Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C069701.5ON94194142990.0
ZYRO0F18480g1.5ON96010269021e-105
KAFR0D001401.5ON10417838422e-96
TPHA0E040101.5ON96510318214e-94
NCAS0B091101.5ON10207947841e-88
Kpol_2002.81.5ON98510257778e-88
TBLA0A075701.5ON12528356994e-76
KNAG0C002201.5ON11617766594e-71
CAGL0B00330g1.5ON11366366409e-69
Smik_3.141.5ON11134415921e-62
NDAI0A001401.5ON10914095796e-61
YCL061C (MRC1)1.5ON10964355601e-58
Suva_3.1521.5ON11404125556e-58
Skud_3.31.5ON11524735558e-58
KLTH0F00484g1.5ON9936245431e-56
SAKL0C00462g1.5ON11773625309e-55
Kwal_33.130051.5ON9706825057e-52
KLLA0C00484g1.5ON9254184371e-43
AFR745W1.5ON10183634202e-41
Ecym_10081.5ON11183544194e-41
NCAS0G008405.612ON47186771.5
KNAG0M024402.653ON170060743.9
NCAS0A036008.78ON123683744.5
TDEL0A047905.612ON47364735.4
NDAI0F015006.234ON118360719.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C06970
         (941 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...  1660   0.0  
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   352   e-105
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   328   2e-96
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   320   4e-94
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   306   1e-88
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   303   8e-88
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   273   4e-76
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   258   4e-71
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   251   9e-69
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   232   1e-62
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   227   6e-61
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   220   1e-58
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   218   6e-58
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   218   8e-58
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   213   1e-56
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   208   9e-55
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   199   7e-52
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   172   1e-43
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   166   2e-41
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   166   4e-41
NCAS0G00840 Chr7 complement(144027..145442) [1416 bp, 471 aa] {O...    34   1.5  
KNAG0M02440 Chr13 complement(449275..454377) [5103 bp, 1700 aa] ...    33   3.9  
NCAS0A03600 Chr1 (717693..721403) [3711 bp, 1236 aa] {ON} Anc_8....    33   4.5  
TDEL0A04790 Chr1 (844870..846291) [1422 bp, 473 aa] {ON} Anc_5.6...    33   5.4  
NDAI0F01500 Chr6 complement(369071..372622) [3552 bp, 1183 aa] {...    32   9.6  

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
           YCL061C
          Length = 941

 Score = 1660 bits (4299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 839/941 (89%), Positives = 839/941 (89%)

Query: 1   MDKLFESFDNAIKKRRATYQKAVQNEDDEYTEDPLVPPAVLGNGFLFNSSTLDKVKNRLN 60
           MDKLFESFDNAIKKRRATYQKAVQNEDDEYTEDPLVPPAVLGNGFLFNSSTLDKVKNRLN
Sbjct: 1   MDKLFESFDNAIKKRRATYQKAVQNEDDEYTEDPLVPPAVLGNGFLFNSSTLDKVKNRLN 60

Query: 61  KDQEQGTQAIDTTQVLSNLYEDGEDLEKEVPSILQSKSKPIPTILIPSIEREILKQPFNE 120
           KDQEQGTQAIDTTQVLSNLYEDGEDLEKEVPSILQSKSKPIPTILIPSIEREILKQPFNE
Sbjct: 61  KDQEQGTQAIDTTQVLSNLYEDGEDLEKEVPSILQSKSKPIPTILIPSIEREILKQPFNE 120

Query: 121 NHNFTGVTVPIAKSSAITKNLDREDLESPEIPETQPIPDFSASDVPTQTQVLKTTSEXXX 180
           NHNFTGVTVPIAKSSAITKNLDREDLESPEIPETQPIPDFSASDVPTQTQVLKTTSE   
Sbjct: 121 NHNFTGVTVPIAKSSAITKNLDREDLESPEIPETQPIPDFSASDVPTQTQVLKTTSETAA 180

Query: 181 XXXXXXXXXXXYEESLTQVEVSEQTYPDQRNSQEDIIQQTAADAVPITRLKIHEIEEMWS 240
                      YEESLTQVEVSEQTYPDQRNSQEDIIQQTAADAVPITRLKIHEIEEMWS
Sbjct: 181 DTGTVATAAIAYEESLTQVEVSEQTYPDQRNSQEDIIQQTAADAVPITRLKIHEIEEMWS 240

Query: 241 REVQTETKEHKVKYRAPRPLKVFTKEAFMQXXXXXXXXXXXXXXQEIKATSPIGRNNDSI 300
           REVQTETKEHKVKYRAPRPLKVFTKEAFMQ              QEIKATSPIGRNNDSI
Sbjct: 241 REVQTETKEHKVKYRAPRPLKVFTKEAFMQDFDKSSDSDSDVFDQEIKATSPIGRNNDSI 300

Query: 301 SEVGTSDVKVLKDKSSGALTAYQRELKEKAEIAKGVMLLSESDDEEDLAVSTSHEAKATV 360
           SEVGTSDVKVLKDKSSGALTAYQRELKEKAEIAKGVMLLSESDDEEDLAVSTSHEAKATV
Sbjct: 301 SEVGTSDVKVLKDKSSGALTAYQRELKEKAEIAKGVMLLSESDDEEDLAVSTSHEAKATV 360

Query: 361 LKLKARLSKRRPPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEK 420
           LKLKARLSKRRPPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEK
Sbjct: 361 LKLKARLSKRRPPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEK 420

Query: 421 EIVENLLEQEIARNKRIRMKEKEKAQMNDVPSLALPNRVEEDNDSNYSVSDEDSVIKXXX 480
           EIVENLLEQEIARNKRIRMKEKEKAQMNDVPSLALPNRVEEDNDSNYSVSDEDSVIK   
Sbjct: 421 EIVENLLEQEIARNKRIRMKEKEKAQMNDVPSLALPNRVEEDNDSNYSVSDEDSVIKEDL 480

Query: 481 XXXXXXXXXXXXNEPKIASDSAGVEIDSDEDDIRFMKGKAHKIXXXXXXXXXXXXXXTVN 540
                       NEPKIASDSAGVEIDSDEDDIRFMKGKAHKI              TVN
Sbjct: 481 DYSDLESDDSGSNEPKIASDSAGVEIDSDEDDIRFMKGKAHKISLLNDDESEEEEDLTVN 540

Query: 541 SAINLGAYGDNLITTTKDEAHTSAEEHTTQLVNEISESQYRTMEKEKSKIRAQEEKQRLK 600
           SAINLGAYGDNLITTTKDEAHTSAEEHTTQLVNEISESQYRTMEKEKSKIRAQEEKQRLK
Sbjct: 541 SAINLGAYGDNLITTTKDEAHTSAEEHTTQLVNEISESQYRTMEKEKSKIRAQEEKQRLK 600

Query: 601 QMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQIRQL 660
           QMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQIRQL
Sbjct: 601 QMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQIRQL 660

Query: 661 LMAENKETDLKTVNKILHDIKNGGFRKRRQXXXXXXXXXXXXXXXXXYXXXXXXXXXXXX 720
           LMAENKETDLKTVNKILHDIKNGGFRKRRQ                 Y            
Sbjct: 661 LMAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDEDDELLNYKKRKLELMRKRR 720

Query: 721 XQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQAETSEKDKKSEGLVDASNKQKDT 780
            QFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQAETSEKDKKSEGLVDASNKQKDT
Sbjct: 721 LQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQAETSEKDKKSEGLVDASNKQKDT 780

Query: 781 ISHEFVQQXXXXXXXXXXXXXXXVARVSQEGERNTDLNSLKQDSTVKTLYAPSNIISESE 840
           ISHEFVQQ               VARVSQEGERNTDLNSLKQDSTVKTLYAPSNIISESE
Sbjct: 781 ISHEFVQQSLSFLSSSRDFSEFEVARVSQEGERNTDLNSLKQDSTVKTLYAPSNIISESE 840

Query: 841 RADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITY 900
           RADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITY
Sbjct: 841 RADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITY 900

Query: 901 LGKMRKLVAPKKSNAEVRTTSKLSTLGNSKIFRNFESSFEN 941
           LGKMRKLVAPKKSNAEVRTTSKLSTLGNSKIFRNFESSFEN
Sbjct: 901 LGKMRKLVAPKKSNAEVRTTSKLSTLGNSKIFRNFESSFEN 941

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
           similar to uniprot|P25588 Saccharomyces cerevisiae
           YCL061C MRC1 S-phase checkpoint protein found at
           replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 960

 Score =  352 bits (902), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 326/1026 (31%), Positives = 500/1026 (48%), Gaps = 153/1026 (14%)

Query: 1   MDKLFESFDNAIKKRRATYQKAVQNEDDE----YTEDPLVPPAVLGNGFLFNSSTLDKVK 56
           MD L E  D    KRR TY+K  + +++E     +  P  PP +LGNGFLF +ST+DKV+
Sbjct: 1   MDSLLEKLDPLSSKRRTTYKKVFEPQEEEETQQISNSP--PPPILGNGFLFQNSTIDKVR 58

Query: 57  NRLNKDQEQGTQAI---------------DTTQVLSNLYEDGEDLE------------KE 89
           NRL ++ E G   +               + TQV+++LYE  E+LE            K+
Sbjct: 59  NRL-RNAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEGAEELEEQNKERVRLPLSKK 117

Query: 90  VPSILQSKSKPIPTILIPSIEREILKQPFNENHNFTGVTVPIAKSSAITKNLDREDLESP 149
             S  Q K++ IP    P++E         EN+   G  +   K+  +   +  +     
Sbjct: 118 TSSASQEKTQVIP--WAPTVEGV-------ENNVEQGTDIHEEKTQQVPNEISYDQ---- 164

Query: 150 EIPETQPIPDFSASDVPTQTQVL----KTTSEXXXXXXXXXXXXXXYEESLTQVEVSEQT 205
              +TQ I  F  ++V   TQ +    +T                  +  +TQ+++S   
Sbjct: 165 ---KTQAIQSFQQTEVEPLTQRISEPERTLDVPTYAATSEDQLDTQEQNPITQLDISNSL 221

Query: 206 YPDQRNSQEDIIQQTAAD--AVPITRLKIHEIEEMWSREVQTETKEHKVKYRAP-RPL-- 260
                     + Q T +D    P  RLK+H+IE+    + Q       ++YRAP +P+  
Sbjct: 222 ----------LFQATDSDIPKSPPQRLKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNV 271

Query: 261 -KVFTKEAFMQXXXXXXXXXXXXXXQEIKATSPIGRNNDSISEVGTSDVK---VLKDKSS 316
            +VF+KEAF++                           D + E+ + D++     KDKS+
Sbjct: 272 KRVFSKEAFLKNFDEESSSE------------------DELIELRSRDIEKKHTEKDKST 313

Query: 317 -----------GALTAYQRELKEKAEIAKGVMLLSESDDEEDLAVST-SHEAKATVLKLK 364
                         + Y+ +LK + +  + + L  + D+ ++      S  +KATVL +K
Sbjct: 314 LENTTESSQRQRVFSVYEYKLKGELDSKRCIQLDDDEDESDEDVEVPLSRVSKATVLDIK 373

Query: 365 ARLSKRRPPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVE 424
           AR SK+ P  + +  K +L+ L+  L+ ++K+QI D Q E ++ +G K ED+EK+KE +E
Sbjct: 374 ARRSKQEPLSKIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIE 433

Query: 425 NLLEQEIARNKRIRMKEKEKAQMNDVPSLALPNRVEEDN----DSNYSVSDEDSVIKXXX 480
           NLLEQEIARNKR+  +E E+   ND+   +  +  E +N    D  +S   E    +   
Sbjct: 434 NLLEQEIARNKRLARRENEEDNSNDLEDRSYGSGNESENSAFSDIEFSGDSESDDGQEDD 493

