Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C069801.4ON42642619360.0
ZYRO0F18502g1.4ON4504547981e-102
Skud_3.21.4ON4264464842e-55
Kpol_2002.71.4ON4744854872e-55
Suva_3.1511.4ON4214474823e-55
YCL063W (VAC17)1.4ON4233654781e-54
NDAI0A001301.4ON4784994699e-53
Smik_3.131.4ON4254494641e-52
KNAG0C001901.4ON4424744266e-47
NCAS0B091201.4ON4334584161e-45
SAKL0C00440g1.4ON4624784083e-44
TPHA0E040201.4ON5405443502e-35
CAGL0B00308g1.4ON4304912976e-29
KLLA0C00462g1.4ON4604782634e-24
TBLA0A075801.4ON5133302362e-20
KAFR0D001201.4ON3994501994e-16
KLTH0F00462g1.4ON4512471347e-08
Kwal_33.130031.4ON4492391241e-06
Ecym_10071.4ON462154890.021
SAKL0E12474g2.90ON26275722.1
KAFR0B043705.82ON42370722.2
NOTE: 1 genes in the same pillar as TDEL0C06980 were not hit in these BLAST results
LIST: AFR746C

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C06980
         (426 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   750   0.0  
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   311   e-102
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      191   2e-55
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   192   2e-55
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   190   3e-55
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   188   1e-54
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   185   9e-53
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   183   1e-52
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   168   6e-47
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...   164   1e-45
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   161   3e-44
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...   139   2e-35
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...   119   6e-29
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...   105   4e-24
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...    96   2e-20
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    81   4e-16
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    56   7e-08
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    52   1e-06
Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to ...    39   0.021
SAKL0E12474g Chr5 (1032742..1033530) [789 bp, 262 aa] {ON} some ...    32   2.1  
KAFR0B04370 Chr2 complement(905535..906806) [1272 bp, 423 aa] {O...    32   2.2  

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/426 (88%), Positives = 377/426 (88%)

Query: 1   MELEDLSERLLTRSQEAILQLELWIQRQQHLRELEDSSIDKLGNQYNVYIAQLNSLCVRS 60
           MELEDLSERLLTRSQEAILQLELWIQRQQHLRELEDSSIDKLGNQYNVYIAQLNSLCVRS
Sbjct: 1   MELEDLSERLLTRSQEAILQLELWIQRQQHLRELEDSSIDKLGNQYNVYIAQLNSLCVRS 60

Query: 61  EYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQXXXXXXXXXXXXXXXXX 120
           EYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQ                 
Sbjct: 61  EYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQSQSIDSTPSSKSTRSSL 120

Query: 121 XXFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVSKCLSLPGSPVR 180
             FQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVSKCLSLPGSPVR
Sbjct: 121 GSFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVSKCLSLPGSPVR 180

Query: 181 VTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVXXXXXXXXXXXX 240
           VTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITV            
Sbjct: 181 VTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVFDDFDEDADSTS 240

Query: 241 XXXXVISLVPADDGKGLPLRRFNSHESILSTKVQPIXXXXXXXXXXXXXXNRPSMKSVRV 300
               VISLVPADDGKGLPLRRFNSHESILSTKVQPI              NRPSMKSVRV
Sbjct: 241 DQDTVISLVPADDGKGLPLRRFNSHESILSTKVQPISSLPLFSSFLLPSSNRPSMKSVRV 300

Query: 301 SSAPVFSKTSAPASSRDLLSTFVTRPGKASNATGIKQENKLGFFANWNFFKGPSSASHDI 360
           SSAPVFSKTSAPASSRDLLSTFVTRPGKASNATGIKQENKLGFFANWNFFKGPSSASHDI
Sbjct: 301 SSAPVFSKTSAPASSRDLLSTFVTRPGKASNATGIKQENKLGFFANWNFFKGPSSASHDI 360

Query: 361 RATKQKASASRPESNSADCRSKTLEKMAPRRFSPRSPVKAPVFDSLISYEDLREALSTEI 420
           RATKQKASASRPESNSADCRSKTLEKMAPRRFSPRSPVKAPVFDSLISYEDLREALSTEI
Sbjct: 361 RATKQKASASRPESNSADCRSKTLEKMAPRRFSPRSPVKAPVFDSLISYEDLREALSTEI 420

Query: 421 ILTSNR 426
           ILTSNR
Sbjct: 421 ILTSNR 426

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  311 bits (798), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/454 (43%), Positives = 262/454 (57%), Gaps = 41/454 (9%)

Query: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELE-DSSIDKLGNQYNVYIAQLNSLCVRSE 61
           L+D+SERL  RSQEA+LQLELWI+RQQHL E+E + + DK+ +QYN+Y+AQLNSLCVRSE
Sbjct: 4   LDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDKIADQYNLYMAQLNSLCVRSE 63

Query: 62  YVRDKLNK-ERERRMSIINDRKYIEDLVFEFQDITVKLNELAQXXXXXXXXXXXXXXXXX 120
           YVRDKLN   + R+  I+N++ YIEDLV+EFQDITVKLNELAQ                 
Sbjct: 64  YVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVTPSSKHSNGSV 123

Query: 121 XXFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEE--AVSKCLSLPGSP 178
             FQPRPLK+TER+  ++ A R+SP +    +K+V F  + +S  E    SKC SLPGSP
Sbjct: 124 NSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNF--VEESLPELFCPSKCTSLPGSP 181

Query: 179 VRVTGPTR----SIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVXXXXXX 234
           +++  P R     +R+AKSYDTGLN  +  K K  ++ ++ S+F+ENQRLSIT       
Sbjct: 182 LKMRSPDRLPDRPLRVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDDIDE 241

Query: 235 XXXXXXXXXXVISLVPADDGKGL---------PLRRFNSHESILSTKVQPIXXXXXXXXX 285
                     VIS  P      +         PLRR+NSH+S+LSTKVQPI         
Sbjct: 242 GSDSASDQNTVISTSPIPPSHPIQYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCPTFL 301

Query: 286 XXXXXNRPSMKSVRVSSAPVFSKTSAPASSRDLLSTFVTRP----GKASNATGIKQENKL 341
                NRPSMKSV VSSAP+ S T   ASS+DLLS+F++       KA N  G    N+ 
Sbjct: 302 TIPTANRPSMKSVTVSSAPIISSTGGKASSKDLLSSFISNTQDYDKKARNDNG--NNNRF 359

