGNESAWIHLMAAATAGWATSTA 186

Query: 224 CSPADVIKTRIM----NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGP-NTILI 278
            +P  ++KTR+        ++++++   + S + NEG+  +++G   S+  LG   +IL 
Sbjct: 187 TNPIWMVKTRLQLDKAGVTRNYKNSWDCIKSILHNEGIRGLYKGLSASY--LGSVESILQ 244

Query: 279 FLVVEQLRK 287
           +L+ EQ+++
Sbjct: 245 WLLYEQMKR 253

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTA----ARPKPT-LFSMIQRILKNDGPLGLYSGLTAS 74
            G+   VA IIT+P ++ + RL+ A     + K T L    + I+K +G   +YSGLT  
Sbjct: 287 AGLAKFVASIITYPHEVVRTRLRQAPLENGKLKYTGLIQSFRVIIKEEGFASMYSGLTPH 346

Query: 75  ILRQCTYTTARFGCYDFI 92
           ++R    +   FG ++ +
Sbjct: 347 LMRTVPNSIIMFGTWELV 364

>Suva_4.50 Chr4 complement(92059..92961) [903 bp, 300 aa] {ON}
           YDL198C (REAL)
          Length = 300

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 120/280 (42%), Gaps = 28/280 (10%)

Query: 24  GIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKND---GPLG-----LYSGLTASI 75
           GI+   + HP+D    RL +    K +    + R++  D    PLG     L+ GL  + 
Sbjct: 21  GIMEIAVFHPVDTISKRLMSN-HTKISSNQELNRVIFRDHFSEPLGKRLFTLFPGLGYAA 79

Query: 76  LRQCTYTTARFGCYDFIKENLLPADKLN-STLYLLPC--SMISGAIGGFVGN------PA 126
             +      ++G   F  E L    K +  +++      +M S A G  +G       P 
Sbjct: 80  SYKVLQRVYKYGGQPFANEFLNKHYKQDFDSMFGEKTGKAMRSAAAGSLIGIGEIVLLPL 139

Query: 127 DVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
           DV+ I+ Q +         ++K    G  +I K+EG+  L  G G    R    + +   
Sbjct: 140 DVLKIKRQTNP-------ESFKG--RGFIKILKDEGLFNLYRGWGWTAARNAPGSFALFG 190

Query: 187 SYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAH-QHHESTL 245
                K  ++    +  +    +F +S+V    +  + +P DVIKTRI N +  + ES L
Sbjct: 191 GNAFAKEYILGLKDYSQATWSQNFVSSIVGACASLIVSAPLDVIKTRIQNRNFDNPESGL 250

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQL 285
           K++ ++++NEG+   F+G  P     GP  +  F + + L
Sbjct: 251 KIVKNTLKNEGITAFFKGLTPKLLTTGPKLVFSFALAQSL 290

 Score = 36.2 bits (82), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 22  VGGIVACIITHPLDLAKVRLQTAARPKP-TLFSMIQRILKNDGPLGLYSGLTASIL 76
           VG   + I++ PLD+ K R+Q      P +   +++  LKN+G    + GLT  +L
Sbjct: 219 VGACASLIVSAPLDVIKTRIQNRNFDNPESGLKIVKNTLKNEGITAFFKGLTPKLL 274

>Kwal_47.19228 s47 (1142985..1143830) [846 bp, 281 aa] {ON} YFR045W
           - Hypothetical ORF [contig 344] FULL
          Length = 281

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 59/130 (45%), Gaps = 6/130 (4%)

Query: 47  PKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
           P     + +Q I ++ G  G   G   +I+RQ + +  RF  Y  +K+ + P   LN   
Sbjct: 127 PSRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNE-Y 185

Query: 107 YLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKL 166
           Y      IS      V  P DV+  RMQ+      +   NYKN+++   RIF EEG  K 
Sbjct: 186 YAFALGFISSCAVVAVTQPIDVIKTRMQSK-----YTWSNYKNSLNCAYRIFVEEGFTKF 240

Query: 167 LTGLGPNLVR 176
             G  P L++
Sbjct: 241 WKGWAPRLMK 250

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/136 (20%), Positives = 58/136 (42%), Gaps = 8/136 (5%)

Query: 139 HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTT 198
           ++ H  R +   +  V  I++  G+R  L G  P ++R    +A +  +Y   K  +   
Sbjct: 123 YDEHPSRQF---LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPN 179

Query: 199 FGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAH--QHHESTLKVLSSSIRNEG 256
              +   +   F    ++      +  P DVIKTR+ + +   +++++L         EG
Sbjct: 180 KPLN---EYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEG 236

Query: 257 LGFMFRGWLPSFARLG 272
               ++GW P   ++G
Sbjct: 237 FTKFWKGWAPRLMKVG 252

>KLTH0G00968g Chr7 complement(70012..71049) [1038 bp, 345 aa] {ON}
           similar to uniprot|P43617 Saccharomyces cerevisiae
           YFR045W
          Length = 345

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 58/130 (44%), Gaps = 6/130 (4%)