Query: 481 XXXXXXXXXXXXNEPKIASD--SAGVEIDSDEDDIRFMKG--KAHKIXXXXXXXXXXXXX 536
                        +    SD  SA  +   +ED+    KG  K HK+             
Sbjct: 494 MNNDDERVQKEKMQEAGDSDNISAREDHSDEEDEDSIQKGRTKNHKMLPAEDSDSEHDDT 553

Query: 537 XTVNSAINLGAYGDNLITTTKD-----------EAHTSAEEHTTQLVNEISESQYRTMEK 585
              N  I+LG YG+NL    ++           E   + EE T +L+          MEK
Sbjct: 554 LPRN-IIDLGPYGNNLQVNHEEDMENLPLSDSAEIDAAEEEKTNELI----------MEK 602

Query: 586 -EKSKIRAQEEKQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMI 644
             K ++R ++++QRLK MK  G+  M +MEAEES+DEW+GVGGVDG+  D++DSDLE+MI
Sbjct: 603 IRKIEMRKKKKEQRLKDMKAKGLNKMLEMEAEESEDEWKGVGGVDGDLSDEHDSDLEEMI 662

Query: 645 DDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQXXXXXXXXXXXXXX 704
           DDF+ +  N D +RQLL  ENKE D K VNKIL+DIKNGGFRKR +              
Sbjct: 663 DDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNALDLELSDDEDED 722

Query: 705 XXXYXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQAETSEKD 764
              Y             + G D +K  +N++SKAF ESMV+DI + K+PF +     E D
Sbjct: 723 LRNYRLKRRELMKKSRIE-GKDKEKAFRNAKSKAFLESMVDDIDESKNPFGD----PEMD 777

Query: 765 KKSEGLVDAS------NKQKDTISHEFVQQXXXXXXXXXXXXXXXVARVSQEGERNTDLN 818
            +    VD        NK+K+T+S EFVQ+               +      G+   D++
Sbjct: 778 VEDNTDVDTQENDYPKNKEKNTLSQEFVQRSLSFLSNNNSSREFELGEQITLGDEEQDVS 837

Query: 819 SLKQDSTVKTLYAPSNIISESERADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKLKEG 878
           SLK++S++  L+  S+ I E    ++++ D   LP      S++KS     + N+K + G
Sbjct: 838 SLKRNSSIHALHNSSSPIKEDLEKENQDEDFITLP-NFKPPSLIKSLAGGFDPNNKFQSG 896

Query: 879 RKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAEV----RTTSKLSTLGNSKIFRN 934
           +KTVTVSKSYR VGG+++SITY GKMRKLV PK  N+ +    R  SK  T+G  K++ +
Sbjct: 897 KKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPASK-PTMG--KLWES 953

Query: 935 FESSFE 940
            ++SF+
Sbjct: 954 QQNSFD 959

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  328 bits (842), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 272/783 (34%), Positives = 400/783 (51%), Gaps = 109/783 (13%)

Query: 230  LKIHEIEEMWSREVQTET-KEHKVKYRAPRPLKVFTKEAFM--------QXXXXXXXXXX 280
            LKIHEI+       +T+T  E+K   R P+ + VFTKE++         +          
Sbjct: 295  LKIHEIQRELEESQKTKTIPEYKQHVRTPKNVIVFTKESYFDEFDSDDEEKEENLESEGD 354

Query: 281  XXXXQEIKATSPIGRNNDSISEVGTSDVKVLKDKSSGA---------LTAYQRELKEKAE 331
                Q +K TSP  ++ND          K L DK+  +         L  Y+ +LK +  
Sbjct: 355  SQKVQLLKNTSPSDKSNDG---------KRLPDKTRTSPSFKPKLHGLNNYELKLKRQLN 405

Query: 332  IAKGVMLLSESDDEEDL-----AVSTSHEAKATVLKLKARLSKRRPPVE-SQHGKASLSA 385
              + + L  +SDDE+ +         S  +KATV  +KARLSK+RP V+ S   K +L  
Sbjct: 406  SDQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKKRPIVKISNDSKTTLHT 465

Query: 386  LMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIARNKRIRMKEKEKA 445
            L   L+ ++++QI++ QKE IE++GL  ED+EKEK+IVENLLEQEI RNK+IR +EKE+ 
Sbjct: 466  LFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQEINRNKKIRQREKERE 525

Query: 446  QMNDVPSLALPNRVEEDNDSNYSVSDEDSVIKXXXXXXXXXXXXXXXNEPKIASDSAGVE 505
            +      LA     E D D ++S ++ D                    E +++ + + ++
Sbjct: 526  KQ-----LADAQDDENDLDFDHSANELD--------------------ESELSGEESAID 560

Query: 506  IDSDEDDIRFMKGK--AHKIXXXXXXXXXXXXXXTVNS---------------AINLGAY 548
             D+D DD    K K    K+              + N+               AINLG Y
Sbjct: 561  SDNDYDDFSLEKTKRSKKKVIVEDSDTEIEDEKMSHNAQIREEKDDSLFQNRNAINLGPY 620

Query: 549  GDNL------ITTTKDEAHT--SAEEHTTQLVNEISES-QYRTMEKEKSKIRAQEEKQ-- 597
            GDNL      ITT K        + E   +   EI E  + R +E++K     ++ KQ  
Sbjct: 621  GDNLSLAPIRITTEKQSGKNFKVSRESGDERDEEIPEKDRIRLIEEKKQHELERQRKQMK 680

Query: 598  RLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQI 657
            + K+MK  G+TN  + EAEES+DEW G+GG+DGE  D+YDS++EKMIDD+S    N D+I
Sbjct: 681  KRKEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEI 740

Query: 658  RQLLMAENKETDLKTVNKILHDIKNGGFRKRRQXXXXXXXXXXXXXXXXXYXXXXXXXXX 717
            RQ+L  ENKETD+K V KIL+DIKNGGFRKRR+                 Y         
Sbjct: 741  RQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMDLELSDEEDDELKQYRLKRRELMR 800

Query: 718  XXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPF-----------SNQAETSEKDKK 766
                + G + + L+KN +SKAFFESMV+DI+++K+PF           +    T E    
Sbjct: 801  QKRLEVG-EAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQRSGTITTDDGTQENANS 859

Query: 767  SEGLVDASNKQKDTISHEFVQQXXXXXXXXXXXXXXXVARVSQEGERNT----DLNSLKQ 822
            +EG    +  +K  +S EFVQ+                AR S   E N     DL +LK+
Sbjct: 860  NEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFAPAR-SMRAEANDELIEDLTALKK 918

Query: 823  DSTVKTLYAPSNIISES----ERADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKLKEG 878
             S++K+       +S+     ++ + + FD+ +L      SS++K+F   ++ NDK +EG
Sbjct: 919  QSSIKSFKTTRASVSQEPTDFDKENDDSFDD-LLNSRVGTSSIMKTFSATVDINDKFQEG 977

Query: 879  RKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAEVRTTS-KLSTLGNSKIFRNFES 937
             KTV VSK+Y++V  +KASITY+GKMRKLVAP+K  A + ++  K +    SK+F   + 
Sbjct: 978  VKTVKVSKAYKSVSSSKASITYMGKMRKLVAPQKKVANLSSSDIKNTNSRTSKLFSRQDE 1037

Query: 938  SFE 940
            SFE
Sbjct: 1038 SFE 1040

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 3/90 (3%)

Query: 1  MDKLFESFDNAIKKRRATYQKAVQNEDDEYTEDPLVPPAVLGNGFLFNSSTLDKVKNRLN 60
          MD +F +      K+R TY+K   + +++ +E    PPA+ G GFLF++ TL+++K RL+
Sbjct: 1  MDGIFGNLQALKPKKRTTYKKISDDLENDTSESNNDPPALTGEGFLFDNPTLNRIKKRLD 60

Query: 61 ---KDQEQGTQAIDTTQVLSNLYEDGEDLE 87
             KD  Q T     TQ++SNLY  GEDL+
Sbjct: 61 GEEKDVVQYTMNFSQTQLISNLYGGGEDLD 90

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
           YCL061C
          Length = 965

 Score =  320 bits (821), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 343/1031 (33%), Positives = 495/1031 (48%), Gaps = 157/1031 (15%)

Query: 1   MDKLFESFDNAIKKRRATYQKAVQN--EDDEYTEDPLVPPAV-----LGNGFLFNSSTLD 53
           MD LF+   N  KK+R TY K   +  E+++ +ED L          L  G LF +S L 
Sbjct: 1   MDSLFDQL-NHFKKKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSILG 59

Query: 54  KVKNRLN-------------------KDQEQ-GTQAIDTTQVLSNLYEDGEDLEKEVPSI 93
           +++NRLN                   KD EQ  TQ    TQ+++NLY+ GEDLE E+   
Sbjct: 60  QIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEIFHN 119

Query: 94  LQSKSKPIP-TILIPSIEREILKQPFNENHNFTGVTVPIAKSSAITKN--LDREDLESPE 150
              K++ I   ILI +              N    +    K+  IT N  L  + L+   
Sbjct: 120 SFKKTQIITDNILIET--------------NTNDKSTQYEKTQVITINERLSDKPLDVVN 165

Query: 151 -------IPETQPIPDFSASDVPTQTQVLKTTSEXXXXXXXXXXXXXXYEESLTQVEVSE 203
                  I  TQP+P    S++  +TQV+   +                 +++   + +E
Sbjct: 166 NTQTVLVIENTQPLP----SEI--KTQVVNEVNSALPVTQPT--------QTIVATQANE 211

Query: 204 QTYPDQRNSQEDIIQQTAAD-AVPITRLKIHEIEEMWSRE--VQTETK---EHKVKYRAP 257
            TY  Q       +  T  D A+  T LKI +IE+    E  +  ET+   E K K    
Sbjct: 212 VTYDTQE------LMPTVDDVAMRSTGLKITDIEKELEEEQRLAKETEFGTEFKFKESES 265

Query: 258 RPLKVFTKEAFMQXXXXXXXXXXXXXXQEIKATSPIGRNNDSISEVGTSDVK---VLKDK 314
           +  K F+KE F+                E       G N D  SEV   D K   +LK K
Sbjct: 266 KISKKFSKEDFLNHFDDSSSSEDETSKNEK------GPNVDK-SEVLHPDNKSKTLLKVK 318

Query: 315 SSGALTAYQRELKEKAEIAKGVMLLSESDDEEDLAVSTSHEAKATVLKLKARLSKRRPPV 374
           S   L  Y+  L+ KA   + ++  SESD++ D  +S S+ +KA +L ++A  SK++P V
Sbjct: 319 SINGLGNYEHNLRRKAN-NEQIIEFSESDEDSDTNISPSYASKAVILNIRANKSKQQPKV 377

Query: 375 ESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIARN 434
             +  + +L  L  NL+ ++K QI+  QKE +E++G+  E++EKE EIVENLLEQEIARN
Sbjct: 378 SQKSDQTTLLMLYNNLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQEIARN 437

Query: 435 KRIRMKEKEKAQ------MNDVPS-LALPNRVEEDND---SNYSVSDEDSVIKXXXXXXX 484
           ++IR +EK+K +      +N  P    L     ED+D   S+++ S+ +S          
Sbjct: 438 QKIRQREKQKQKKENQDDLNSNPEEFDLSANELEDSDIPGSDFAESNNNSEKDDEEEEND 497

Query: 485 XXXXXXXXNEPKIASDSAGVEIDSDEDDIRFMKGK-AHKIXXXXXXXXXXXXXXTVNS-- 541
                   + PK   D         E+D  F  GK  HK                V+S  
Sbjct: 498 EEEEDEQEDAPKSTVD---------EEDEGFAIGKRKHKKTEIVDDSDSEIEAQIVDSKE 548