Query: 342 GFFANWNFFKGPSSASHD---IRATKQKASASR----------PESNSADCRSKTLEKMA 388
                WN FK  S  + +   +R  +Q  ++ R          P    + C S+ L K  
Sbjct: 360 SSNLIWNLFKQKSQKNRNPTPLRVPQQDVTSERKENQLLTTSHPSGVYSSC-SRLLVKN- 417

Query: 389 PRRFSPRSPVKAPVFDSLISYEDLREALSTEIIL 422
            +  S  SP +  + +    Y++L+EAL TE++L
Sbjct: 418 -QNSSIISPTRQRITNGNTMYDELQEALDTELVL 450

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  191 bits (484), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 162/446 (36%), Positives = 222/446 (49%), Gaps = 51/446 (11%)

Query: 3   LEDLSERLLTRSQEAILQLELWIQRQQH---LRELEDSSIDKLGNQYNVYIAQLNSLCVR 59
           LED++ERLL RSQEAILQL+LWIQRQQ     +  +  S+DKL  QYN Y++QLNSL VR
Sbjct: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLNSLYVR 65

Query: 60  SEYVRDKLNKERERRM-SIINDRKYIEDLVFEFQDITVKLNELAQ--XXXXXXXXXXXXX 116
           SE VRDKL+KE++RR+ +  N+ + IEDLV EFQDIT +LNELA                
Sbjct: 66  SESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVSNDSPQSQST 125

Query: 117 XXXXXXFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVSKCLSLPG 176
                 FQPRPLK+ ER     +    +P  +K   KSV F+ ++D   +  SK  SLP 
Sbjct: 126 RSSSGSFQPRPLKIIERQ----RVCMVTP--SKPPKKSVGFNPINDV--DCPSKTNSLPC 177

Query: 177 SPVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVXXXXXXXX 236
           SP +     R++R AKS+DTGLN   +KK   +  Y+  S F+  QRLS+T         
Sbjct: 178 SPKKPPAKNRTLRAAKSHDTGLN--KSKKMSSTDAYE--SFFKNKQRLSLTFFDEMDDED 233

Query: 237 XXXXXXXXV---ISLVP-----ADDGKGLPLRRFNSHESILSTKVQPIXXXXXXXX-XXX 287
                   +   IS  P     A   +  PLRR+NSHESILS K  PI            
Sbjct: 234 LDSDQDTIILPNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLGGFPGSF 293

Query: 288 XXXNRP----SMKSVRVSSAPVFSKTSA-------PASSRDLLSTFVTRPGKASNATGIK 336
              + P    S  +V+V   P  + + A         SS+ LLS+F+ RP + +      
Sbjct: 294 YKPSHPTFGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPDRIAAKQDPT 353

Query: 337 QENKLGFFANWNFFKGPSSASHDIRATKQKASASRPESNSADCRSKTLEKMAPRRFSPRS 396
                 F   +N     SS S    + + K      + N  D R   L  +A +      
Sbjct: 354 NLKHTSFLDKFN-----SSLSTISESFQNKKGKKNKDVN--DGRISNLNHIATQE----- 401

Query: 397 PVKAPVFDSLISYEDLREALSTEIIL 422
             K  + D  +S E+L++AL+TE++ 
Sbjct: 402 -QKKNIMDMSVSIEELQDALNTELLF 426

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  192 bits (487), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 168/485 (34%), Positives = 238/485 (49%), Gaps = 82/485 (16%)

Query: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELEDS----SIDKLGNQYNVYIAQLNSLCV 58
           ++DLSERLL RSQEAILQL+LWIQRQQ   E +D+     ++K+ + YN+Y++QLNSL +
Sbjct: 6   IDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQLNSLYI 65

Query: 59  RSEYVRDKLNKERERRMSII----------NDRKYIEDLVFEFQDITVKLNELAQXXXXX 108
           RS+ VRDKLN +++ R + I          N +  IEDL+FEFQDIT KLN LA      
Sbjct: 66  RSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLASSRRRC 125

Query: 109 XXXXXXXXXXXXX-XFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEA 167
                          FQP+PLK++ +     K+L+E   +NK   K+V F  + +  +  
Sbjct: 126 SSSKSSSSRSSSIGSFQPKPLKISLKRN---KSLKE---QNK---KTVTF-DVEEVTDLN 175

Query: 168 VSKCLSLPGSPVR--VTGP--TRSIRMAKSYDTGLNSKNT---KKSKGSRDYDVPSIFRE 220
           ++  +SLPGSP+R   + P     +R AKSYDTGLNSK +   KKSK    YD  S F+ 
Sbjct: 176 INSVISLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNSKRSIKPKKSKIDSVYD--STFKN 233

Query: 221 NQRLSITV--XXXXXXXXXXXXXXXXVIS---------LVPADDGKG--LPLRRFNSHES 267
            QRLSI++                  VIS         L   DD K    PLRR+NSHES
Sbjct: 234 TQRLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSHES 293

Query: 268 ILSTKVQPIXXXX----------XXXXXXXXXXNRPSMKSVRVSSAPVFSK--TSAPASS 315
           ILSTK++PI                           S   V+   A  F K   S   +S
Sbjct: 294 ILSTKIRPISISKRFQIGPFRSVSTTTTSTNYDTTASNTDVK---ADDFYKPNLSNSTTS 350

Query: 316 RDLLSTFVTRPGKASNATGIKQENK------LGFFANWNFFKGPSSASHDIRA------- 362
           +D+LS +  +    ++  G    NK        FF  WN F  P  AS ++ +       
Sbjct: 351 KDILSMYSIKNDVQNSNRGNIINNKKESNSSTSFFNKWNIFNFPLIASSEVGSKQENNTT 410

Query: 363 -----TKQKASASRPESNSADCRSKTLEKMAPRRFSPRSPVKAPVFDSLISYEDLREALS 417
                +++K   S    N A+  + T+        SP   +  P F + +S+++L +AL+
Sbjct: 411 AKHFGSQRKKQISSLSYNKANYSTMTIGPNGSMFCSP--TIYEPTFSNTVSFQELHDALN 468