Query: 47  PKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL 106
           P   LF+ IQ + +  G  G   G   +I+RQ   +  RF  Y  +K+   P   +N   
Sbjct: 191 PSRQLFTTIQEMFRTRGLRGFVQGTAPTIIRQTANSAVRFTSYTSLKQVFSPDGPINE-Y 249

Query: 107 YLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKL 166
           Y      +S      V  P DVV  RMQ+      +   NYKN+++   RIF EEG  K 
Sbjct: 250 YAFALGFVSSCAVVAVTQPIDVVKTRMQSK-----YTWVNYKNSLNCAYRIFVEEGFTKF 304

Query: 167 LTGLGPNLVR 176
             G  P L++
Sbjct: 305 WKGWAPRLMK 314

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 53/122 (43%), Gaps = 7/122 (5%)

Query: 154 VTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH-FTA 212
           +  +F+  G+R  + G  P ++R    +A +  SY   K      F  D    + + F  
Sbjct: 199 IQEMFRTRGLRGFVQGTAPTIIRQTANSAVRFTSYTSLKQ----VFSPDGPINEYYAFAL 254

Query: 213 SLVAGLVATTICSPADVIKTRIMNAHQ--HHESTLKVLSSSIRNEGLGFMFRGWLPSFAR 270
             V+      +  P DV+KTR+ + +   +++++L         EG    ++GW P   +
Sbjct: 255 GFVSSCAVVAVTQPIDVVKTRMQSKYTWVNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMK 314

Query: 271 LG 272
           +G
Sbjct: 315 VG 316

>KLTH0H00220g Chr8 complement(18972..19883) [912 bp, 303 aa] {ON}
           similar to uniprot|P32331 Saccharomyces cerevisiae
           YPR058W YMC1 Putative mitochondrial inner membrane
           transporter member of the mitochondrial carrier (MCF)
           family
          Length = 303

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 115/278 (41%), Gaps = 25/278 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G VGG    ++  P D+ KVRLQT+  P  T   +I+ ++KN+G L  Y G    ++   
Sbjct: 30  GTVGGFAQVLVGQPFDITKVRLQTSPVPS-TAVEVIKNLVKNEGILAFYKGTLVPLVGVG 88

Query: 80  TYTTARFGCYDFIKENL----LPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQN 135
              + +FG  + +K +       +D+  +      C  +SG    F+ +P + V IR+Q 
Sbjct: 89  ACVSCQFGINEAMKRHFRRDHTESDQTLTLSQYYTCGFVSGFANAFLASPIEHVRIRLQL 148

Query: 136 DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVR-----GVLMTASQVVSYDV 190
            +      +  Y+  ID   ++ +      L+ GL   ++R     GV     + +  + 
Sbjct: 149 QTKSLD--KAEYRGCIDCTKKLLQGGA---LMRGLSATMLRTSHGFGVYFATYEALIANQ 203

Query: 191 CKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAH-----QHHESTL 245
             H ++     +    K     +  +G     +  P DVIK+ +M A      ++  +  
Sbjct: 204 AHHGVLRQ---EIPAWKVCLYGAF-SGAFFWAMTYPFDVIKS-VMQADSLKSPKYGRTVF 258

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
            V  S  R  G+G   +G+ P+  R  P     F   E
Sbjct: 259 SVARSIRRERGIGAFLKGFWPTMLRSLPVNGATFAAFE 296

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 28/150 (18%), Positives = 60/150 (40%), Gaps = 20/150 (13%)

Query: 92  IKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAI 151
           + ++L+ +  +N     + C  + G     VG P D+  +R+Q               A+
Sbjct: 10  VVDDLVDSHDVNQAFKDIFCGTVGGFAQVLVGQPFDITKVRLQTSPVPS--------TAV 61

Query: 152 DGVTRIFKEEGVRKLLTG-LGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASEK---- 206
           + +  + K EG+     G L P +  G  ++    ++  + +H     F  D +E     
Sbjct: 62  EVIKNLVKNEGILAFYKGTLVPLVGVGACVSCQFGINEAMKRH-----FRRDHTESDQTL 116

Query: 207 --KTHFTASLVAGLVATTICSPADVIKTRI 234
               ++T   V+G     + SP + ++ R+
Sbjct: 117 TLSQYYTCGFVSGFANAFLASPIEHVRIRL 146

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 34/83 (40%), Gaps = 8/83 (9%)

Query: 16  PWW----YGGVGGIVACIITHPLDLAKVRLQTAARPKP----TLFSMIQRILKNDGPLGL 67
           P W    YG   G     +T+P D+ K  +Q  +   P    T+FS+ + I +  G    
Sbjct: 214 PAWKVCLYGAFSGAFFWAMTYPFDVIKSVMQADSLKSPKYGRTVFSVARSIRRERGIGAF 273

Query: 68  YSGLTASILRQCTYTTARFGCYD 90
             G   ++LR      A F  ++
Sbjct: 274 LKGFWPTMLRSLPVNGATFAAFE 296

>Skud_2.230 Chr2 (417863..418852) [990 bp, 329 aa] {ON} YBR104W
           (REAL)
          Length = 329

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/306 (23%), Positives = 130/306 (42%), Gaps = 35/306 (11%)