Query: 542 -----AINLGAYGDNLITTTKDEAHTSAEEHTTQLVNE---ISESQYRTMEKEKSKIRAQ 593
                 I+LG YGDN+I  +++  + + E            ISE   +  E EK      
Sbjct: 549 IITANTIDLGHYGDNIIQQSRETLNETEESDEEDEERYNAIISEGIRKQKELEK------ 602

Query: 594 EEKQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSN 653
            E +RLK+MK SGV+ MF++EAEES+DEW G+GGVD +  D YDS++EKMIDD+S    N
Sbjct: 603 REAKRLKEMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFN 662

Query: 654 ADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQXXXXXXXXXXXXXXXXXYXXXXX 713
             +IR++L  ENKETDL  VNKIL+DIKNGGFR R++                 Y     
Sbjct: 663 PSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDDDDDDLKAYRAKRR 722

Query: 714 XXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQAETSEKD-KKSEGLVD 772
                        DKK++KN +SKAFFES+V+DII+ K+PF +   + E+  +K    VD
Sbjct: 723 ALMREKRLDIEG-DKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVD 781

Query: 773 ASNKQK-----------DTISHEFVQQXXXXXXXXXXXXXXXVARVSQEGERNT---DLN 818
             N +K             IS EFVQ+               +      GE+ T   DL 
Sbjct: 782 IDNDEKLATNVTKKKKKIVISEEFVQRSLSFLNSCREQDEFEINNQHNGGEKATSTADLY 841

Query: 819 SLKQDSTVKTLYAPSNIISESERADHEEFDNSVLPVESSYS--------SVVKSFGFDLN 870
           +LK+ S++KTL + ++  S S  ++  E      P +SS S        SV+ SF  D++
Sbjct: 842 TLKRYSSIKTLQSVTSSRSSSIASNLNE-----QPSQSSGSLFNDLRKTSVLNSFSSDVD 896

Query: 871 ANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAEVRTTSKLSTLGN-S 929
            N K KEG K+V VS +Y+TVG  +ASITY+G  R+LVAPKKS   + T+SK ++    S
Sbjct: 897 INSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKS--RLTTSSKANSRTTPS 954

Query: 930 KIFRNFESSFE 940
           ++F N E SFE
Sbjct: 955 RLFDNQEGSFE 965

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  306 bits (784), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 286/794 (36%), Positives = 411/794 (51%), Gaps = 71/794 (8%)

Query: 197  TQVEVSEQTYPDQRNSQEDIIQQTAADAVPITRLKIHEIEEMWSREVQT-ETKEHKVKYR 255
            T ++V E T  D  N  E   Q T AD +P T LKIHEI++   RE  + E KE+K   +
Sbjct: 248  TNLDVIEATMADLPNLNEP--QSTVAD-IPSTGLKIHEIQKELERERNSKELKEYKKPSK 304

Query: 256  APR--PLKVFTKEAFMQXXXXXXXXXXXXXXQEIKATSPIGRNNDSISEVGTSDVKVLKD 313
              +  P+K F+K + +               +++K T        +  +  +S    +K 
Sbjct: 305  EIKVIPIK-FSKTSLLDGFDNSSSDDELEVQKDMKITR-------TKEKPESSIKPKIKP 356

Query: 314  KSSGALTAYQRELKEKAEIAKGVMLLSESDDEEDLA--VSTSHEAKATVLKLKARLSKRR 371
            K    L  Y+ +LK+K    K + L S+SD++ D+A     S  +KAT+L LKARLSK++
Sbjct: 357  KKLTGLNTYENKLKKKLLEKKHIQLDSDSDNDSDIAKRFPISRTSKATLLNLKARLSKKK 416

Query: 372  PPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEI 431
            P   ++    SL  L +NL+ ++++QILD Q+E +E +G K ED+EKEKEIVENLLE+EI
Sbjct: 417  PVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFKLEDIEKEKEIVENLLEEEI 476

Query: 432  ARNKRIRMKEKEKAQM---NDVPSLALPNRVEEDNDSNYSVSDEDSVIKXXXXXXXXXXX 488
             RNKRIRM+EK+K +    N+     L     ED + +  V+D D++             
Sbjct: 477  KRNKRIRMREKQKEKSLSENEDADFDLSANELEDEEED-GVNDSDNIANSQISDEEDEDS 535

Query: 489  XXXXNEPKIASDSAG--------------VEI-DSDEDDIRFMKGKAHKIXXXXXXXXXX 533
                +     +D  G               EI D DED I  +  K              
Sbjct: 536  DSVLDNGNHVADEEGDANREADNSSISSKNEISDEDEDSIFQLTRKEKHPVRIIQESDDE 595

Query: 534  XXXXTVNSAINLGAYGDNL-----ITTTKDEAHTSAEEHTTQLVNEISESQ-YRTMEKEK 587
                 +N+ I+LG YG NL     +++  +      +E +T    EI+E + +  +  EK
Sbjct: 596  NEINKINT-IDLGVYGGNLDNPNPLSSQTEPNEDDEDEKSTYENKEITEEERHALILAEK 654

Query: 588  SKIRAQEEKQ--RLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMID 645
             +I+  E+K   R K+MK+ GV  +F+MEAEES+DEW G+GG DGE  D+YDS++EKMID
Sbjct: 655  KRIQLIEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMID 714

Query: 646  DFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGG--FRKRRQXXXXXXXXXXXXX 703
            D+S +  N D+IRQ+L  ENKE DL  + KIL+DIKNGG   R+R               
Sbjct: 715  DYSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDE 774

Query: 704  XXXXYXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSN------- 756
                Y             + G DDKKL+KN +SKAFFESMVEDI+D K+ F +       
Sbjct: 775  ELREYHKRKRELMKKRMLEIG-DDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKS 833

Query: 757  QAETSEKDKKSEGLVDASNKQKDTISHEFVQQXXXXXXXXXXXXXXXVAR---VSQEGER 813
              E   +++K + +    +K+K+ IS EFVQ+               +       Q GE 
Sbjct: 834  STELDTQEEKEQDVTPGVDKKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGEN 893

Query: 814  NTDLNSLKQDSTVKTLYAPSNIISESERADHEEFDNSVLPVESS------YSSVVKSFGF 867
              DL SLKQ ST+K    PS       + +  +  N+V  VESS        SV+KSF  
Sbjct: 894  VEDLFSLKQRSTIKEFRNPS-------QTNTIDLINNVENVESSPLGGFKPPSVIKSFSS 946

Query: 868  DLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAEVRTTSKLSTLG 927
              + N+K K+G KTVT+SK Y+TVG +KASITYLGK RKL+ PKK+    +  SK+    
Sbjct: 947  RTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKIGSKIKPTR 1006

Query: 928  NSKIFRNFESSFEN 941
            +S +F + + SFEN
Sbjct: 1007 SS-LFSSHDESFEN 1019

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 58/89 (65%), Gaps = 7/89 (7%)

Query: 1  MDKLFESFDNAIKKRRATYQKAVQ---NEDDEYTE--DPLVPPAVLGNGFLFNSSTLDKV 55
          M+ +FE F    K+R+ TY+K  +   N+++  TE  D + PP V+GNGF+F ++ +DK+
Sbjct: 1  MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPP-VIGNGFIFGNALIDKI 59

Query: 56 KNRLN-KDQEQGTQAIDTTQVLSNLYEDG 83
          +NRL+ K+ ++ T     TQ++ NLY+D 
Sbjct: 60 RNRLDGKENKEDTPVPTQTQMIDNLYKDA 88

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
           complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  303 bits (777), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 333/1025 (32%), Positives = 496/1025 (48%), Gaps = 126/1025 (12%)

Query: 1   MDKLFESFDNAIKKRRATYQKAVQN--EDDEYTEDPLVPPAVLGNGFLFNSSTLDKVKNR 58
           MD +F+  D    K+R TY+K      ED+    +  +    LG   LFN+S L +++NR
Sbjct: 1   MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELPGLGQSILFNNSKLKQIRNR 60

Query: 59  L---NKDQEQG-----TQAIDTTQVLSNLYEDGEDLE-KEVPSILQSKSKPIPTILIPSI 109
           L   N D E       TQ I  TQ++SNLYE GEDLE KE    LQ       T ++   
Sbjct: 61  LEGNNNDSENDSSQAETQVIADTQIISNLYEGGEDLEEKEERRFLQR------TQIV--- 111

Query: 110 EREILKQPFNENHNFTGVTVPIAKSSAITKNLDREDLESPEIPETQPIPDFSASD-VPTQ 168
             E   Q  + +  ++  T+   K     K ++  D E  +I  ++       +D + +Q
Sbjct: 112 --EDHTQIIDASVTYSSKTIESNKMDNTQKYINASDSEPTQIQISKVDKLLKITDNLDSQ 169

Query: 169 TQVLKTTSEXXXXXXXXXXXXXXYEE-SLTQVEVSEQTYP-----DQRNSQEDIIQQTAA 222
            +VL TT E                +   TQV+ + Q +P     D+       +Q    
Sbjct: 170 KKVLDTTLETQELETQYGKTQVDKTQVDKTQVDKT-QIFPTLVADDEIKHSSTAVQTVDD 228

Query: 223 DAVPITRLKIHEIEEMWSREVQT-ETKEHKVKYR---APRPLKV-FTKEAFMQXXXXXXX 277
           +    + LKI+EIE     E Q  + K    +Y+   AP   KV F+K  F++       
Sbjct: 229 NTHSNSELKINEIERQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFLEHFDSSSS 288

Query: 278 XXXXXXXQEIKATSPIGRNNDSISEVGTSDVKVLKDKSSGALTAYQRELKEKAEIAKGVM 337
                   ++ +T P      +   +  S  +  K+     L+ Y+  LK+     +  +
Sbjct: 289 EEDEEGVVKLSSTEP----ETAAMNLENSLPQFSKESKFIGLSNYENILKKDIN-KQNCI 343

Query: 338 LLSESDDEEDLAVSTSHEAKATVLKLKARLSKRRPPVESQHGKASLSALMKNLRNSTKRQ 397
             S+S+DE ++    S  +KAT+L +KA LS+ +P   S + K +L  L  +L+ +TK Q
Sbjct: 344 EFSDSEDETEVTSKVSRASKATILSIKANLSRHKPAQSSINNKNALGNLFSDLKKATKAQ 403

Query: 398 ILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIARNKRIRMKEKEKAQM---------- 447
           ILD +KE +E++G K E++EKEKEIVENLLEQEI RN++IR++EK+K ++          
Sbjct: 404 ILDHKKEIMEQKGYKMEEIEKEKEIVENLLEQEIERNRKIRIREKQKEELKKRKQRIENG 463

Query: 448 ----------NDVPSLALPNRVEEDND-----SNYSVSDEDSVIKXXXXXXXXXXXXXXX 492
                     N++    +P   E DND     SN   SD D  ++               
Sbjct: 464 DQEEDFAISANELSDSEVP---ESDNDGEVMSSNEEASDSDDELRTQLDASTGIEKETEQ 520

Query: 493 NEPKIASDSAGVEIDSDEDDIRFMKG----KAHKIXXXXXXXXXXXXXXTVNS------- 541
           +  + +   +  E D DE++I  +K     K H +               V +       
Sbjct: 521 DASRDSEKDS--ERDIDEENILNIKNRKSKKIHVVSESDSDSDSGENSVQVEANHQPSLN 578

Query: 542 AINLGAYGDNLITTTKDEAHT--SAEEHTTQLVNEISESQYRTMEKEKSKIRAQEEKQR- 598
            INLG YGDNL     +E +   S E    +L  E+       ++KE  + R QE KQR 
Sbjct: 579 TINLGHYGDNLSQENNNERNNIDSDESEDEELYKEM-------VKKEIDRRRDQERKQRQ 631