Query: 418 TEIIL 422
           TE+ L
Sbjct: 469 TELDL 473

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  190 bits (482), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 162/447 (36%), Positives = 221/447 (49%), Gaps = 58/447 (12%)

Query: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELEDS---SIDKLGNQYNVYIAQLNSLCVR 59
           LED++ERLLTRS+EAILQL+LWIQRQQ     E S   S+DKL  QYN Y++QLNSL VR
Sbjct: 6   LEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLNSLYVR 65

Query: 60  SEYVRDKLNKERERRMSI-INDRKYIEDLVFEFQDITVKLNELAQ--XXXXXXXXXXXXX 116
           SE VRDKL+KE+ RR++   N+ K IEDLV EFQDITV+LN+LA                
Sbjct: 66  SESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSPQSQST 125

Query: 117 XXXXXXFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVSKCLSLPG 176
                 FQPRPLK+ ER    V    + P       KSV F+ ++D   E  SK  SLP 
Sbjct: 126 RSSLDSFQPRPLKIIERQRLCVVTPSKPP------KKSVVFNPINDV--ECPSKTNSLPC 177

Query: 177 SPVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVXXXXXXXX 236
           SP +  G   ++R AKS+DTGLN   +KK   +  Y+  S F+  QRLS+T         
Sbjct: 178 SPKKQPGKAHTLRAAKSHDTGLN--KSKKPSSTDAYE--SFFKNKQRLSLTFFDEMDDED 233

Query: 237 XXXXXXXXVISLVPADDGKGL--------PLRRFNSHESILSTKVQPIXXXXXXXXXXXX 288
                   ++  +       +        PLRR+NSHESILS K  P             
Sbjct: 234 LDSDQDTIILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLGSFPFFK 293

Query: 289 XXN---RPSMKSVRVSSAPVFSKTSAP-------ASSRDLLSTFVTRPGK---ASNATGI 335
             N     S+ +V+V+  P  + +  P        +S+ LLS+F+ +P +      +T +
Sbjct: 294 PSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQPDRIVVKQKSTNL 353

Query: 336 KQENKLGFFANWNFFKGPSSASHDIRATKQKASASRPESNSADCRSKTLEKMAPRRFSPR 395
           K  + L       F    S+ S   +  K K S     S+  D R        P    P 
Sbjct: 354 KHTSFLD-----KFNSSLSTISESFQNKKGKKS-----SDLNDDR-------IPPHIMPE 396

Query: 396 SPVKAPVFDSLISYEDLREALSTEIIL 422
                 + D  +S E+L++AL+TE++L
Sbjct: 397 H--NNNLMDMGVSIEELQDALNTELLL 421

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  188 bits (478), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 143/365 (39%), Positives = 194/365 (53%), Gaps = 46/365 (12%)

Query: 3   LEDLSERLLTRSQEAILQLELWIQRQQH---LRELEDSSIDKLGNQYNVYIAQLNSLCVR 59
           LED++ERLL RSQEAILQL+LWIQRQQ     +  +  S+DKL  QYN Y++QLNSL VR
Sbjct: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLNSLYVR 65

Query: 60  SEYVRDKLNKERERRM-SIINDRKYIEDLVFEFQDITVKLNELAQ--XXXXXXXXXXXXX 116
           SE VRDKL+KE++RR+ +  N+ + IEDLV EFQDIT++LNELA                
Sbjct: 66  SESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSPQSQST 125

Query: 117 XXXXXXFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVSKCLSLPG 176
                 FQPRPLK+ ER     +    +P  +K   KSV F+ +++   +  SK  SLP 
Sbjct: 126 RSSLGSFQPRPLKIIERQ----RLCMVTP--SKPPKKSVGFNPINEV--DCPSKTNSLPC 177

Query: 177 SPVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVXXXXXXXX 236
           SP +     R++R AKS+DTGLN   +KK   S  Y+  S F+  QRLS+T         
Sbjct: 178 SPKKQPARNRTLRAAKSHDTGLNK--SKKPSSSDTYE--SFFKNRQRLSLTFFDEMDDED 233

Query: 237 XXXXXXXXVISLVPADDGKGL--------PLRRFNSHESILSTKVQPIXXXXXXXXXXXX 288
                   ++  +      G+        PLRR+NSHESILS K  P             
Sbjct: 234 FDSDQDTIILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNK--PAPSKSLNLGSFSA 291

Query: 289 XXNRP-------SMKSVRVSSAPVFSKTSAP-------ASSRDLLSTFVTRPGKASNATG 334
              RP       S+ +V+V+  P  + T AP       +SS+ LLS+F+ R    S+   
Sbjct: 292 SFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIAR----SDTHT 347

Query: 335 IKQEN 339
           +K+ N
Sbjct: 348 VKENN 352

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  185 bits (469), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 157/499 (31%), Positives = 240/499 (48%), Gaps = 104/499 (20%)

Query: 3   LEDLSERLLTRSQEAILQLELWIQR---QQHLRELEDS---SIDKLGNQ-YNVYIAQLNS 55
           L+D++ERLL RSQEAILQL+LWIQR   QQ L  L +S   + D + NQ YNVY+AQLNS
Sbjct: 5   LQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNS 64

Query: 56  LCVRSEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQXXXXXXXXXXXX 115
           L VR +Y+RDK      +  S  +++KYIE+LV+EF+ IT+KLN+L++            
Sbjct: 65  LIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLSKKNKTTSSSENSS 124

Query: 116 XXXX----XXXFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHD--SKEEAVS 169
                      F+P+PLK+ +R   + K              S   +  HD   ++E + 
Sbjct: 125 KTASSKSSMESFEPKPLKIIKRTKNDQKV-------------SNTINNDHDLIMQDENLQ 171

Query: 170 KCLSLPGSP------VRVTGPTRSIRMAKSYDTGLNSKNTKKSKGS---RDYDVPSI--- 217
           +  SLP SP      V ++   +++R+ KS D     KNT ++      R ++  +I   
Sbjct: 172 RPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFST-KKNTSRNTNYNTIRKFENDTINQF 230

Query: 218 FRENQRLSITVXXXXXXX-----------------XXXXXXXXXVIS--LVPADDGKGLP 258
           F+  QRLSI +                                 VIS   +  +D    P
Sbjct: 231 FKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRNDDDFTP 290