Query: 8   SSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGL 67
           SSN V+K   + G +GG+   ++  P D  KVRLQTA     T+  +++ ++KN+G    
Sbjct: 30  SSNRVLK-DIFAGTIGGVAQVLVGQPFDTTKVRLQTATTRTTTM-EVLRDLVKNEGVFAF 87

Query: 68  YSGLTASILRQCTYTTARFGCYDFIKE-----------NLLPADKLNSTLYLLP------ 110
           Y G    +L      + +FG  + +K            N+   D   S    LP      
Sbjct: 88  YKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASRNPNMSSQDVDLSRSNTLPLSQYYV 147

Query: 111 CSMISGAIGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGL 170
           C +  G +  F+ +P + + IR+Q  +++     R +K   D + ++  + G   L+ GL
Sbjct: 148 CGLTGGVVNSFLASPIEQIRIRLQTQTSNGGD--REFKGPWDCIKKLKAQGG---LMRGL 202

Query: 171 GPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDASE----KKTHFTASLVAGLVATTICSP 226
            P ++R      +  + Y+      + T G   +E    K   F A   +G +      P
Sbjct: 203 FPTMIRAGHGLGTYFLVYEALMAKEIGT-GLTRNEIPPWKLCLFGA--FSGTMLWLTVYP 259

Query: 227 ADVIKTRIMNAH----QHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVV 282
            DV+K+ I N      ++  S   V  +    EG+   F+G+ P+  R  P     F+  
Sbjct: 260 LDVVKSIIQNDDLRKPKYKNSISSVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFVTF 319

Query: 283 EQLRKY 288
           E + ++
Sbjct: 320 ELVMRF 325

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 80/195 (41%), Gaps = 17/195 (8%)

Query: 112 SMISGAIGG----FVGNPADVVNIRMQNDSAHEPH---LRRNYKNAIDGVTRIFKEEGVR 164
            + +G IGG     VG P D   +R+Q  +        LR   KN  +GV   +K     
Sbjct: 37  DIFAGTIGGVAQVLVGQPFDTTKVRLQTATTRTTTMEVLRDLVKN--EGVFAFYKGALTP 94

Query: 165 KLLTGLGPNLVRGVLMTASQVV-SYDVCKHNLVTTFGFDASEKKT-----HFTASLVAGL 218
            L  G+  ++  GV     +   +Y+  ++  +++   D S   T     ++   L  G+
Sbjct: 95  LLGVGICVSVQFGVNEAMKRFFQNYNASRNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGV 154

Query: 219 VATTICSPADVIKTRIMNAHQHH-ESTLKVLSSSIRN-EGLGFMFRGWLPSFARLGPNTI 276
           V + + SP + I+ R+     +  +   K     I+  +  G + RG  P+  R G    
Sbjct: 155 VNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLG 214

Query: 277 LIFLVVEQLRKYEIG 291
             FLV E L   EIG
Sbjct: 215 TYFLVYEALMAKEIG 229

>Skud_2.422 Chr2 complement(752512..753411) [900 bp, 299 aa] {ON}
           YBR291C (REAL)
          Length = 299

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 129/297 (43%), Gaps = 22/297 (7%)

Query: 5   KSESSNAVVKYPWWYGGVGGIVACIITHPLDLAKVRLQ---TAARPKPTLFSMIQRILKN 61
           K+  S+    + ++ G + G V   IT+P + AK RLQ    A++       +I +  K+
Sbjct: 4   KATKSDVDRLHSFFAGSLAGAVEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKS 63

Query: 62  DGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPAD--KLNSTLYLLPCSMISGAIG 119
            G   +Y G  A I+     T  RF  +D IK+ L   +  +L+ T       +I+G   
Sbjct: 64  QGLGSIYVGCPAFIIGNTAKTGIRFLGFDTIKDMLRDRETGELSGT-----KGVIAGLGA 118

Query: 120 GFVGN-----PADVVNIRMQND-SAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPN 173
           G + +     P + +   + +D  + +P    N +  I   + + +++G   L  G+ P 
Sbjct: 119 GLLESVAAVTPFEAIKTALIDDKQSAKPRYHNNGRGMIRNYSLLVRDQGFSGLYRGVLPV 178

Query: 174 LVRGVLMTASQVVSYDVCKHNLVTTFGFDASEKKTH----FTASLVAGLVATTICSPADV 229
            +R     A ++  Y+  K  L+  +     +K       F     +G+V      P D 
Sbjct: 179 SMRQAANQAVRLGCYNKIK-TLIQDYTDSPKDKPLSSGLTFVVGAFSGIVTVYSTMPLDT 237

Query: 230 IKTRIMNAHQ-HHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQL 285
           +KTR+ +     + ST+   ++  + EGL   ++G  P   RL  +  ++F + E+L
Sbjct: 238 VKTRMQSLDSTKYSSTINCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKL 294

>ZYRO0D16698g Chr4 complement(1382235..1383152) [918 bp, 305 aa]
           {ON} highly similar to uniprot|P40035 Saccharomyces
           cerevisiae YER053C PIC2 Mitochondrial phosphate carrier
           imports inorganic phosphate into mitochondria
           functionally redundant with Mir1p but less abundant than
           Mir1p under normal conditions expression is induced at
           high temperature
          Length = 305