Query: 599 -LKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQI 657
            L+++K+ G+T+MF++EAEES+DEW G+GGVDGE  D+YDS++EKMIDD+S    NA +I
Sbjct: 632 KLRELKDKGITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEI 691

Query: 658 RQLLMAENKETDLKTVNKILHDIKNGGFRKRRQXXXXXXXXXXXXXXXXXYXXXXXXXXX 717
           R+ L AENK+ DLK VN+IL+DIKNGGFRKRR                  Y         
Sbjct: 692 REKLAAENKDMDLKMVNRILNDIKNGGFRKRRN-ALEIELSDDEDDDLKAYRAKRRQLMK 750

Query: 718 XXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQ-----AETSEKDKKSEGLVD 772
               +    +KKL+ N +S AF ESMV+DI+++K+PF  +      +T E D  +EG V+
Sbjct: 751 EKRLETDH-NKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIMDDTPETD--AEGDVN 807

Query: 773 A----SNKQKDTISHEFVQQX----XXXXXXXXXXXXXXVARVSQEGERNTDLNSLKQDS 824
           +    + K+K  +S  FVQ+                   +A+  Q     TD+ +LK   
Sbjct: 808 SNELLNKKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAK-EQHSHAATDMFALKSHC 866

Query: 825 TVKTLY----APSNIISESERADHEEFDNSVLPVESSYS-----SVVKSFGFDLNANDKL 875
           ++K+L     + +N IS      HEE       V + +S     SV+KSF   ++ + K 
Sbjct: 867 SIKSLESLPGSHNNSISSKLDLLHEEI------VSTPFSGLKQTSVIKSFSSSIDIDSKF 920

Query: 876 KEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAEVRTTSKLSTLGNSKIFRNF 935
           K+G KTV VSKSYRTVG  KASITYLGK RKLV PKK   +   + K  T   S++F   
Sbjct: 921 KDGNKTVKVSKSYRTVGSAKASITYLGKARKLVPPKKKEHKPH-SHKSKTASASRLFDEQ 979

Query: 936 ESSFE 940
           ++SFE
Sbjct: 980 DNSFE 984

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  273 bits (699), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 258/835 (30%), Positives = 386/835 (46%), Gaps = 142/835 (17%)

Query: 212  SQEDIIQQTAADAVPITRLKIHEIEEMWSREVQTETK--EHKVKYRAPRPLKVFTKEAFM 269
            +++DI Q +  D +   +L+IHEI++   +EV+ + K  EH ++          TK  F 
Sbjct: 451  ARDDIFQTSVKDGILDKKLRIHEIQDALLQEVKEKEKQTEHHIQDSDS-----LTKTKFT 505

Query: 270  QXXXXXXXXXXXXXXQEIKATSPIGRNNDSISEVGTSDVK-------------------- 309
                             + A     +N D      TS  K                    
Sbjct: 506  FTKEDFLADLDDDDSDAVYANGENDKNEDKSERANTSHAKLKAMPVTIPHQQIEVQFNKV 565

Query: 310  -----VLKDKSSGALTAYQRELKEKAEIAKGVMLLSESDD--EEDLAVSTSHEAKATVLK 362
                 + K K    L+ Y+  LKE       + L S+S++  + D+  ST+  +KA +L 
Sbjct: 566  QLKNVIAKPKRKVILSQYENRLKENLLYNNSIDLYSDSEENTQSDILFSTA--SKAQILD 623

Query: 363  LKARLSKRRPPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEI 422
            ++ +LSK++P V+ +  + +L  L   L+ ++K+QI D QK  IE +GLK ED++KEKEI
Sbjct: 624  IRHKLSKKKPQVKKKTIQTNLDQLFNKLKKASKKQIFDHQKNAIESKGLKLEDLKKEKEI 683

Query: 423  VENLLEQEIARNKRIRMKEKEKA-QMNDVPSLALPNRVEEDN---------DSNYSVSDE 472
            VENLLEQEI RN++IR KE+++  + N V   ++ +  +ED+         DS Y+ SDE
Sbjct: 684  VENLLEQEIERNRKIRAKERKRENKKNKVDDKSVQSASDEDDFDHSANELEDSFYNDSDE 743

Query: 473  DSVIKXXXXXXXXXXXXXXXNEPKIASDSAGVEIDSDEDDIRFMKGKAHKIXXXXXXXXX 532
            +  I                    I     G+++ ++E D                    
Sbjct: 744  NKEIIEPEEEDSEDDI-------NIFRHKKGLKLVTEESD-------------SENDNPL 783

Query: 533  XXXXXTVN-SAINLGAYGDNLITTTKDEAHTSAEEHTTQLVNEISESQY-RTMEKEKSKI 590
                  +N + INLG YGDNL     D   T   E++ + + +I + +   + E   +++
Sbjct: 784  ESEKIPINPNIINLGHYGDNL-----DSKSTIFNENSKKFIEDIEQFEADNSTENSNNEL 838

Query: 591  RAQEEKQRLKQ------------------MKESGVTNMFDMEAEESDDEWRGVGGVDGET 632
               E K+ +KQ                  +K+ G + MFDMEAEES+DEW G+GG DGE 
Sbjct: 839  NELEYKRHIKQELEKQKLKEAKKKAKLRELKKVGASKMFDMEAEESEDEWFGIGGADGEV 898

Query: 633  IDDYDSDLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQXX 692
             D+YDS++EK+IDD+S    N D+IR  LM ENKE D+K VN+IL+DIKNGGFRKR +  
Sbjct: 899  SDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIKNGGFRKRNRNN 958

Query: 693  XXXXXXXXXXXXXXXYXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLKD 752
                           Y             +    D K+LK S+SKAFF SMV+DI++  +
Sbjct: 959  IDLELSDDEDDELREYRIKRREIMKKKRLEVTNTD-KILKTSKSKAFFMSMVDDIVETSN 1017

Query: 753  PF------------------SNQAETSEKDKKS---------EGLVDASNKQKDTISHEF 785
            PF                  SN+      + K             +  S+++K  +S +F
Sbjct: 1018 PFMITQPSDDDSDDNNMDSISNKNHKDANNAKKDKKDKRTDDHARLSQSSRKKFVMSEDF 1077

Query: 786  VQQXXXXXXXXXXXXXXXVAR---VSQEGERNTDLNSLKQDSTVKTLYAPSNIISESERA 842
            V +                      SQ G  N D+ SLKQ S++KT++  S +  ++   
Sbjct: 1078 VHKTLSFLTKSKEVNEFQHVNEHYKSQIGTIN-DIQSLKQKSSIKTMHVLSMMSQDTNVD 1136

Query: 843  D-----------HE--EFDNSV---LPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSK 886
                        H    FDNS    L   S   S++K FG   + NDK K+G KTVT+S 
Sbjct: 1137 LDASDKDDDDMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISN 1196

Query: 887  SYRTVGGNKASITYLGKMRKLVAPKKS--NAEVRTTSKLSTLGNSKIFRNFESSF 939
            SY+TVGG K SIT  G+ RKLVAP K+  N      S + +  NSK+FRN + SF
Sbjct: 1197 SYKTVGGMKTSITSFGR-RKLVAPVKTHNNFNKNRISNIKSSSNSKLFRNQDKSF 1250

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 7/66 (10%)

Query: 1  MDKLFESFDNAIKKRRATYQKA---VQNEDDEYT---EDPLVPPAVLGNGFLFNSSTLDK 54
          MD +F+S D    K+R TY+K    V  E D+      +P VP   L  GFLF +  L+K
Sbjct: 3  MDAVFDSLDELKIKKRTTYKKVPEQVATELDKAATTISNP-VPSFNLSEGFLFANDKLEK 61

Query: 55 VKNRLN 60
          +KNRLN
Sbjct: 62 IKNRLN 67

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  258 bits (659), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 259/776 (33%), Positives = 391/776 (50%), Gaps = 104/776 (13%)

Query: 205  TYPDQRNSQEDIIQQTAADAVPI--TRLKIHEIEEMW---SREVQTETKEHKVKYRAPRP 259
            T  D+  +QE   Q T AD V      LKIHEI+      +R +     EH+     P  
Sbjct: 391  TMRDRLETQE--FQPTVADDVKSGGNTLKIHEIQTQIDEETRNMLNRGVEHRKSRGVPSR 448

Query: 260  LKV-FTKEAFMQX-XXXXXXXXXXXXXQEIKATSP-IGRNNDSISEVGTSDVKVLKDKSS 316
            ++V FTKE+FM                 +I  T+P  G + +S S       +  K K  
Sbjct: 449  VEVRFTKESFMADFEESDSASDMESDSDQINDTTPETGSSQNSDSNKARKPTEAPKTKRV 508

Query: 317  GALTAYQRELKEKAEIAKGVMLLSE----SDDEEDLAVSTSHEAKATVLKLKARLSKRRP 372
              L++Y+  L+ K    + + L S+    S++E D     S  +KA VL +KA+  K++ 
Sbjct: 509  TGLSSYETILRNKVNDDECLDLGSDDTYSSEEEYDKESKVSQASKAAVLNIKAKALKKKA 568

Query: 373  PVESQH-GKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEI 431
             V++ +  K +L +L  +L+   ++QIL  Q E I  +G+  +D+E+EKEIVE+LLEQEI
Sbjct: 569  IVKAANTNKTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREKEIVEDLLEQEI 628

Query: 432  ARNKRIRMKEKEKAQMNDVPSLALPNRVEEDNDSNYSV--------SDEDSVIKXXXXXX 483
             RNKR+R +E+E+ Q  +  S         D D+NYS         SD DS+        
Sbjct: 629  LRNKRLREREREREQKEEEQS---------DMDNNYSANELESFDDSDHDSL-------- 671

Query: 484  XXXXXXXXXNEPKIASDSA---GVEIDSDEDDIRFMKGKAHKIXXXXXXXXXXXXXXTVN 540
                     +EP I  D+    GV+ + +E+   F   K  K               TVN
Sbjct: 672  -------NEDEPNINDDNNSSNGVDSEDEEEFAAFQVLKGKKRKNMQIQPESDSEEETVN 724

Query: 541  S---------------------AINLGAYGDNLITTTKDEAHTSAEEHTTQLVNEISESQ 579
            S                     AI+LG YG+NL    + E + + +  T  +++E  +  
Sbjct: 725  SNDKRVNAPSESKPIHPVNNINAIDLGDYGNNL--EIRAELNNTEKLDTKCMLDE--KEH 780

Query: 580  YRTMEKEKSKIRAQEEKQRLK--QMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYD 637
             R ++KE+ K   +E+K  LK  ++KE GV+N F+ EAEES+DEW G+GG+DGE  D+YD
Sbjct: 781  ARAVDKERLKTIMKEKKLMLKRAELKEKGVSNFFEEEAEESEDEWHGIGGIDGEVSDEYD 840

Query: 638  SDLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQXXXXXXX 697
            S++EKMIDD+S    + ++IR+LL++ENKE D+K VNKIL DIKNG FRKR +       
Sbjct: 841  SEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTLELEL 900

Query: 698  XXXXXXXXXXYXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQ 757
                      Y               G DDKKL+KN ++KAFF+S+VEDI+++K+PF   
Sbjct: 901  SDEEDDDLRQYRQKRNELMKQRLLDLG-DDKKLVKNVKTKAFFDSLVEDIVEVKNPFGVM 959

Query: 758  AETSEKDKKSEGLV------DASNKQ---------KDTISHEFVQQX----XXXXXXXXX 798
            ++   +D      +        SNK+         K  +S EFVQ+              
Sbjct: 960  SDNETQDTDETTTIDTQTRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEF 1019