Query: 259 LRRFNSHESILSTKVQ--PIXXXXXXXXXXX-----XXXNRPSMKSVRVSSAPVFSKTSA 311
           LRR+NSHESILS K+   P+                    RPSM+S+ V+S P+F+++S 
Sbjct: 291 LRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSIRRPSMQSIHVTSNPIFARSSQ 350

Query: 312 PASSRDLLSTFVTRPGKASNATGI----------KQENKL-----------GFFANWNF- 349
             +S+DLLS+FVT     +N   I          ++ N+L            FF NWNF 
Sbjct: 351 GKTSKDLLSSFVTSSIPRNNNRNIQTRTKTRTQSRRNNQLRDHTINQTSTSSFFGNWNFL 410

Query: 350 --FKGPSSASHDIRATKQKASASRPESNSADCR----SKTLEKMAPRRFSPRSPVKAPVF 403
             F   +S ++    T +K + + P  N +       + T++ ++         +K PV+
Sbjct: 411 NRFNMITSETN--TTTNRKRNYNIPLVNQSRAHNIDVNDTMDSIS---------IKEPVY 459

Query: 404 DSLISYEDLREALSTEIIL 422
           D+ IS +DL +AL+TE++L
Sbjct: 460 DNTISLDDLEDALNTELLL 478

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  183 bits (464), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 159/449 (35%), Positives = 225/449 (50%), Gaps = 58/449 (12%)

Query: 3   LEDLSERLLTRSQEAILQLELWIQRQQH---LRELEDSSIDKLGNQYNVYIAQLNSLCVR 59
           LED++ERLL RSQEAILQL+LWIQRQQ     +  +   +DK+  QYN Y++QLNSL VR
Sbjct: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLNSLYVR 65

Query: 60  SEYVRDKLNKERERRM-SIINDRKYIEDLVFEFQDITVKLNELAQX--XXXXXXXXXXXX 116
           SE VRDKL+KE++RR+ +  N+ + IEDLV EFQDIT++LNELA                
Sbjct: 66  SESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSPQSQST 125

Query: 117 XXXXXXFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVSKCLSLPG 176
                 FQPRPLK+ ER     +    +P  +K   KSV F+ ++D   +  SK  SLP 
Sbjct: 126 RSSLESFQPRPLKIIERQ----RLCMVTP--SKPPKKSVGFNPINDV--DCPSKTNSLPC 177

Query: 177 SPVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVXXXXXXXX 236
           SP +      ++R AKS+DTGLN   +KK   +  Y+  S F+  QRLS+T         
Sbjct: 178 SPKKQPAKNHTLRAAKSHDTGLN--KSKKPSSADAYE--SFFKNRQRLSLTFFDEMDDED 233

Query: 237 XXXXXXXXV---ISLVP-----ADDGKGLPLRRFNSHESILSTKVQPIXXXXXXX-XXXX 287
                   +   IS  P     A   +  PLRR+NSHESILS K  P+            
Sbjct: 234 FDSDQDTVILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLGSFPVSF 293

Query: 288 XXXNRP----SMKSVRVSSAPVFSKTSAP-------ASSRDLLSTFV---TRPGKASNAT 333
              + P    S+ +V+ +  P  + T AP        SS+ LLS+F+    RP    N  
Sbjct: 294 FKPSNPTFGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSERPMVKQNTP 353

Query: 334 GIKQENKLGFFANWNFFKGPSSASHDIRATKQKASASRPESNSADCRSKTLEKMAPRRFS 393
            +K  + L  F         +S+   I  + Q       + N  D R  +L+ +     +
Sbjct: 354 NLKHVSLLDKF---------NSSLTTISESFQSKKKKNKDLN--DERISSLDHIGAHDRN 402

Query: 394 PRSPVKAPVFDSLISYEDLREALSTEIIL 422
                   + D  +S E+L++AL+TE++L
Sbjct: 403 ------NCIMDMSVSIEELQDALNTELLL 425

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  168 bits (426), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 150/474 (31%), Positives = 221/474 (46%), Gaps = 89/474 (18%)

Query: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELEDSSIDK-----LGNQYNVYIAQLNSLC 57
           LED+++RLL RSQ+AILQLELW+Q+Q+ L   + +S+D+     +  Q N++++QLNSLC
Sbjct: 4   LEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSLC 63

Query: 58  VRSEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQXXXXXXXXXXXXXX 117
           +RS Y+++KL  ER         R YIE+LV+EFQDI + LNEL++              
Sbjct: 64  LRSRYIKEKLASERNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRKNGSPVSQATT 123

Query: 118 XXXXXFQPRPLKLTERH-GPNVKALRESPLK-NKSVIKSVKFSGLHDSKEEAVSKCL--S 173
                F+P+PL++ ER    N K    SP K N + IK  + +   D  E  V+ CL  S
Sbjct: 124 NSSDSFEPKPLRILERQRTCNAK----SPTKRNSNHIKIPRETEKSDFTEN-VADCLHSS 178

Query: 174 LPGSPVRVT-GPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVXXXX 232
           LP SP+R + G  ++IR+ KSY   LN +     K +    + + F    RLS+ +    
Sbjct: 179 LPSSPLRGSNGSQQTIRLTKSYHESLNGQ-----KPTSHSPLMNPFNAKNRLSLYLFDNI 233

Query: 233 XXXXXXXXXXXXVISLVPADD---------------GKGL---PLRRFNSHESILST-KV 273
                          L P DD                KG    PLRR+NSHESILS  K 
Sbjct: 234 DEKE-----------LTPCDDDNSDQETVMYNSPVVSKGAAFEPLRRYNSHESILSVAKK 282

Query: 274 QPIXXXXXXXXXXXXXXN-RPSMKSVRVSSAPVFSK-TSAPASSRDLLSTFVTRPGKASN 331
            PI              N   S +SV VSS PV++K  S  + S+DLLS+        ++
Sbjct: 283 APIHSSAQKLQFYPSATNGTTSAQSVFVSSKPVYTKPLSVQSRSKDLLSSI-------AH 335