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/287 (21%), Positives = 121/287 (42%), Gaps = 23/287 (8%)

Query: 22  VGGIVACIITH----PLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILR 77
           +GGIVAC  TH    PLDL K RLQ       +     + I++N+G   +++G+ A+ + 
Sbjct: 22  LGGIVACGPTHSSVAPLDLVKCRLQVNPALYKSNLDGWKSIIRNEGFKKIFTGIGATFIG 81

Query: 78  QCTYTTARFGCYDFIKE----NLLPAD--KLNSTLYLLPCSMISGAIGGFVGNPADVVNI 131
                  ++G Y++ K     N++  D  K + T   L  S  +  +   +  P + + +
Sbjct: 82  YSLQGAGKYGGYEYFKHFYTNNVVSPDLAKRHLTSVYLCASATAEFLADIMLCPFEAIKV 141

Query: 132 RMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVC 191
           R Q        +     N   G+++++  EG+     G+ P   R +  T  +  S++  
Sbjct: 142 RQQTT------IPPFCNNVFQGLSKVYSMEGLSGFYKGIVPLWCRQIPYTMCKFTSFEEI 195

Query: 192 KHNLVTTFGF------DASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTL 245
              +              S+    F    +AG++   +  PADV+ ++I +  +  ES +
Sbjct: 196 VQAIYRRIPTPKEQLSSLSQISVSFLGGYLAGVLCAVVSHPADVMVSKINSEKKEGESMI 255

Query: 246 KVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGM 292
                  +  G G ++ G +     +G  T   +L+ +   K +IG+
Sbjct: 256 HSSKRIYKAIGFGGLWNGLMVRIVMVGTLTSFQWLIYDSF-KVKIGL 301

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + G++  +++HP D+   ++ +  +   ++    +RI K  G  GL++GL   I+   
Sbjct: 223 GYLAGVLCAVVSHPADVMVSKINSEKKEGESMIHSSKRIYKAIGFGGLWNGLMVRIVMVG 282

Query: 80  TYTTARFGCYDFIK 93
           T T+ ++  YD  K
Sbjct: 283 TLTSFQWLIYDSFK 296

>YIL134W Chr9 (97395..98330) [936 bp, 311 aa] {ON}  FLX1Protein
           required for transport of flavin adenine dinucleotide
           (FAD), a synthesis product of riboflavin, across the
           mitochondrial membrane
          Length = 311

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 125/296 (42%), Gaps = 38/296 (12%)

Query: 23  GGIVACIITHPLDLAKVRLQTAARPKPTL----FSMIQRILKNDGPLG------LYSGLT 72
            G V  ++ HPLDL KVRLQ +A          F +I+ I+++    G      LY GL+
Sbjct: 19  AGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNELYRGLS 78

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPA---------------DKLNSTLYLLPCSMISGA 117
            ++          FG Y   KE +  +                K+NS +Y L     SG 
Sbjct: 79  INLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIY-LSAGASSGL 137

Query: 118 IGGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG 177
           +   + NP  V+  R+ + S      +  Y +  +GV ++ + +G + L  GL P L  G
Sbjct: 138 MTAILTNPIWVIKTRIMSTSKGA---QGAYTSMYNGVQQLLRTDGFQGLWKGLVPALF-G 193

Query: 178 VLMTASQVVSYDVCKHNLV---TTFGFDA--SEKKTHFTASLVAGLVATTICSPADVIKT 232
           V   A     YD  K   +      G D   +  +T    SL   +V+ T+  P  ++K+
Sbjct: 194 VSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSL-GKMVSVTLVYPFQLLKS 252

Query: 233 RIMN--AHQHHESTLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLR 286
            + +  A++       ++   I N+G   +++G   +  R  P+T + F V E L+
Sbjct: 253 NLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCVYENLK 308

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 2/77 (2%)

Query: 22  VGGIVACIITHPLDLAKVRLQT--AARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           +G +V+  + +P  L K  LQ+  A   K  LF +I+ I+ NDG +GLY GL+A+++R  
Sbjct: 235 LGKMVSVTLVYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAI 294

Query: 80  TYTTARFGCYDFIKENL 96
             T   F  Y+ +K  L
Sbjct: 295 PSTCITFCVYENLKHRL 311

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 81/186 (43%), Gaps = 16/186 (8%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAAR----PKPTLFSMIQRILKNDGPLGLYSGLTASI 75
           G   G++  I+T+P+ + K R+ + ++       ++++ +Q++L+ DG  GL+ GL  ++
Sbjct: 132 GASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVPAL 191

Query: 76  LRQCTYTTARFGCYDFIKENLLPADKLN------STLYLLPCSMISGAIGGFVGNPADVV 129
               +     F  YD +K+  L   + N      + L  +  + +   +   +  P  ++
Sbjct: 192 F-GVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLVYPFQLL 250

Query: 130 NIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYD 189
              +Q+  A+E   R         +  I   +G   L  GL  NLVR +  T      Y+
Sbjct: 251 KSNLQSFRANEQKFR-----LFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCVYE 305