Query: 799  XXXXXVARVSQEGERNTDLNSLKQDSTVKTLYAPSNIISESERADHEEFDNSVLPVESSY 858
                 +AR+ Q  +  +DL +LK+ S+VK+  +   + S++E  + +  DNS   V ++ 
Sbjct: 1020 EQNQDLARL-QHDDDVSDLYTLKKQSSVKSFKS---VGSKNEIINVDANDNSGTAVATAT 1075

Query: 859  ---SSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPK 911
                S++KSF   LN +DK + G+KTV   KSY+ VGG+K S+TY+ K+RKL APK
Sbjct: 1076 FRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPK 1131

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 61/101 (60%), Gaps = 15/101 (14%)

Query: 1   MDKLFESFDNAIKKRRATYQKAVQNEDDEYT-EDPLVPPAVLGNGFLFNSSTLDKVKNRL 59
           MD L E F++   KRR TY+K  QN  DE   +D  VP ++ GNGFLF ++T+DK+KNRL
Sbjct: 1   MDDLLERFNSVKVKRRTTYKKVQQNSTDEAAGDDDCVPTSLAGNGFLFGNATVDKIKNRL 60

Query: 60  NKDQEQGTQAIDTT-------------QVLSNLYEDGEDLE 87
           N +++    +ID T             Q+LS LY+ GEDLE
Sbjct: 61  N-NEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGEDLE 100

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  251 bits (640), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 225/636 (35%), Positives = 332/636 (52%), Gaps = 57/636 (8%)

Query: 315  SSGALTAYQRELKEKAEIAKGVMLLSESDDEEDLAV--STSHEAKATVLKLKARLSKRRP 372
            SS  L AY   LK+K E  K + L S+SDDE D AV    S+++KAT+L LK RLSK++P
Sbjct: 494  SSMILPAYVNNLKQKVE-NKKLQLSSDSDDEVDSAVIYKLSNKSKATLLNLKVRLSKKKP 552

Query: 373  PVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIA 432
              +  + K S + L  NLR +TK+QI+  +KE +E +GL FED+EK+K +VE+LLE+EI 
Sbjct: 553  VKKVHNEKDSTNLLFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIE 612

Query: 433  RNKRIRMKEKEKAQMNDVPSLALPNRVEEDND--------SNYSVSDEDSVIKXXXXXX- 483
            RN +IR  E+EK + ++ P LA    +E D +        SN  + D  S+         
Sbjct: 613  RNLKIR--EREKRKESNEP-LAEQEIMESDYEYSGDESDISNSDIVDNSSISSQQINYTE 669

Query: 484  -------XXXXXXXXXNEPKIASDSAGVEIDS--DEDDIRFMKG-----KAHKIXXXXXX 529
                            N P + +    +E+D+  DE DI   +      K          
Sbjct: 670  EITYGLKNSNESDKGDNSPAVINGPIELELDNVDDEGDIEIKRSHRTSKKPFLFSDTESD 729

Query: 530  XXXXXXXXTVNSAINLGAYGDNLITTTKDEAHTSAEEHTTQ--LVNEISESQYRTMEKEK 587
                      +S+       ++  T+ ++E H S+E+  T+   +  I +   R  E+E 
Sbjct: 730  FQNDDIITDASSSAERLPIDESQETSPENEDHDSSEDIDTEQERIAAIKQQVKRQQERE- 788

Query: 588  SKIRAQEEKQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDF 647
                  +E+++L+++   GV   F+ EAEESDDEWRG+GGVDG+   +YDS++EKMIDD+
Sbjct: 789  -----VKERKKLQELANKGVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVEKMIDDY 843

Query: 648  SNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQXXXXXXXXXXXXXXXXX 707
            S T  +   +RQ +M ENKE DLK VNKIL+DIKNGGFRKR +                 
Sbjct: 844  SKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDEDAELQE 903

Query: 708  YXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPF---SNQAE----- 759
            +             +   D  KL KN +SKAFFESM+ D+++ K+ F   S+Q E     
Sbjct: 904  FRRKRRELMKQRMLE-NEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSDQIELKEEN 962

Query: 760  -TSEKDKKSEGLVDASNKQKDTISHEFVQQXXXXXXXXXXXXXXXVARVSQEGERNTDLN 818
             T E ++K      ++ + K  IS +FVQ+                + +  + +   D+N
Sbjct: 963  ITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEKGIGDMN 1022

Query: 819  SLKQDSTV---KTLYAPSNIISESERADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKL 875
            +LK +S++     L     II++ E    EEF++   P      S+++SF      +DK 
Sbjct: 1023 ALKSNSSLSFCSKLSTSRKIINDEEDV-IEEFESFKRP------SIIQSFSSKFTIDDKF 1075

Query: 876  KEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPK 911
            K+G K+V VS SY+TVGG+KASITYLGK RKLV PK
Sbjct: 1076 KDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPK 1111

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  232 bits (592), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 172/441 (39%), Positives = 232/441 (52%), Gaps = 72/441 (16%)

Query: 542  AINLGAYGDNL--------------------ITTTKDEAHTSAEEHTTQLVNE--ISES- 578
            AINLG YGDN+                    IT  ++     A    T +V+E  I+E  
Sbjct: 644  AINLGHYGDNIEEEVNKFQETNDMNTQQTDKITMERNIVENKAILEDTAVVDEDNINEEA 703

Query: 579  ----QYRTMEKEKSKIRAQEEKQ--RLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGET 632
                +   ++KEK ++R +E ++  +LK++K  GVTN F+MEAEESDDEW G+GG DGE 
Sbjct: 704  DEAIRRELIDKEKLQLRQKELEKAIKLKELKHKGVTNFFEMEAEESDDEWHGIGGADGEG 763

Query: 633  IDDYDSDLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFR-KRRQX 691
             D+YDSD+EKMIDD+S    N+ +IR++L AENKE D+K +NKIL+DIKNGGFR KR + 
Sbjct: 764  SDEYDSDVEKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKN 823

Query: 692  XXXXXXXXXXXXXXXXYXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLK 751
                            Y             + G D  KL+KN +SKAFFESMVEDI++ K
Sbjct: 824  SLELELSDDEDDVLQQYRLKRRELMRKRRLEIG-DGTKLVKNPKSKAFFESMVEDIMEYK 882

Query: 752  DPF-----SNQAETSEK------DKKS-----------EGLVDASNKQKDTISHEFVQQX 789
            +PF     SNQ  TS        D  S           +G VD  +K K  IS +FVQ+ 
Sbjct: 883  NPFRAEEESNQDITSTATDLDTLDNNSLNVRDSTRNNEKGPVDDKSK-KIIISEDFVQKS 941

Query: 790  XX---XXXXXXXXXXXXVARVSQ--EGERNTDLNSLKQDSTVKTL-----------YAPS 833
                             +A++    + E   DL +LKQ S++K+               +
Sbjct: 942  LSFLKSNNYNEFEMDKELAKMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTT 1001

Query: 834  NIISESERADHEEFDN--SVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTV 891
             I  E    D +E +N  S L     + S+VKSF    + NDK KEG KTV +SKSY+ V
Sbjct: 1002 MIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMV 1061

Query: 892  GGNKASITYLGKMRKLVAPKK 912
            G +KASITY+GK RKL+APK+
Sbjct: 1062 GSSKASITYMGKTRKLMAPKR 1082

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 57/94 (60%), Gaps = 21/94 (22%)

Query: 13  KKRRATYQK-AVQNEDDE-------YTEDPLVPPAVLGNGFLFNSSTLDKVKNRL----- 59
           KKR  TY+K A+   DD        YT D + PPA+ GNGFLF ++TL++VKNRL     
Sbjct: 14  KKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANATLNRVKNRLEGGKA 73

Query: 60  ------NKDQEQGTQAIDTTQVLSNLYEDGEDLE 87
                 NKD E   + + ++Q+++NLYE GEDLE
Sbjct: 74  PEQEHDNKDDED--EDVSSSQLIANLYEGGEDLE 105

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  227 bits (579), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 169/409 (41%), Positives = 227/409 (55%), Gaps = 37/409 (9%)

Query: 541  SAINLGAYGDNLITTT--------KDEAHTSAEEHTTQLVNEISESQYRTMEKEKSKIRA 592
            +AI+LGAYGDNL T           +      E   TQ +    + +   +E EK+KI+ 
Sbjct: 649  NAIDLGAYGDNLTTANVKSQDDDDLEVDDDKNENLDTQPLELTEQERIDIIEAEKTKIKM 708

Query: 593  QEEKQRLKQ--MKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNT 650
            Q+EK R K+  M + GVT  F+MEAEES+DEW G+GG+DGE  D+YDSD+EKMIDD+S  
Sbjct: 709  QQEKMRHKEKEMMKKGVTKFFEMEAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKA 768

Query: 651  TSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKR-RQXXXXXXXXXXXXXXXXXYX 709
              + ++IR++L AENKE DL  +NKIL+DIKNGGFRKR R                  Y 
Sbjct: 769  NFDPNEIREMLAAENKEMDLNMINKILYDIKNGGFRKRKRGGLELELSEDEDDDALREYH 828

Query: 710  XXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQ--AETS------ 761
                        + G D+KKL+KN +SKAFFESMVEDI D K+ F+++   ETS      
Sbjct: 829  LKRKELMRKRRLELGDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINN 888

Query: 762  -EKDKKSE--------GLVDASNKQKDTISHEFVQQX----XXXXXXXXXXXXXXVARVS 808
             + D K E        G      K+K  IS EFVQ+                   +A+  
Sbjct: 889  TQDDMKEEDAAVVKENGDSKRIKKKKTIISEEFVQRTLSFLKSSREDEEFAMNENLAK-E 947

Query: 809  QEGERNTDLNSLKQDSTVKTLYAPSN----IISESERADHEEFDNSVLPVESSYSSVVKS 864
            Q G +  +L SLKQ S++K   +PSN    +I   +  + ++ D           S++KS
Sbjct: 948  QHGTKVENLLSLKQQSSIKVFQSPSNNSSKVIKLDDINNDDDDDEDSPIALFKVPSILKS 1007

Query: 865  FGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKS 913
            FG   + N+K ++G KTVT+SKSYRTVG +KASITYLGK RKL+AP  S
Sbjct: 1008 FGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHS 1056

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 99/197 (50%), Gaps = 29/197 (14%)

Query: 1   MDKLFESFDNAIKKRRATY-QKAVQNEDDEYTEDPL---------VPPAVLGNGFLFNSS 50
           MD L +      K R+ TY +K++    +E  ED +         V P +LG GFLF +S
Sbjct: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60

Query: 51  TLDKVKNRLNK----DQEQGTQAID--TTQVLSNLYEDGEDLEKE-VPSILQSKSKPIPT 103
           T+DKV+ RL+     +QE+   A     TQ+++NLY +GEDLEK+ +  I  S+++PI  
Sbjct: 61  TIDKVRARLSGKNYIEQEKTPLASSEQETQIITNLYTNGEDLEKDLIKHIPVSQTQPITN 120

Query: 104 ILIPSIEREILKQPFNENHNFTGVTVPIAKSSAITKNLDREDLESPEIPE--TQPIP--- 158
               + ER  L+Q      +     +P     +  +  D E  E  +I E  TQ IP   
Sbjct: 121 ----TGERTQLEQEIKVTIDNDSNEMPTQVIGSTER--DDETAERTQIGEVATQLIPGDT 174

Query: 159 -DFSASDVPTQTQVLKT 174
            D +++   TQ Q+LKT
Sbjct: 175 YDRTSTMQKTQEQLLKT 191

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  220 bits (560), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 167/435 (38%), Positives = 235/435 (54%), Gaps = 68/435 (15%)

Query: 542  AINLGAYGDNL-----------ITTTKDEAHTSAEEHTTQ-------LVNEISESQYR-- 581
            AINLG YGDN+           +  T++     AE +T +        VNE ++   R  
Sbjct: 628  AINLGHYGDNIGEDTDKFQETNVLDTQNIEEVMAERNTIENEVKDDVYVNEEADEAIRRQ 687