Query: 332 ATGIKQENKLGFFANWNFFKGPSSAS--------------HDIRATKQK---------AS 368
           A   K       F  WN F   S+A+              H    T ++         ++
Sbjct: 336 AEASKDTKTTSVFNGWNLFGKSSTAAITSEVGTCAISQKKHSAIKTNRRYITGDTLVIST 395

Query: 369 ASRPESNSADCRSKTLEKMAPRRFSPRSPVKAPVFDSLISYEDLREALSTEIIL 422
           ++RP  + +  R        P  ++  +    P+ D  +   +L EAL TE++L
Sbjct: 396 SNRPRLSRSSVRQ-------PHGYNRHTSPITPIVDHQVRQNELSEALETELLL 442

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score =  164 bits (416), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 145/458 (31%), Positives = 213/458 (46%), Gaps = 66/458 (14%)

Query: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELE------------DSSIDKLGN------ 44
           L+D+SERLL RSQEAILQL++WIQRQ+ L+EL             ++++D  G       
Sbjct: 4   LQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQFLE 63

Query: 45  QYNVYIAQLNSLCVRSEYVRDKL---------NKERERRMSIINDRKYIEDLVFEFQDIT 95
           QYN Y+AQLNSL VR E++RD L         N++ E   S ++++KYI+DLV EFQDIT
Sbjct: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNS-VDEQKYIQDLVHEFQDIT 122

Query: 96  VKLNELAQXXX-XXXXXXXXXXXXXXXXFQPRPLKLTERHGPNVKALRESPLKNKSVIKS 154
            KL+EL+                     F+P+PL++  R   +    +++ L      K 
Sbjct: 123 QKLSELSTVRNPSTASSRSTSTKSSIESFKPKPLRIISRSNTHSHLHQQTSLD-----KK 177

Query: 155 VKFSGLHDSKEEAVSKCLSLPGSPVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDV 214
           V F+      E+  +  +S   S   +   ++S+R  KS D        K+S      D 
Sbjct: 178 VSFN------EDESNSSISHSRSMESLHENSKSLRNTKSMDV------LKRSTFKNHSDF 225

Query: 215 PSIFRENQRLSITV---------XXXXXXXXXXXXXXXXVISLVPADDGKGLP-LRRFNS 264
             +    QRLSI +                         VIS      G   P LRR+NS
Sbjct: 226 SKLLNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGTPIRGADTPLLRRYNS 285

Query: 265 HESILSTKVQPIXXXXXXXXXXXXXXNRPSMKSVRVSSAPVFSKTSAPASSRDLLSTFVT 324
           HESILS + +P                +PSM+SV V+S P+FS+    A+S+DLLS+F+ 
Sbjct: 286 HESILSFR-KPTQSRQPNQILPYSSVRQPSMQSVAVNSNPIFSRMRPNATSKDLLSSFIN 344

Query: 325 RPGKASNATGIKQENKLGFFANWNFFKGPSSASHDIRATKQKASASRPESNSADCRSKTL 384
           +P          + N    F  WNFF   +S + +I  T  +   +          S   
Sbjct: 345 KPQPNRLHQQKPKPNSNSLFGKWNFFNKFNSVTSEIGTTTTQLYPT---------NSSMS 395

Query: 385 EKMAPRRFSPRSPVKAPVFDSLISYEDLREALSTEIIL 422
            K  P      + ++ PVFD  +  EDL +AL+TE++L
Sbjct: 396 NKFNPNDIPSSASIREPVFDDSLHLEDLNDALNTELLL 433

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  161 bits (408), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 157/478 (32%), Positives = 208/478 (43%), Gaps = 77/478 (16%)

Query: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELEDSSIDKLGN-------QYNVYIAQLNS 55
           L ++S++LL RSQEAILQL+L+IQRQQ L E E  ++D+  N       +Y   +AQLNS
Sbjct: 4   LHEISQKLLVRSQEAILQLDLYIQRQQRLYEYE--TLDQPDNGLLTKLQEYQTCLAQLNS 61

Query: 56  LCVRSEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQXXXXXXXXXXXX 115
           L +RSE++RD++     R      D   I  LV EFQ IT KLNELA             
Sbjct: 62  LHIRSEHLRDRIASTDHR---ASQDGDSIGHLVTEFQKITTKLNELAATQDRAYQSPGSQ 118

Query: 116 XXXXXXXFQPRPLKLTER---HGPNVKALRE-------SPL-KNKSVIKSVKFSGLHDSK 164
                  F+P+PLK+ ER     P     R        +PL KN    K V FSG     
Sbjct: 119 STKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH---- 174

Query: 165 EEAVSKCLSLPGSPVRVTGPTRSI------RMAKSYDTGLNSKNTKKSKGSRDYDVPSIF 218
               SK  SLPGSP        SI      R AKS D GLN +  ++       +    F
Sbjct: 175 ----SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLN---FF 227

Query: 219 RENQRLSITVXXXXXXXXXXXXXXXXVISLVPADDG------KGLPLRRFNSHESILSTK 272
           +ENQRLSI+                 VIS+ P +        K  PLRR+NSHES+LS K
Sbjct: 228 KENQRLSISF---FDDEIDYSSDEDTVISVSPPETTSFKGFPKAEPLRRYNSHESVLSRK 284

Query: 273 -----VQPIXXXXXXXXXXXXXXNRPSMKSVRVSSAPVFSKTS-------APASSRDLLS 320
                  P                +P  +SV ++  PV+S  +          +S+DLL+
Sbjct: 285 EVLPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLA 344

Query: 321 TFVTRPGKASNAT----GIKQENKLGFFANWNFFKGP--SSASHDIRATKQKASASR--- 371
            FV+   K    T    G  +E K   F+ W  F      ++   ++ +  K SA R   
Sbjct: 345 QFVSAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNSKPSAKRIGA 404

Query: 372 --PESNSADCRSKTLEK-----MAPRRFSPRSPVKAPVFDSLISYEDLREALSTEIIL 422
             P       R KT        M P      SP   PV ++ +SY+ L EAL TE  L
Sbjct: 405 AAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSPPNEPVLNNKVSYDALHEALCTEFRL 462

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score =  139 bits (350), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 153/544 (28%), Positives = 217/544 (39%), Gaps = 137/544 (25%)