Query: 190 VCKHNL 195
             KH L
Sbjct: 306 NLKHRL 311

>TBLA0H00550 Chr8 complement(105982..106887) [906 bp, 301 aa] {ON}
           Anc_8.445 YDL198C
          Length = 301

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 110/279 (39%), Gaps = 26/279 (9%)

Query: 24  GIVACIITHPLDLAKVRLQT-------AARPKPTLFSMIQRILKNDGPLGLYSGLTASIL 76
           GI+   + HP+D    RL T       A+     +F     I        L+ GL  +  
Sbjct: 20  GILEICVFHPVDTISKRLMTNHTKVVSASELNKVIFKEYATIPFGKRLFTLFPGLGYAAS 79

Query: 77  RQCTYTTARFGCYDFIKENL---LPADKLNSTLYLLPCSMISGAIGGFVGN------PAD 127
            +      ++G   F+ E L      D  N+       +MIS   G  +G       P D
Sbjct: 80  YKVLQRVYKYGGQPFVNEYLNKNFKKDFDNAFGAKTGKAMISATAGSLIGIGEIILLPLD 139

Query: 128 VVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVS 187
           V+ I+ Q +    P   +       G  +I KEEG   L  G G  + R    + +    
Sbjct: 140 VLKIKSQTN----PDAFKG-----RGFVKILKEEGFFNLYRGWGWTIARNAPGSFALFGG 190

Query: 188 YDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMN-AHQHHESTLK 246
               K  L        +  + +F +S+V    +  + +P DVIKTRI N +  + ES + 
Sbjct: 191 NSFTKEYLFGLKDHSKASWEQNFVSSIVGACSSLIVSAPLDVIKTRIQNRSFDNPESGMT 250

Query: 247 VLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQL 285
           ++ ++++ EG+   F+G  P     GP  +  F + + L
Sbjct: 251 IVKNTLKKEGVTAFFKGLTPKLLTTGPKLVFSFTLAQTL 289

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 22  VGGIVACIITHPLDLAKVRLQTAARPKP-TLFSMIQRILKNDGPLGLYSGLTASIL 76
           VG   + I++ PLD+ K R+Q  +   P +  ++++  LK +G    + GLT  +L
Sbjct: 218 VGACSSLIVSAPLDVIKTRIQNRSFDNPESGMTIVKNTLKKEGVTAFFKGLTPKLL 273

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 43/106 (40%), Gaps = 7/106 (6%)

Query: 192 KHNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHEST--LKVLS 249
           K +    FG    +     TA  + G +   I  P DV+K +        +    +K+L 
Sbjct: 104 KKDFDNAFGAKTGKAMISATAGSLIG-IGEIILLPLDVLKIKSQTNPDAFKGRGFVKIL- 161

Query: 250 SSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVEQLRKYEIGMHQH 295
              + EG   ++RGW  + AR  P +  +F      ++Y  G+  H
Sbjct: 162 ---KEEGFFNLYRGWGWTIARNAPGSFALFGGNSFTKEYLFGLKDH 204

>KLTH0F09790g Chr6 (847760..848833) [1074 bp, 357 aa] {ON} similar
           to uniprot|Q03829 Saccharomyces cerevisiae YMR166C
          Length = 357

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 115/280 (41%), Gaps = 31/280 (11%)

Query: 30  ITHPLDLAKVRLQTAAR-PK-PTLFSMIQRILKNDG-PLGLYSGLTASILRQCTYTTARF 86
           + H LD  K R Q A   PK   + S  + +   +G   GLY G TA++L         F
Sbjct: 64  VMHSLDTVKTRQQGAPNAPKYRNMVSAYKTLFVEEGIRRGLYGGYTAAMLGSFPSAAIFF 123

Query: 87  GCYDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ-NDSAHEPHLRR 145
           G Y+F K  ++    +N T+  L   +    +      P++V+  R+Q     + P+   
Sbjct: 124 GTYEFTKRKMIDEWGVNDTVSHLTAGLGGDLVSSAAYVPSEVLKTRLQLQGRFNNPYFHS 183

Query: 146 --NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNLVTTFGFDA 203
             NY+N  D ++ I + EG R L  G    L R +  +A Q   Y+  +H     + F  
Sbjct: 184 GYNYRNLRDAISVIARIEGWRTLFFGYKATLCRDLPFSAFQFAFYEKFRH-----WAFSL 238

Query: 204 SEKKTHFTASLVAGLVATT--------ICSPADVIKTRIMNAH------------QHHES 243
             K      S+++ L            I +P DVIKTRI                +   S
Sbjct: 239 ENKGQDEDLSVLSELTTGAAAGGLAGIITTPMDVIKTRIQTQTPLMALGDSAKLVRIENS 298

Query: 244 TLKVLSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
            +K L++  R+EG+   F G  P F      + ++ L+ +
Sbjct: 299 LIKGLTAVYRSEGVLGFFSGVGPRFIWTSIQSSIMLLLYQ 338

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 83/198 (41%), Gaps = 23/198 (11%)

Query: 20  GGVGG-IVACIITHPLDLAKVRLQTAARPKPTLF----------SMIQRILKNDGPLGLY 68
            G+GG +V+     P ++ K RLQ   R     F            I  I + +G   L+
Sbjct: 148 AGLGGDLVSSAAYVPSEVLKTRLQLQGRFNNPYFHSGYNYRNLRDAISVIARIEGWRTLF 207