Query: 582  TMEKEKSKIRAQEEKQ--RLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSD 639
             ++KEK +++ +E++   ++K++K+ GVTN F+MEAEES+DEW G+GG DGE  DDYDSD
Sbjct: 688  LIDKEKLQLKQKEKEHEAKIKELKKRGVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSD 747

Query: 640  LEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQXXXXXXXXX 699
            LEKMIDD+S    N  +IR++L AENKE D+K +NKIL+DIKNGGFR +R          
Sbjct: 748  LEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNSLELELS 807

Query: 700  XXXXXX--XXYXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQ 757
                      Y             + G DD KL+KN +S AFFESMVEDII+ K+PF  +
Sbjct: 808  DDDEDDVLQQYRLKRRELMRKRRLEIG-DDAKLVKNPKSSAFFESMVEDIIEYKNPFGAE 866

Query: 758  AE--------TSEKDKKSEGL-------------VDASNKQKDTISHEFVQQXXX---XX 793
             E         ++ D +   +             VD  NK K  IS +FVQ+        
Sbjct: 867  EEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKNK-KVIISEDFVQKSLSFLKSN 925

Query: 794  XXXXXXXXXXVARVSQEG--ERNTDLNSLKQDSTVKTLY----------APSNIISESER 841
                      ++R+ Q G  E   DL +LKQ+S++K+              + II   +R
Sbjct: 926  NYEDFETDKELSRI-QHGNDEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKR 984

Query: 842  ADHEE----FDNSVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKAS 897
             + E+     D S++ V   + S++KSF    + NDK KEG KTV + KSY+TVG +KAS
Sbjct: 985  PEDEDEVENGDTSLVGV-FKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKAS 1043

Query: 898  ITYLGKMRKLVAPKK 912
            ITY+GK RKL+APK+
Sbjct: 1044 ITYMGKTRKLIAPKR 1058

 Score =  158 bits (399), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 174/550 (31%), Positives = 257/550 (46%), Gaps = 139/550 (25%)

Query: 13  KKRRATYQKA---VQNEDDEYT----EDPLVPPAVLGNGFLFNSSTLDKVKNRL------ 59
           KKR  TY+K    + +E+D        D   PP + GNGFLF ++TL++VKNRL      
Sbjct: 14  KKRTTTYKKVAVPILDENDNTNGNGPNDIDNPPELTGNGFLFANATLNRVKNRLEGKKAP 73

Query: 60  ----NKDQEQGTQAIDTTQVLSNLYEDGEDLEK---------------------EVP-SI 93
               N  +++   ++  TQ++SNLY+ GE+LEK                      +P SI
Sbjct: 74  EQNHNNGKDRSENSL-PTQLISNLYDGGEELEKSEVKDNSYSEKNVSSSFTQTQRIPVSI 132

Query: 94  LQSK--SKPI-------PTILIP-----SIEREILKQPFN----------ENHNFTGVTV 129
            Q K  + PI       PT LI      +   + LK P            ++   T  T 
Sbjct: 133 QQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGRPGATQRIDSSGATSQTQ 192

Query: 130 PI----AKSSAITKNLDREDLESPEIP-------ETQPI--------PDFSASDVPTQTQ 170
           PI     +S  IT + +  +  SP+IP        T P+        PD +  DVP QT 
Sbjct: 193 PIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQSIQNRGPD-TQMDVPPQT- 250

Query: 171 VLKTTSEXXXXXXXXXXXXXXYEESLTQ-VEVSEQTYPDQRNSQEDIIQQTAADAVPITR 229
                                ++E  TQ + + + T+ +Q+ +Q D + QT  D VP T 
Sbjct: 251 --------------------AHDEDKTQAIGIPQATHQEQK-TQIDTVAQTLQDEVPHT- 288

Query: 230 LKIHEIEEMWSREVQTETKEHKVKYRAP-RPL---KVFTKEAFMQXXXXXXXXXXXXXXQ 285
           LKI EI+   + E     K   V+Y+ P +P+   K F+KE+F+                
Sbjct: 289 LKIREIQSELASEDSKREKARNVEYKKPQKPIPTKKFFSKESFLADFDDSSSNEDDDIKL 348

Query: 286 EIKATSPIGRNNDSISE-----VGTSDVKVLKDKSSGALTAYQRELKEKAEIAKGVMLLS 340
           E     P+ +N+D + E     +  +D   + +K    L++Y   LK + + +K + L  
Sbjct: 349 ENAHPKPV-QNDDELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCITLDL 407

Query: 341 ESDDEE--------------DLAVSTSHEAKATVLKLKARLSKR-----RPPVESQHGKA 381
           +SD +E              +  +  S  +KAT+L LKARLSK+     + P +S+  K 
Sbjct: 408 DSDSDEYGDDDMDSIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKV 467

Query: 382 SLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIARNKRIRMKE 441
             + L+  LR ++++QILD QKE IE +GLK ED+ KEKEIVENLLEQEI RNKRIR KE
Sbjct: 468 DHNVLLNTLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNKRIRQKE 527

Query: 442 K--EKAQMND 449
           K  EK + ND
Sbjct: 528 KRREKLEEND 537

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  218 bits (555), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 163/412 (39%), Positives = 226/412 (54%), Gaps = 47/412 (11%)

Query: 575  ISESQYRTM-EKEKSKIRAQEEKQ--RLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGE 631
            +SE+  R + ++EKS+ R +E++Q  +LK++K  GVTN F+MEAEES+DEW GVGG DGE
Sbjct: 729  VSEAIRRELIDREKSERRQKEKEQATKLKELKSKGVTNFFEMEAEESEDEWHGVGGADGE 788

Query: 632  TIDDYDSDLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFR-KRRQ 690
              D+YDS++EKMIDD+S    N+ +IR++L AENKE D+K +NKIL+DIKNGGFR KR +
Sbjct: 789  GSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAK 848

Query: 691  XXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIIDL 750
                             Y             + G DD KL+KN +SKAFFESMVEDI++ 
Sbjct: 849  NSLELELSDDEDDVLQQYRLKRRELMRKRRLEIG-DDTKLVKNPKSKAFFESMVEDIMEF 907

Query: 751  KDPFSNQAE-------------TSEKDKKSEGLVDASNKQ---------KDTISHEFVQQ 788
            K+PF  + E             T + D    G   ++N+          K  IS +FVQ+
Sbjct: 908  KNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQK 967

Query: 789  XXXXXXXXXX---XXXXXVARVSQ-EGERN-TDLNSLKQDSTVK-------------TLY 830
                              +AR+    GE +  DL +LKQ S++K             T+ 
Sbjct: 968  SLSFLKSNNYDEFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMN 1027

Query: 831  APSNIISESERADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRT 890
               N+   +E  D  E  +  L     + SV+KSF    + NDK KEG KTV +SKSY+T
Sbjct: 1028 TVINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKT 1087

Query: 891  VGGNKASITYLGKMRKLVAPKKSNAEVRTTSKL--STLGNSKIFRNFESSFE 940
            VG +KASITY+GK RKL+APK+   E    + +  S    SK+F N + SF+
Sbjct: 1088 VGSSKASITYMGKTRKLMAPKRKTEENHHPNHIKKSKTQKSKLFENGQDSFD 1139

 Score =  134 bits (337), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 149/515 (28%), Positives = 233/515 (45%), Gaps = 90/515 (17%)

Query: 1   MDKLFESFDNAIKKRRATYQKAVQNE--DDEYTED---PL----VPPAVLGNGFLFNSST 51
           MD    +  +   K+RAT  K V +   D+ Y  D   P+     PPA+ GNGFLF ++T
Sbjct: 44  MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103

Query: 52  LDKVKNRLNKDQEQGTQAID---------TTQVLSNLYEDGEDLEKE-----------VP 91
           L++VKNRL    E G    D         +TQ+++NLY+ GE+LE +           V 
Sbjct: 104 LNRVKNRLEGRNELGQDGQDKENEDEDVFSTQLIANLYDGGEELESKSNGDKNNQKVNVS 163

Query: 92  SILQSKSKPIP--------TILIPSI-EREILKQPFNENHNFTG--------VTVPIAKS 134
           S  Q++  P+          + I SI E E  ++  N     T          T  I + 
Sbjct: 164 SFTQTQRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFTTAQITQK 223

Query: 135 SAITKNLDREDLESPEIPETQPIPDFSASDVPT------QTQVLKTTSEXXXXXXXXXXX 188
           +    N      ++ +IP T+P    + +DV T      Q +V   T+E           
Sbjct: 224 TTQCLNNHGATSQTQQIPPTKPSEAQTQADVATANDSDTQQKVPMLTTETSPLFQTVPDQ 283

Query: 189 XXXYEESLTQVEVSEQTYPDQRNSQEDIIQQTAADAVPITRLKIHEIEEMWSREVQTETK 248
                   TQ+     T  D R +Q D + QT  D VP T LKIHE++   + E     K
Sbjct: 284 SPS-----TQMNTPPPTVHDDR-TQMDTVAQTMQDKVPPT-LKIHELQSELALEDFNRKK 336

Query: 249 EHKVKYRAPRP----LKVFTKEAFMQXXXXXXXXXXXXXXQEIKATSPIGRNND------ 298
               +YR  +     +K F+KE+F+                +++++ P  + N       
Sbjct: 337 AQNTEYRKLQKTIPIVKRFSKESFLADFDNSSSDEDTNF--KLESSQPKQQQNGYEMIDI 394

Query: 299 SISEVGTSDVKVLKDKSSGALTAYQRELKEKAEIAKGVMLLSESD--------------D 344
           S S    ++ +  KDK    L+ Y   LK + + +K + L  +S               +
Sbjct: 395 SQSNPQPAEKENKKDKKVPLLSTYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLN 454

Query: 345 EEDLAVSTSHEAKATVLKLKARLSKRRPPV-----ESQHGKASLSALMKNLRNSTKRQIL 399
           E++ A+  S  +KAT+  LKARLSK+   +     +++  K+  + L+  LR ++++QIL
Sbjct: 455 EDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQIL 514

Query: 400 DRQKEGIERQGLKFEDVEKEKEIVENLLEQEIARN 434
           D Q+E +E +G K ED+ KEKEIVE+LLEQEI RN
Sbjct: 515 DHQREIVETKGFKLEDMVKEKEIVEDLLEQEILRN 549

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  218 bits (555), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 173/473 (36%), Positives = 250/473 (52%), Gaps = 78/473 (16%)

Query: 541  SAINLGAYGDNLITTTKDEAHTSAEEHTT---------------------------QLVN 573
            +AI+LG YGDN+     +EA  S EE TT                            +  
Sbjct: 684  NAIDLGHYGDNI----DEEASNSFEEATTLNTQKIDNIIIKTHTIENREEEEVENDSIDE 739

Query: 574  EISESQYRTM-EKEKSKIRAQEEKQ--RLKQMKESGVTNMFDMEAEESDDEWRGVGGVDG 630
            E+SE+  R + +K+KS++R +E+K    LK+ K  G+TN F+MEAEES+DEW GVGG DG
Sbjct: 740  EVSEAIRRELIDKKKSQLRQKEKKHVAELKEFKSKGITNFFEMEAEESEDEWHGVGGADG 799

Query: 631  ETIDDYDSDLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFR-KRR 689
            E  ++YDS++EKMIDD+S  + N+ +IR++L AENKE D+K +N+IL+DIKNGGFR KR 
Sbjct: 800  EGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIKNGGFRNKRA 859

Query: 690  QXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIID 749
            +                 Y             + G DD KL+KN +SKAFFESMVEDI++
Sbjct: 860  KNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIG-DDTKLVKNPKSKAFFESMVEDIME 918