Query: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLR-------------ELEDS--SIDKLGNQYN 47
           LE+LSE+LL RSQEAILQL+LWI RQQ                + +DS  +++ L + Y+
Sbjct: 8   LEELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYD 67

Query: 48  VYIAQLNSLCVRSEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQXXXX 107
           +Y++QLNSL VRSE++RDKLN E+        D + IE+LVFEFQ+I  KLN+LA     
Sbjct: 68  LYMSQLNSLYVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSKL 127

Query: 108 XXXX--XXXXXXXXXXXFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKE 165
                               +PLK+  +H   +   +E  LKNK   KSV F      KE
Sbjct: 128 DKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMS--KELELKNKE--KSVTF-----GKE 178

Query: 166 EAVSKCLSLPG-----------SPVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDY-- 212
             +S   +  G           SP  +    + +R A SYDTGLNSK+    + +R+Y  
Sbjct: 179 TRISLTTNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLNSKSKSNKRSNREYRK 238

Query: 213 ----DVPSIFRENQRLSIT-----------------------------VXXXXXXXXXXX 239
                  S+F+  QR SI+                             +           
Sbjct: 239 KNDAAYDSLFKNKQRFSISLFEDYVDTTTNTNYNEFNPTVDASINTELIENNSDQETVIS 298

Query: 240 XXXXXVISLVPADD-------------------GKGLPLRRFNSHESILSTKVQPIXXXX 280
                 I+  P DD                   GK   LRR NSHESILSTK++      
Sbjct: 299 SSHLPCITNEPLDDYILSNSIQLDKNNNSGNNEGKKSHLRRCNSHESILSTKLENTFYKN 358

Query: 281 XXXXXXX----XXXNRPSMKSVRVSSA---PVFS--KTSAP--------------ASSRD 317
                          RP++ SV  +S    P  S  K  +P               +SR+
Sbjct: 359 VGSNFYDRFIFSSFYRPTVASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRGVTSRE 418

Query: 318 LLSTFVTRPGKASNATGIKQENKLGFFANWNFF----------KGPSSASHDIRATKQKA 367
           LLS F  +P +    T     +   FF NW  F          +  +S S+ I +   K 
Sbjct: 419 LLSKFADKPEQLKAPTTSNSNSSKYFFENWGLFSSMSSSSTFHRKNTSGSNIISSEVGKK 478

Query: 368 SASRPESNSADCRSKTLEKMAPRRFS---------PRSPVKAPVFDSLISYEDLREALST 418
              R    S   +  ++       F           +  +  P+    +SY +L +AL+T
Sbjct: 479 LCDR----STGIKVTSINTQNAYTFPFIRSNSHDITKQNITNPIIKERVSYNELHDALNT 534

Query: 419 EIIL 422
           EI L
Sbjct: 535 EIKL 538

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score =  119 bits (297), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 126/491 (25%), Positives = 216/491 (43%), Gaps = 135/491 (27%)

Query: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELEDS-----SIDKLGNQYNVYIAQLNSLC 57
           LE+++ERLL RS EAI QL+ WI  Q   R + ++     SI++L ++Y  ++ +LNSL 
Sbjct: 4   LEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLNSLY 63

Query: 58  VRSEYVRDKLNKERE----RRMSIINDRKYIEDLVFEFQDITVKLNELAQXXXXXXXX-- 111
           +RS+Y++DK+  E+     +R S +N  + I++L+ EF++IT+ LNE+AQ          
Sbjct: 64  IRSQYIKDKIRTEKNAKATKRKSELNTSR-IQELMLEFKEITLSLNEIAQQDDETNSKQL 122

Query: 112 --XXXXXXXXXXXFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVS 169
                        F P+PLK+  R      ++  SP+ +    +++ F  +H++   +V+
Sbjct: 123 SPASTSTKSSLESFTPKPLKILNR-----ASMIRSPINSPPKKRNISFCPIHENL--SVT 175

Query: 170 KCLSLPGSPVR---VTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSI 226
           +  SLP SP R   +    + +  A+S+ TGL    T+K++      +   F++ QRLS+
Sbjct: 176 EYESLPSSPNRSNLLEEQEQVLHPARSFQTGL---RTEKARKPDKNQLDKYFKDKQRLSL 232

Query: 227 TVXXXXXXXXXXXXXXXXVISLVPADDGKGL----------------------------- 257
           T                 +     ADDG+ L                             
Sbjct: 233 T-----------------LFGSADADDGESLNNNDYSDEETVIFTSSSNIETDAITDDMK 275

Query: 258 PLRRFNSHESILSTKVQPIXXXXXXXXXX----------XXXXNR----PSMKSVRVSSA 303
           P+RR NSHES+LS   + +                        NR    PS+++++VS  
Sbjct: 276 PIRRCNSHESVLSVHNKFVPKNNNNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGT 335

Query: 304 PVFSKTS----------APASSRDLLSTFVTRPGKASNATGI--KQENKLGFFANWNFFK 351
              S+ S             +S+DLL++ +T       AT I  ++ NKL FF  +N   
Sbjct: 336 STLSRFSREQDREMTQLGSKTSKDLLTSVMT-------ATPITTQRNNKLTFFDKFNSMF 388

Query: 352 GPSSASHDIRATKQKASASRPESNSADCRSKTLEKMAPRRFSPRSPVKAPVFDSLISYED 411
             S+ S + + T +K  ++                      SPR        +  +S E+
Sbjct: 389 NFSTISEEQKTTVEKNRSAE---------------------SPR--------NDFVSIEE 419

Query: 412 LREALSTEIIL 422
           L EAL+T +++
Sbjct: 420 LNEALTTNMVM 430

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score =  105 bits (263), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 127/478 (26%), Positives = 210/478 (43%), Gaps = 80/478 (16%)

Query: 3   LEDL---SERLLTRSQEAILQLELWIQRQQHLRELEDSSIDKLGNQYNVYIAQLNSLCVR 59
           +ED+   +ERL+ R  EA++QLEL IQR+    +  +S       +Y  ++A+L+SL +R
Sbjct: 1   MEDMRYVAERLVIRCNEAVMQLELSIQRKMCEFDPNNSHCFIQVQEYYSFLARLSSLKLR 60