Query: 69  SGLTASILRQCTYTTARFGCYD------FIKENLLPADKLNSTLYLLPCSMISGAIGGFV 122
            G  A++ R   ++  +F  Y+      F  EN    + L S L  L     +G + G +
Sbjct: 208 FGYKATLCRDLPFSAFQFAFYEKFRHWAFSLENKGQDEDL-SVLSELTTGAAAGGLAGII 266

Query: 123 GNPADVVNIRMQNDS-----AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRG 177
             P DV+  R+Q  +          L R   + I G+T +++ EGV    +G+GP  +  
Sbjct: 267 TTPMDVIKTRIQTQTPLMALGDSAKLVRIENSLIKGLTAVYRSEGVLGFFSGVGPRFIWT 326

Query: 178 VLMTASQVVSYDVCKHNL 195
            + ++  ++ Y V   +L
Sbjct: 327 SIQSSIMLLLYQVTLKSL 344

>NCAS0D00910 Chr4 (171719..172840) [1122 bp, 373 aa] {ON} Anc_2.344
          Length = 373

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 117/279 (41%), Gaps = 46/279 (16%)

Query: 32  HPLDLAKVRLQTAA-RPK-PTLFSMIQRILKNDG-PLGLYSGLTASILRQCTYTTARFGC 88
           H LD  K R Q A   PK   + +  + I   +G   GLY G  A++L         FG 
Sbjct: 70  HSLDTVKTRQQGAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGT 129

Query: 89  YDFIKENLLPADKLNSTLYLLPCSMISGAIGGFVGNPADVVNIRMQ-NDSAHEPHLRR-- 145
           Y++ K  ++     N T+  L   ++   +  FV  P++V+  R+Q     + P  +   
Sbjct: 130 YEWCKRKMIGDLGFNDTVSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGY 189

Query: 146 NYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSY-------------DVCK 192
           NY++    +  I   EGV+ L  G    L R +  +A Q   Y             D+ K
Sbjct: 190 NYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITK 249

Query: 193 HNLVTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRI-----------------M 235
           HNL        S     FT ++  GL A  I +P DVIKTR+                 +
Sbjct: 250 HNL--------SIPNEIFTGAIAGGL-AGIITTPMDVIKTRLQTQQADINPNSATTVGAI 300

Query: 236 NAHQHHESTLKVLSSSI-RNEGLGFMFRGWLPSFARLGP 273
           +A  + +S   VLS+SI R+  L +   G +  F+ +GP
Sbjct: 301 SAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGP 339

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 83/206 (40%), Gaps = 34/206 (16%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLF----------SMIQRILKNDGPLGLYS 69
           G +G  V+  +  P ++ K RLQ   R     F          + I+ I+  +G   L+ 
Sbjct: 153 GLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFF 212

Query: 70  GLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLL--PCSMISGAI-GGFVG--- 123
           G  A++ R   ++  +FG Y+  ++     +K + T + L  P  + +GAI GG  G   
Sbjct: 213 GYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIIT 272

Query: 124 NPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTR------------------IFKEEGVRK 165
            P DV+  R+Q   A           AI   T                   +++ EGV  
Sbjct: 273 TPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIG 332

Query: 166 LLTGLGPNLVRGVLMTASQVVSYDVC 191
             +G+GP  V   + ++  ++ Y + 
Sbjct: 333 FFSGVGPRFVWTSVQSSIMLLLYQMT 358

>SAKL0G03146g Chr7 complement(260142..260978) [837 bp, 278 aa] {ON}
           similar to uniprot|Q12375 Saccharomyces cerevisiae
           YOR130C ORT1 Ornithine transporter of the mitochondrial
           inner membrane exports ornithine from mitochondria as
           part of arginine biosynthesis human ortholog is
           associated with
           hyperammonaemia-hyperornithinaemia-homocitrullinuria
           (HHH) syndrome
          Length = 278

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 110/270 (40%), Gaps = 9/270 (3%)

Query: 19  YGGVGGIVACIITHPLDLAKVRLQTA-ARPKPTLFSMIQRILKNDGPL-GLYSGLTASIL 76
           YG + G V  +I +P D  KVRLQT  A   PT +S I+    N+G   G Y G+ + + 
Sbjct: 12  YGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSPLA 71

Query: 77  RQCTYTTARFGCYDFIKENLLPADKLNSTLY-LLPCSMISGAIGGFVGNPADVVNIRMQN 135
                    F  ++  K  LL  + L S L   +     +GA   FV  P +++  ++Q 
Sbjct: 72  GAALENAVLFVSFNQAKR-LLDVESLLSPLSKTVWAGAFAGACASFVLTPVELIKCKLQ- 129

Query: 136 DSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHNL 195
             ++    + ++   +  +  +  E G   L  G     +R     A+   +Y+V K+ L
Sbjct: 130 -VSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNYL 188

Query: 196 VTTFGFDASEKKTHFTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIRNE 255
            +    + +       +   AGL       PAD IK+ +   H    S  + + +    +
Sbjct: 189 ASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHIDLSSATRKIYA---RQ 245