Query: 750  LKDPFSNQAETSE-----------KDKKSEGLVDASNK----------QKDTISHEFVQQ 788
             K+PF  + E+ +           +D  S  + D++            +K  IS +FVQ+
Sbjct: 919  FKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQK 978

Query: 789  XXXXXXXXXX---XXXXXVARVSQE-GERNT-DLNSLKQDSTVKTLY-APSNIIS----- 837
                               AR+  + G+    DL +LKQ S++K+   +P++ +S     
Sbjct: 979  SLSFLRSNNYDEFEMDKERARIQHDIGDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVN 1038

Query: 838  -----ESERADHEEFDN--SVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRT 890
                 E    D+ E +N    L     + S++KSF    + NDK KEG KTV +SK+Y+T
Sbjct: 1039 SMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKT 1098

Query: 891  VGGNKASITYLGKMRKLVAPKKS---NAEVRTTSKLSTLGNSKIFRNFESSFE 940
            VG +KASITY+GK RKL+APKK    +      SK      SK+F + + SF+
Sbjct: 1099 VGSSKASITYMGKTRKLMAPKKKADRDHHHNHHSKAWKTQKSKLFESGQDSFD 1151

 Score =  128 bits (321), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 143/488 (29%), Positives = 227/488 (46%), Gaps = 90/488 (18%)

Query: 36  VPPAVLGNGFLFNSSTLDKVKNRLN-----------KDQEQGTQAIDTTQVLSNLYEDGE 84
            PPA+ GNGFLF ++TL++VKNRL            KD E       +TQ+++NLY+ GE
Sbjct: 100 APPALTGNGFLFGNATLNRVKNRLEGIDVPEDDRQIKDNENEDAV--STQLIANLYDGGE 157

Query: 85  DLE---------------------KEVPSILQSKSK---PIPTILIPSIEREILKQPFNE 120
           DLE                     + +P  +QS++    PI +I      R I    F  
Sbjct: 158 DLEETKSMGDNASLKDGIAAFTQTQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFS 217

Query: 121 NHNFTGVTVPIAKSSAI---TKNLDREDLESP--EIPETQPIP------DFSASDVPTQ- 168
               T   +P A +  I   T+ +   D  S   ++P T+PI         +A+D  TQ 
Sbjct: 218 TAAQTQKIIP-ATARIIPVATQRIHSRDTASQTQQVPFTKPIEPQTQIIGTTANDSDTQP 276

Query: 169 ----------TQVLKTTSEXXXXXXXXXXXXXXYEESLTQVEVSEQTYPDQRNSQEDIIQ 218
                     + + +TT +              +++  TQ++   QT  D+  +Q D + 
Sbjct: 277 LRIPVLTAEASLLFQTTPDCVPTIRMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMP 336

Query: 219 QTAADAVPITRLKIHEIEEMWSREVQTETKEHKVKYRAPR---PLKV-FTKEAFMQXXXX 274
           QT  D V  T LKI E++   + E     K   V+Y+  R   P  + F+KE+F+     
Sbjct: 337 QTIHDDVSHT-LKIRELQSELALEDSKREKARNVEYKKSRRNIPTMINFSKESFLADFDN 395

Query: 275 XXXXXXXXXXQEIKATSPIGRNNDSISEVGTSDVKVLKD-----KSSGALTAYQRELKEK 329
                      E K+     ++++ + E   S+   +K+     K+   L++Y   LK +
Sbjct: 396 SSSDEGTDVQLE-KSQLKQQQDDNEVHENKPSEPNSVKNSRESYKNVPLLSSYANNLKRE 454

Query: 330 AEIAKGVMLLSESDD--------------EEDLAVSTSHEAKATVLKLKARLSKR----- 370
            + +K ++L  +SD               +++ A+  S  +KA +L LKARLSK+     
Sbjct: 455 IDSSKCIILDLDSDSDDDGDDYMGGNMSIKDESALPISRLSKAAILNLKARLSKQSQNLT 514

Query: 371 RPPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQE 430
           + P +++  K   + L   LR ++++QILD Q+E IE +G K ED+ KEKEIVENLLEQE
Sbjct: 515 QMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQE 574

Query: 431 IARNKRIR 438
           I RN+RIR
Sbjct: 575 ILRNRRIR 582

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 993

 Score =  213 bits (543), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 190/624 (30%), Positives = 284/624 (45%), Gaps = 87/624 (13%)

Query: 357 KATVLKLKARLSKRR-----PPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGL 411
           KA +L LKARLSK+      P  +     +S   L  +LR + K QILD +KE  + +G+
Sbjct: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419

Query: 412 KFEDVEKEKEIVENLLEQEIARNKRIRMKEKEKAQMNDVPSLALPNRVEEDNDSNYSVSD 471
            ++ + +EK  +E+LLE+E+ARNK+IR++E E+ + N+          E+ +  +YS  +
Sbjct: 420 DYDKITEEKNSIESLLERELARNKKIRLREIEQERQNERKDFG-----EQSSAFDYSNDE 474

Query: 472 EDSVIKXXXXXXXXXXXXXXXNEPKIASDSA-------------GVEIDSDEDDIRFMKG 518
            +                   +   + +D A              ++ + +ED IR    
Sbjct: 475 LEEEPSDEEIDENQSSSPVSLHSGIVCADDAVECAANRMQDLKQTIKPNEEEDAIRKSGL 534

Query: 519 KAHKIXXXXXXXXXXXXXXTVNSAINLGAYGDNLITTTKDEAHTSAEEHTTQLVNEIS-- 576
           + HK                  + I+LGAYG N+    + E     E     + N+++  
Sbjct: 535 RKHKKFCLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLNQIEQEQVGEHVGAHIENDLTTT 594

Query: 577 ------------ESQYRT----------------MEKEKSKIRAQEEKQRLKQMKESGVT 608
                        S ++                 +EK K K   +E K  L+++ +S  +
Sbjct: 595 GRNKNLIKPSSRSSSFQVEDNSHEDMNPGVIRELIEKHKRKELLREAK--LEKLHQSKAS 652

Query: 609 NMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQIRQLLMAENKET 668
            + D EAEESDDEW G+GGVDGE  DD+DSDLEKMIDD+SN+  ++ ++R+  + E    
Sbjct: 653 RIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISE 712

Query: 669 DLKTVNKILHDIKNGGFRKRRQXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXQFGADDK 728
           D   VNKILHDI+ GGFRKR +                 Y               G + K
Sbjct: 713 DKSMVNKILHDIETGGFRKRGRNALDLELSDDDDEELLKYHSRRKELLRQKVSAQG-EAK 771

Query: 729 KLLKNSRSKAFFESMVEDI-----IDLKDP-----FSNQAETSEKDKKSEGLVDASNKQK 778
            L +N +SKAFFE++VEDI     ++ + P     FS+     EK+       D+  K K
Sbjct: 772 LLAENPKSKAFFETIVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNS------DSDKKGK 825

Query: 779 DTI-SHEFVQQXXXXXXXXXXXXXXX---------VARVSQEGERNTDLNSLKQDSTVKT 828
            T+ S  FVQQ                            S   E   D+ +LKQ+S++K+
Sbjct: 826 KTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKS 885

Query: 829 LYAPSNIISESERADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSY 888
           L AP+   S     D E+     L       S    F   ++AN+K +EG+KTV    SY
Sbjct: 886 LSAPTRNSSNMLIDDQED-----LLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSY 940

Query: 889 RTVGGNKASITYLGKMRKLVAPKK 912
           +  G +KASITYLGK RKL APKK
Sbjct: 941 KVAGSSKASITYLGKARKLNAPKK 964

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 41/80 (51%), Gaps = 15/80 (18%)

Query: 38  PAVLGNGFLFNSSTLDKVKNRLNKDQ-----------EQGTQAIDTTQVLSNLYEDGEDL 86
           P V G GFLF +S L +VK+RL  D+           + G   +  TQV+   Y DGEDL
Sbjct: 29  PLVTGTGFLFGNSVLRRVKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAY-DGEDL 87

Query: 87  EKEVP---SILQSKSKPIPT 103
           E++     + ++ KS   PT
Sbjct: 88  EQDFADSTARIEGKSWAGPT 107

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  208 bits (530), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 147/362 (40%), Positives = 200/362 (55%), Gaps = 34/362 (9%)

Query: 581  RTMEKEKSKIRAQEEK--QRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDS 638
            + M +  ++ R QE K  Q+ K+MK  GV+ MF+MEAEES+DEW GVGG DGE  D+YDS
Sbjct: 787  KAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFEMEAEESEDEWHGVGGADGELSDEYDS 846

Query: 639  DLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQXXXXXXXX 698
            +LEKM+DD++ TT +  +IRQ+L AE+KE D K VNKILHDIKNGGFR+R +        
Sbjct: 847  ELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGALDIELS 906

Query: 699  XXXXXXXXXYXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFS--- 755
                     Y             + G +  KL+ N +S AFFESMVED+++ K+PFS   
Sbjct: 907  DDEDDELQRYHAKRRELLRQKVLENG-EASKLVSNPKSHAFFESMVEDLVESKNPFSIGE 965

Query: 756  ----NQAETSEKDK-----------KSEGLVDASNKQKDTISHEFVQQXXXXXXXXXX-- 798
                +    SE DK            + G    + +++  IS EFVQ+            
Sbjct: 966  TADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELD 1025

Query: 799  -----XXXXXVARVSQEGERNTDLN---SLKQDSTVKTLYAPSNIISESERADHEEFDNS 850
                        + S  G+ N DL    +LKQ+S +KTL+ P+     S R    E D +
Sbjct: 1026 NEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPART---SSRTVDLEVDGN 1082

Query: 851  VLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAP 910
                     SV+ SF   ++ N+K KEG KTV VSKSY+T+GG++ASITYLGK+RKL AP
Sbjct: 1083 SPANGFKLPSVISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAP 1142

Query: 911  KK 912
            K+
Sbjct: 1143 KR 1144

 Score = 91.3 bits (225), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 90/131 (68%), Gaps = 6/131 (4%)

Query: 319 LTAYQRELKEKAEIAKGVMLLSESDDEEDLAVSTSHEAKATVLKLKARLSKRRPPVESQH 378
           L +Y+ +LK + +  + + L S SD++E+ +V  S  +KA VL++KAR SKR+   +++ 
Sbjct: 412 LNSYKNQLKARLDSKEHIDLDSSSDEDEN-SVPASKMSKAAVLEIKARTSKRQGIKKTRQ 470

Query: 379 GKA-----SLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIAR 433
             +     SL  L  +L+ + K+QILD ++E  E++GL  ED+E+EK+ VENLLEQEI R
Sbjct: 471 QPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEIER 530

Query: 434 NKRIRMKEKEK 444
           N++IR++EK++
Sbjct: 531 NRKIRLREKQR 541

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 53/92 (57%), Gaps = 18/92 (19%)

Query: 13 KKRRATYQK-----AVQNEDDEYTEDPLVPPAVLGNGFLF-NSSTLDKVKNRLNK----- 61
          KK++ TY K     A Q E+DE  + P +  A     FLF NS+ +DKVK+RLN      
Sbjct: 14 KKKKTTYVKDIEVYATQEENDEEKKQPQLSSA----SFLFGNSTIVDKVKSRLNGVSNEE 69

Query: 62 -DQEQGTQAIDTTQVLSNLYEDGEDLEKEVPS 92
           D E+G  A+  TQV+ N Y DGEDLE++  S
Sbjct: 70 TDGERG-DALPQTQVIPNYY-DGEDLEQDFVS 99

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
           YCL061C (MRC1) - protein involved in replication
           checkpoint [contig 123] FULL
          Length = 970

 Score =  199 bits (505), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 199/682 (29%), Positives = 312/682 (45%), Gaps = 73/682 (10%)