Query: 60  SEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQXXXXXXXXXXXXXXXX 119
           +E+V++ L  +R+    +  + + +E L++EFQDIT+ LNE+A+                
Sbjct: 61  AEHVQESLRHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKSARSGSSKE 120

Query: 120 XXXFQPRPLKLTERHGPNVKALRESPLK-----------NKSV--IKSVKFSG-----LH 161
                 + LK+ ER+  ++  +  SP+K           N+S+   ++V+F       LH
Sbjct: 121 SSVIPLKTLKIIERNRDSL--IGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDILH 178

Query: 162 DSKEEAVSKCLSLPGSPV--------RVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYD 213
                +V +  SLPGSP+          +   +++RMAKSYD GLN     ++K + D++
Sbjct: 179 --HLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNG----RAKKNADWE 232

Query: 214 VPSIFRENQRLSITVXXXXXXXXXXXXXXXXV----ISLVPADDGKGLP---LRRFNSHE 266
               F+   RLS++V                V    IS   + +    P   +RR NSHE
Sbjct: 233 ---FFKNKNRLSLSVFDDVNTDASDEETVISVSPPNISYYLSQNEDQYPSKQVRRCNSHE 289

Query: 267 SILSTKVQPIXXXXXXXXXXXXXXNRPSMKSV----RVSSAPVFSKTS----------AP 312
           SILS K+                  RP+ +SV     + + P  S ++          +P
Sbjct: 290 SILSRKI-------LSPSTPANLIMRPTYQSVWQKKAIVTKPTISCSTSNSTASPTIGSP 342

Query: 313 ASSRDLLSTFVTRPGKASNATGIKQENKLGF----FANWNFFKGPSSASHDI-RATKQKA 367
             S+D+LS FVT P            N   F    F  W  F   S  + +I        
Sbjct: 343 HLSKDMLSQFVTAPPSKKYRGWFSSSNSTPFASSIFQKW--FNSDSLVTKEIGNPDNSSP 400

Query: 368 SASRP-----ESNSADCRSKTLEKMAPRRFSPRSPVKAPVFDSLISYEDLREALSTEI 420
           S+ RP     + +S+     T   + P        +  P+    +SY +L+EAL+TE 
Sbjct: 401 SSGRPIVENRQRHSSSNSYSTSIVIGPNGAKFIRGLNDPLVTCTVSYNELQEALNTEF 458

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 99/330 (30%), Positives = 147/330 (44%), Gaps = 71/330 (21%)

Query: 4   EDLSERLLTRSQEAILQLELWIQRQQH------LRELEDSSIDKLGNQYNVYIAQLNSLC 57
           E++S RLLT++QEA+LQL+LWI+ QQ       LR     S+++    YN Y+ QLNSL 
Sbjct: 5   EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQLNSLY 64

Query: 58  VRSEYVRDKLNKERERRMS-------IINDRKYIEDLVFEFQDITVKLNELAQXXXXXXX 110
           +R++Y+RDK+ K+    ++         N   Y++ LV EF  +++K+NEL+        
Sbjct: 65  LRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQENVTN 124

Query: 111 XXXXXXXXXXXX----------FQPRPLKLTER--HGPNVKAL----RESPLK------- 147
                                 FQPRPLK+ +R  H  N         ESPLK       
Sbjct: 125 GSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQKHNNNQNTHPQPDLESPLKLKHRSSY 184

Query: 148 NKSVIKSVKFSGLH---DSKEEAVSKCLSLPGSPVRVTG---PTRSIRMAKSYDTGLNSK 201
           NK +  + K S  +   +SK+   ++ LS   SPV++     PT S+          N++
Sbjct: 185 NKLLSSNKKESKPYKNFNSKKSKNNELLS-DISPVKIQSFEEPTFSVA---------NTR 234

Query: 202 NTKKSKGSRDYDVPSIFRENQRLSITVXXXXXXX---------XXXXXXXXXVISLVPAD 252
           N    K S D    S+F+ N RLSI                              +  + 
Sbjct: 235 N----KNSMDPLHYSLFKTNNRLSIQFPDGYDNDDEYDDPTCISDQDTIFVSTPKIASSI 290

Query: 253 DGKGLPLRRFNSHESILSTK------VQPI 276
                PLR+FNSHESILS +      +QP+
Sbjct: 291 KNTSEPLRKFNSHESILSVEKSNMKFIQPL 320

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 115/450 (25%), Positives = 187/450 (41%), Gaps = 90/450 (20%)

Query: 6   LSERLLTRSQEAILQLELWIQRQQHLRELEDSSIDKLGNQYNVYIAQLNSLCVRSEYVRD 65
           +S+ LL RS+EA+ QLE W+++Q+ L             Q      QLNSLC +S+Y+ +
Sbjct: 5   VSDTLLQRSEEAVSQLESWLKQQEQLH------------QTTAEYKQLNSLCAKSKYISN 52

Query: 66  KLNKERERRMSIIND------RKYI-EDLVFEFQDITVKLNELAQXXXXXXXXXXXXXXX 118
            L   ++   SI +D      R +I E L+ EF +I+ KLNE+                 
Sbjct: 53  LL---KDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIV---------THTSPQS 100

Query: 119 XXXXFQPRPLKLTERHGPNVKALRESPLKNKSVIK-------SVKFSGLHDSKEEAVSKC 171
               F+P+PL L  ++      + ESP ++  V +       S+    +H       +KC
Sbjct: 101 TIDSFEPKPLNLLRKN-----KILESPTRSSPVTRGRLERKISINLFPMH-----TTTKC 150

Query: 172 LSLPGSPVRVTGPT---RSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSI-- 226
            S+P SP   +  T   R++R  KSY  GLN           DY  P  F+EN RLSI  
Sbjct: 151 NSVPTSPKCKSTSTLNQRTLRNIKSYHYGLNG----------DYINP--FKENNRLSISF 198

Query: 227 -----TVXXXXXXXXXXXXXXXXVISLVPADDGKGLPLRRFNSHESILSTKVQPIXXXXX 281
                T                 V+   P        L+R NS +S+     +       
Sbjct: 199 FNGDNTFNDNNSDSESDIDDDDTVLVTSPFLTNPKQKLKRSNSQDSVFWN--ENYLRKPS 256