Query: 256 GLGFMFRGWLPSFARLGPNTILIFLVVEQL 285
           G+   +RG   +  R  P    IF   E L
Sbjct: 246 GIAGFYRGLGITLIRAVPANAAIFYTYETL 275

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 74/183 (40%), Gaps = 25/183 (13%)

Query: 18  WYGGVGGIVACIITHPLDLAKVRLQ-----TAARPKPTLFSMIQRILKNDGPLGLYSGLT 72
           W G   G  A  +  P++L K +LQ     T       +   I+ +L   G LGL+ G +
Sbjct: 105 WAGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQS 164

Query: 73  ASILRQCTYTTARFGCYDFIKENLLPADKL--NSTLYLLPCSMISGAIGGFVGN----PA 126
            + +R+     A F  Y+ +K  L    +   N+T  LL     SGA  G   N    PA
Sbjct: 165 GTFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTWELLA----SGASAGLAFNASIFPA 220

Query: 127 DVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
           D +   MQ D        R          +I+  +G+     GLG  L+R V   A+   
Sbjct: 221 DTIKSTMQTDHIDLSSATR----------KIYARQGIAGFYRGLGITLIRAVPANAAIFY 270

Query: 187 SYD 189
           +Y+
Sbjct: 271 TYE 273

>TDEL0G04780 Chr7 (873633..874553) [921 bp, 306 aa] {ON} 
          Length = 306

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 120/276 (43%), Gaps = 20/276 (7%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G + G+   ++  P D+ KVRLQT+ +   T + +I+ ++K++G    Y G  A +L   
Sbjct: 32  GTISGVAQVLVGQPFDITKVRLQTS-QGDSTAYQVIKNLIKDEGLFAFYKGTWAPLLGIG 90

Query: 80  TYTTARFGCYDFIKE--NLLPADKLNSTLYL---LPCSMISGAIGGFVGNPADVVNIRMQ 134
              + +FGC + +K+  ++   +  N  L L     C  +SGA   F+  P + V IRMQ
Sbjct: 91  ACVSCQFGCNEAMKKYFHVRNGNNPNQGLSLPQYYACGAVSGAANAFLATPIEHVRIRMQ 150

Query: 135 NDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVVSYDVCKHN 194
             +  +      +  + D   ++ K  GV  L+ GL   ++R         ++Y+   + 
Sbjct: 151 IQT--KSLNAGEFSGSFDCFKKLLK-RGV--LMRGLTATMLRTSHGFGIYFLTYEALTNR 205

Query: 195 LVTTFGFDASEKKTHFTASL--VAGLVATTICSPADVIKTRIMNAHQ-----HHESTLKV 247
            ++  G    +  T        ++G     +  P DVIK+ +M A +     H  + ++V
Sbjct: 206 QISK-GIKREDIPTWKVCGFGAISGAFFWAMTYPFDVIKS-VMQADKLHLPVHGTNVVQV 263

Query: 248 LSSSIRNEGLGFMFRGWLPSFARLGPNTILIFLVVE 283
             +  R  G     +G+ P+  R  P     F   E
Sbjct: 264 AKAIYRTRGASAFLKGFAPTMFRSLPVNGATFATFE 299

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 11/96 (11%)

Query: 202 DASEKKTH--------FTASLVAGLVATTICSPADVIKTRIMNAHQHHESTLKVLSSSIR 253
           D  +K+ H          A  ++G+    +  P D+ K R+  + Q   +  +V+ + I+
Sbjct: 13  DIEDKRAHSFRRTAKDILAGTISGVAQVLVGQPFDITKVRLQTS-QGDSTAYQVIKNLIK 71

Query: 254 NEGLGFMFRG-WLPSFARLGPNTILIFLVVEQLRKY 288
           +EGL   ++G W P    +G      F   E ++KY
Sbjct: 72  DEGLFAFYKGTWAPLLG-IGACVSCQFGCNEAMKKY 106

>ZYRO0A02530g Chr1 complement(199620..200513) [894 bp, 297 aa] {ON}
           similar to uniprot|Q07534 Saccharomyces cerevisiae
           YDL119C Hypothetical ORF
          Length = 297

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 118/269 (43%), Gaps = 38/269 (14%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQC 79
           G  GG+ + +   PLDL K R+Q       TLF+++++I   D PL L+ G   S +R  
Sbjct: 15  GFFGGLSSAVTLQPLDLLKTRIQ--QNKNATLFTVLKQI---DNPLNLWRGTITSAVRTS 69

Query: 80  TYTTARFGCYDFIKENLLPADKLNSTLYL----LPC-----SMISGAIG----GFVGNPA 126
           T +     C + ++   L  D+ +S        LP      ++I+GA+     G++  P 
Sbjct: 70  TGSALYLSCLNLMR-TALAKDRGSSAAGPSSSNLPQLTTYENLIAGALARGIVGYLTMPF 128

Query: 127 DVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQVV 186
            V+ +R      +E  L  NY +  +    +++  G++    G GP  +R V  +   V+
Sbjct: 129 TVLKVR------YESTLY-NYSSISEATRDVYRTYGIKGFFRGFGPTSLRDVPYSGLYVL 181