Query: 282 XXXXXXXXXNRPSMKSVRVSSAPVFSKTSA--PASSRDLLSTFVTRPGKASNATGIKQEN 339
                    +  +  +  +SS  VF K +    +SS+ LL++FV           ++Q+ 
Sbjct: 257 FQKQLNLFPSTLTKPTAELSSTQVFLKNTGRLGSSSKALLTSFV--------KDNLQQQQ 308

Query: 340 KLGFFANW-NFFKGPSSASHDIRATKQKA--SASRPESNSADCRSKTLEKMAPR--RFSP 394
           +    +++ N F   +S     +  K +   +  R  S+++   S  +     R  RFS 
Sbjct: 309 RTHNASSFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLITSKKSRFNRFSS 368

Query: 395 R---SPVKAPVFDSLISYEDLREALSTEII 421
               SP K P+ ++ + Y DL +AL+TE +
Sbjct: 369 VDNISPTKKPIINNDVQYSDLNDALNTEFL 398

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 111/247 (44%), Gaps = 35/247 (14%)

Query: 2   ELEDLSERLLTRSQEAILQLELWIQRQQHLRE-------LEDSSIDKLGNQYNVYIAQLN 54
           +L+++++  L  SQ A+ +L+  ++RQ+ L E       L D S   +  QY  YI QL 
Sbjct: 3   QLQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTNMA-QYYEYIGQLY 61

Query: 55  SLCVRSEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQXXXXXXXXXXX 114
           SL  +++ + D +     + +S +  R  IE+L+ EFQ+I    N+              
Sbjct: 62  SLYTKAQKLSDTVILSDSKSLSSVQQRA-IENLIQEFQEIAK--NDENFISYSMRESPNS 118

Query: 115 XXXXXXXXFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKF-------SGLHDSKEEA 167
                   FQP+PLK+ +R     +A  ESP K +S   S+         + L  + + +
Sbjct: 119 MSVQSICSFQPKPLKILQRR----QAQLESPTK-RSFRPSMSLLDNRGDETNLATASDRS 173

Query: 168 VSKCL-SLPGS-----PVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFREN 221
             + L S P S     P      T  IR AKS D GLN ++          +  + F++ 
Sbjct: 174 QERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHE------NRLNFFKDR 227

Query: 222 QRLSITV 228
           QRLSI+ 
Sbjct: 228 QRLSISF 234

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 103/239 (43%), Gaps = 22/239 (9%)

Query: 2   ELEDLSERLLTRSQEAILQLELWIQRQQHLRELE--DSSIDKLGN----QYNVYIAQLNS 55
           +L  +++  L RS+EA+++LE  + +Q+ L E E  D  + +  +    QY  Y+ QLN 
Sbjct: 3   QLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLNC 62

Query: 56  LCVRSEYVRDKLNKERERRMSIIND-RKYIEDLVFEFQDITVKLNELAQXXXXXXXXXXX 114
           L ++++ ++D +     R   + N  ++ IE L  +++ +    NEL             
Sbjct: 63  LYIKAQSLKDMMGN---RCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDSPSC 119

Query: 115 XXXXXXXXFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKE---EAVSKC 171
                   FQP+PLK+ ER                 + KS   SG   + +   + + K 
Sbjct: 120 LSPASVSSFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEIGKT 179

Query: 172 LSL-PGSPV--RVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSIT 227
            S    SP         + IR+ KS  TGLN  +          +  S FR+ QRLSI+
Sbjct: 180 NSCNTNSPCTNEAKKEPKFIRVVKSCGTGLNKHSNPHE------NRLSFFRDRQRLSIS 232

>Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to
           XP_452214  K. lactis KLLA0C00462g
          Length = 462

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 56/154 (36%), Gaps = 31/154 (20%)

Query: 8   ERLLTRSQEAILQLELWIQRQQHLRELEDSSIDKLGNQYNVYI----------------- 50
            RLLTR QE+++ L L IQ    L EL         N +N  I                 
Sbjct: 9   HRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQR 68

Query: 51  -----------AQLNSLCVRSEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLN 99
                      A L SL +R++++ DK +K          D   ++ L  EF+DI+  L 
Sbjct: 69  TEQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQI---DLDTVKKLGSEFEDISHNLC 125

Query: 100 ELAQXXXXXXXXXXXXXXXXXXXFQPRPLKLTER 133
            L                     FQ RPLKL +R
Sbjct: 126 FLEPNKVFDKNHTRFRSSEYPAPFQLRPLKLLQR 159

>SAKL0E12474g Chr5 (1032742..1033530) [789 bp, 262 aa] {ON} some
           similarities with uniprot|P38844 Saccharomyces
           cerevisiae YHR143W
          Length = 262

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 141 LRESPLKNKSVIKS----VKFSGLHDSKEEAVSKCLSLPGSPVRVTGPTRSIRMAKSYDT 196
           + E  L N  V  S    VK S    +  EA++   S   S V  T P+ +I +A +  T
Sbjct: 61  IEEITLANSKVTSSTKAVVKTSTFATTSTEAMADNNSQLTSAVEGTQPSSTISVAATTST 120

Query: 197 GLNSKNTKKSKGSRD 211
           G++S  TK+S GS +
Sbjct: 121 GVSSTYTKQSVGSTE 135

>KAFR0B04370 Chr2 complement(905535..906806) [1272 bp, 423 aa] {ON}
           Anc_5.82 YGR244C
          Length = 423

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%)

Query: 33  ELEDSSIDKLGNQYNVYIAQLNSLCVRSEYVRDKLNKERERRMSIINDRKYIEDLVFEFQ 92
           E+ D++   LGN      +  +   V   YV +K+N E+E  +SI+ DR+    L+   +
Sbjct: 94  EIADAASKMLGNHLITKQSGPDGKFVSGVYVVEKINVEKEAYLSILMDREKKVPLIIASK 153

Query: 93  DITVKLNELA 102
           D  V + E+A
Sbjct: 154 DGGVNIEEVA 163

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,922,557
Number of extensions: 1428531
Number of successful extensions: 4339
Number of sequences better than 10.0: 42
Number of HSP's gapped: 4416
Number of HSP's successfully gapped: 47
Length of query: 426
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 314
Effective length of database: 40,638,807
Effective search space: 12760585398
Effective search space used: 12760585398
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)