Query: 187 SYDVCKH--NLVTTFGFDASEKKTHFTASLVAGL----------VATTICSPADVIKTRI 234
            Y+  K    L+      A E    FT++  A +          +AT+I +P D IKTR+
Sbjct: 182 LYEKAKLIVPLILPREVIAHEHNGKFTSTTSATVNALSAIFSASLATSITAPFDTIKTRM 241

Query: 235 MNAHQHHESTLKVLSSSIRNEGLGFMFRG 263
               +   S    L+  +R E    +F G
Sbjct: 242 QLEPKKFTSFFTTLTIIVRQESPIKLFSG 270

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%)

Query: 26  VACIITHPLDLAKVRLQTAARPKPTLFSMIQRILKNDGPLGLYSGLTASILRQCTYTTAR 85
           +A  IT P D  K R+Q   +   + F+ +  I++ + P+ L+SGL+  + R+       
Sbjct: 226 LATSITAPFDTIKTRMQLEPKKFTSFFTTLTIIVRQESPIKLFSGLSMRLTRKALSAGIA 285

Query: 86  FGCYD 90
           +G Y+
Sbjct: 286 WGIYE 290

>AER184W Chr5 (978781..979698) [918 bp, 305 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL030C (PET9) and
           YBR085W (AAC3)
          Length = 305

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 78/180 (43%), Gaps = 22/180 (12%)

Query: 15  YPWWY------GGVGGIVACIITHPLDLAKVRLQTAARPKPT--------LFSMIQRILK 60
           Y  W+      GG  G ++ +  + LD A+ RL   ++            L  + ++ L 
Sbjct: 110 YAKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLA 169

Query: 61  NDGPLGLYSGLTASILRQCTYTTARFGCYDFIKENLLPADKLNSTL--YLLPCSMISGAI 118
           +DG  GLY G   S++    Y    FG YD +K  LL  +  +S +  +LL  ++ +GA 
Sbjct: 170 SDGIAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVTTGA- 228

Query: 119 GGFVGNPADVVNIRMQNDSAHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGV 178
                 P D V  RM   S         Y  A D   +I   EGV+ L  G G N++RGV
Sbjct: 229 -STASYPLDTVRRRMMMTSGQAVK----YDGAFDAFRKIVAAEGVKSLFKGCGANILRGV 283

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/266 (20%), Positives = 99/266 (37%), Gaps = 29/266 (10%)

Query: 20  GGVGGIVACIITHPLDLAKVRLQ---------TAARPKPTLFSMIQRILKNDGPLGLYSG 70
           GGV   V+     P++  K+ +Q         +  R    +    +R   ++G +  + G
Sbjct: 16  GGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVISFWRG 75

Query: 71  LTASILRQCTYTTARFGCYDFIKENLLPADKLNSTLYLLPCSMISGAIGG-----FVGNP 125
            TA+++R        F   D IK       +++        ++ SG   G     FV   
Sbjct: 76  NTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLASGGAAGGLSLLFV-YS 134

Query: 126 ADVVNIRMQNDS-AHEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLGPNLVRGVLMTASQ 184
            D    R+  DS + +    R +   +D   +    +G+  L  G  P++V  V+     
Sbjct: 135 LDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLY 194

Query: 185 VVSYDVCKHNLVTTFGFDASEKKTHFTASLVAGLVATTICS----PADVIKTRIMNAHQH 240
              YD  K  L+T         ++ F AS + G   TT  S    P D ++ R+M     
Sbjct: 195 FGMYDSLKPLLLT------GNLESSFIASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQ 248

Query: 241 ---HESTLKVLSSSIRNEGLGFMFRG 263
              ++         +  EG+  +F+G
Sbjct: 249 AVKYDGAFDAFRKIVAAEGVKSLFKG 274

 Score = 36.2 bits (82), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 66/170 (38%), Gaps = 20/170 (11%)

Query: 114 ISGAIGGFVGNPADVVNIRMQNDSA--HEPHLRRNYKNAIDGVTRIFKEEGVRKLLTGLG 171
           +S A+      P + V + +QN      +  L R Y   +D   R    EGV     G  
Sbjct: 18  VSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVISFWRGNT 77

Query: 172 PNLVRGVLMTASQVVSYDVCKHNLVTTFGF--DASEKKTHFTASLVAGLVATTI----CS 225
            N++R      +Q +++   K  +   FGF  +       F  +L +G  A  +      
Sbjct: 78  ANVIR---YFPTQALNF-AFKDKIKAMFGFRKEVDGYAKWFAGNLASGGAAGGLSLLFVY 133

Query: 226 PADVIKTRIM--------NAHQHHESTLKVLSSSIRNEGLGFMFRGWLPS 267
             D  +TR+            +     + V   ++ ++G+  ++RG+LPS
Sbjct: 134 SLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPS 183

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,789,697
Number of extensions: 1134406
Number of successful extensions: 6985
Number of sequences better than 10.0: 642
Number of HSP's gapped: 4364
Number of HSP's successfully gapped: 1581
Length of query: 296
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 187
Effective length of database: 40,982,805
Effective search space: 7663784535
Effective search space used: 7663784535
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)