Query: 319 LTAYQRELKEKAEIAKGVMLLSESDDEEDLAVSTSHEAKATVLKLKARLSKRRPPVESQH 378
           L  Y   LK++   A  V   S  D++   A S S  +KA +L LKAR+SK++  +    
Sbjct: 303 LQLYHTILKQRLTDANSVEFSSSDDEKSSEARSLS--SKAAILDLKARMSKKKQSLAVTS 360

Query: 379 GK-----ASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIAR 433
            K     ASL  L  +LR + + Q+++ +   +  +G+   ++ KEKE VE+LLE+E+AR
Sbjct: 361 SKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRGVDLAEIAKEKESVESLLERELAR 420

Query: 434 NKRIRMKEKEKAQ-----------MNDVPSLALPNRVEEDNDSNYSVSDEDSVIKXXXXX 482
           NK+++ +E +K +            ND  S +L +  +  +DSN        V +     
Sbjct: 421 NKKVKQEEIQKGEDSSSDSSSDEFCND-SSTSLGSHSDSADDSNGYDDYNQEVDESVDTE 479

Query: 483 XXXXXXXXXXNEPKIASDSAGV---EIDSDEDDIRFMKGKAHKIXXXXXXXXXXXXXXTV 539
                     +E  + + +  +   E D ++D +   K K  +                 
Sbjct: 480 VVDLGPLKSKHELSVKTTNLTIVRAESDEEDDPLNVTKKKKVRRWNLIDSDDEALSNDEQ 539

Query: 540 NSAINLGAYGDNLITTTK-DEA------HTSAEEHTTQLVNEISESQYRTMEK------- 585
            + I+LGAYG+N++ T + DE        TS+     +L    ++S  R + +       
Sbjct: 540 KTVIDLGAYGENILGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKID 599

Query: 586 --------------EKSKIRAQEEKQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGE 631
                         EK K++    + ++K++  S    M D EAEESDDEW GVGG DGE
Sbjct: 600 QDEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGE 659

Query: 632 TIDDYDSDLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQX 691
             D YDS+L++MIDD+SNT S+ + +R+ LM E K  D   V++ILHDI+NGGFRKR + 
Sbjct: 660 NSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRY 719

Query: 692 XXXXXXXXXXXXXXXXYXXXXXXXXXXXXXQFGADDKKLLK-NSRSKAFFESMVEDIIDL 750
                           Y               G  +  +L  N +SKAFF+S+ ED  DL
Sbjct: 720 AMDLTLSDDEDDDLLRYHARRKELLNERKS--GNQEISVLATNPKSKAFFDSIFED--DL 775

Query: 751 KDPFSNQAETSEKDKKSEGLVD-ASNKQKDTISHEFVQQX----XXXXXXXXXXXXXXVA 805
           K   +N  E        +   D  S K++  IS +FVQ+                   VA
Sbjct: 776 KGGIANLKEYQSHASPLKAAKDEISGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVA 835

Query: 806 RVSQEGERN----TDLNSLKQDSTVKTLYAP--SNIISESERADHEEFDNSVLPVESSYS 859
              +    +    TD   LKQ S +K+  AP  S+I  +    D       VL  +++ +
Sbjct: 836 DTQESSSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKD------GVLSGKAN-T 888

Query: 860 SVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAEVRT 919
           ++V+ F   ++ N+K +EGRKTV    SY+  G ++ASIT+LGK R L A K+       
Sbjct: 889 TLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHARSA 948

Query: 920 TSKLSTLGNSKIFRNFESSFEN 941
                 + + + F +   SFEN
Sbjct: 949 PHGQKIMTSHQFFASDGQSFEN 970

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 18/87 (20%)

Query: 13 KKRRATYQKAVQNEDDEYTEDPLVPPAVLGNGFLFNSSTLDKVKNRLNK--DQEQGTQAI 70
          + +R+ + K +   DDE        P V G GFLF +S  ++VK R+    D E    A 
Sbjct: 11 RTKRSGFVKKLHLFDDESC------PTVGGTGFLFENSIFNQVKKRIKATDDNEINHNAP 64

Query: 71 DT--TQVLSNLYE--------DGEDLE 87
           T  T++L +  E        DGE+LE
Sbjct: 65 TTASTEILKDTCETQAIERPYDGEELE 91

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 925

 Score =  172 bits (437), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 151/418 (36%), Positives = 202/418 (48%), Gaps = 64/418 (15%)

Query: 542 AINLGAYGDNLIT---TTKDEAHTS------------AEEHTTQL-VNEISESQY----- 580
            INLG YGDNL +   T  D A  S               H+ +L V E+S         
Sbjct: 516 GINLGHYGDNLTSSNVTENDGADQSDRNVPSNSELKMNRSHSAKLLVGELSSDSSVDSDS 575

Query: 581 ---------RTMEKEKSKIRAQEE----KQRLKQMKESGVTNMFDMEAEESDDEWRGVGG 627
                    R   +E++K+R + E    K+R + +K +G+  + +MEAEES+DEW GVGG
Sbjct: 576 SEDELDEVERNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGG 635

Query: 628 VDGETIDDYDSDLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRK 687
            DGE  DDYDSDL+ MIDDFS +  +   IR+ L  ENKE D + +NKILHDI  GGFRK
Sbjct: 636 ADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRK 695

Query: 688 RRQXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDI 747
           R +                 +             +   +   ++ NS+SKAFF+SMVEDI
Sbjct: 696 RGRGALDLELSDDEDELLRQFREKRREIMKQKLLE---NVDGVVNNSKSKAFFDSMVEDI 752

Query: 748 IDLKDP----FSNQAETSEKDKKSEGLVDASNKQKDTISHEFVQQXXXXXXXXXXXXXX- 802
                P    FSN               D   K+K  IS EFVQ                
Sbjct: 753 TRKSIPAVTSFSNTR-------------DEMGKKKIVISEEFVQSSLSFLSAKDDDINEF 799

Query: 803 XVARVSQEGERNTDLNSLKQDSTVKTLYAPSNIISESERADHEEFDNSVLPVESSYSSVV 862
            V   + +     DL SLKQ S +K+L +P         A  ++ D + L  +    S+V
Sbjct: 800 EVTEAAHDA--TEDLESLKQRSNIKSLDSPQR---NRNSAFFDDVDGTSLDFK--LPSIV 852

Query: 863 KSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAP--KKSNAEVR 918
           KSF  + + NDK K G KTVT+SKSYR   G++++IT+LGK RKL AP  +KS   VR
Sbjct: 853 KSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKSTPLVR 910

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 65/110 (59%), Gaps = 6/110 (5%)

Query: 336 VMLLSESDDEEDLAVSTSHEAKATVLKLKARLSKRRPP-VESQHGKA--SLSALMKNLRN 392
           + L S S+ E+D     S  +KA +L +KA+ S+ +    ++ H     SL  L  +L+ 
Sbjct: 322 IELNSSSESEDDYK---SQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELFTSLKT 378

Query: 393 STKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIARNKRIRMKEK 442
             + QIL+ ++E   ++G+  E +E EK  VE LLEQE+ RN+R++++EK
Sbjct: 379 KNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQELERNRRVKLREK 428

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 68/164 (41%), Gaps = 33/164 (20%)

Query: 13  KKRRATYQKAVQNEDDEYTEDPLVPPAVLGNGFLFNSSTLDKVKNRLNKDQEQGT-QAID 71
           KK+  TY KA   ED+E           +G       + L++VK RLN D +  T  AID
Sbjct: 13  KKKGKTYSKANDAEDEELN---------VGEHKFLAENLLERVKKRLNGDSDDSTASAID 63

Query: 72  TTQVLSNLYED-----GEDLEKEVPSI-------------LQSKSKPIP-TILIPSIERE 112
            ++  +  Y D     G++L+ E  ++             +Q K  PI  T LIP+    
Sbjct: 64  NSKKSTFFYSDTDLYEGKELDDEFEAMRETAAVPKQREVEIQQKKHPISQTQLIPTFSSS 123

Query: 113 ILKQPFNENHNFTGVTVPIAKSSAITKNLDREDLESPEIPETQP 156
            L +         G    I +     ++LD + L + EI +T P
Sbjct: 124 WLAKTQVNTQALEGTNRTIDRQQ---QDLDTQ-LNNEEITQTTP 163

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  166 bits (420), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 121/363 (33%), Positives = 189/363 (52%), Gaps = 29/363 (7%)

Query: 587  KSKIRAQEEKQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDD 646
            +++ RA+  K R ++MK+ G+T M +MEAEES+DEW G+GG D E  +DYDS++EKMIDD
Sbjct: 666  RNRKRAERNKLRRREMKKKGITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDD 725

Query: 647  FSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQXXXXXXXXXXXXXXXX 706
            +S  +SNAD +R +L    ++ D   VNKILHDI  GGFR+R +                
Sbjct: 726  YSVHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQ 785

Query: 707  XYXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQAETSEK-DK 765
             +             + G D  KL+ N +S AFF++MV+D+ +     +  A   EK D 
Sbjct: 786  QFRQKRRELLKQKILENG-DTSKLVSNPKSYAFFQTMVDDVTEASFGNTFDANIDEKTDP 844

Query: 766  KSEGLVDASNKQKDTISHEFVQQXXXXXXXXXX-----XXXXXVARVSQEGERNTDLNSL 820
             + G       +K  IS +FV++                    ++  + E E   DL++L
Sbjct: 845  SAAG-------RKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTL 897

Query: 821  KQDSTVKTLYAPSNI---ISESERADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKLKE 877
            KQ+S +K L     +   ++E    D  ++  S+      + S  KSF    N +DK K 
Sbjct: 898  KQNSNIKHLKGSLELPAQMAELSSGDEGDYGFSL----DRFRSAAKSFNNGTNVDDKFKS 953

Query: 878  GRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPK--------KSNAEVRTTSKLSTLGNS 929
            G K V + K+ +T+GG+KA+IT++G+ R+L+ PK        K N+  R  S+L + GN+
Sbjct: 954  GTKAVRILKANKTIGGSKAAITFIGRKRRLIPPKNDYKDSEPKLNSSKRARSQLFSEGNN 1013

Query: 930  KIF 932
            + F
Sbjct: 1014 RSF 1016

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 65/100 (65%), Gaps = 2/100 (2%)

Query: 333 AKGVMLLSESDDEEDLAVSTSHEAKATVLKLKARLSKRRPPVESQHGKASLS-ALMKNLR 391
           A+ ++L   S+D+ D+ +S S  +KA VL +KAR SK   P +    K+S S  L   LR
Sbjct: 363 ARQIILDESSEDDTDVNLS-SAVSKAAVLAIKARNSKFITPQKIDETKSSKSNELFAKLR 421

Query: 392 NSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEI 431
            + + Q+L++++  IER+G+  +++E+E+E + NLLEQE+
Sbjct: 422 KANREQLLEQRRNAIERRGINMQNLEQEREQLGNLLEQEL 461

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  166 bits (419), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 184/354 (51%), Gaps = 34/354 (9%)

Query: 589  KIRAQEE--KQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDD 646
            K+R QE+  +Q+ K+M++ GV  M ++EA+ES+DEW GVGGVD E  D+YDSDL+KMIDD
Sbjct: 762  KLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDD 821

Query: 647  FSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQXXXXXXXXXXXXXXXX 706
            ++    +  +IR++L +E+ + D   VNKILHDIK GGFRKR +                
Sbjct: 822  YNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGELDLELSEDEDGILQ 881

Query: 707  XYXXXXXXXXXXXXXQFGADDKKLLKNSRSKAFFESMVEDII-----DLKDPFSNQAETS 761
             Y                  +  +  N +S  FFESMV++        L  P S  A+++
Sbjct: 882  SYRAKRWNEQKQKMLD-SEHNTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSPPAQST 940

Query: 762  EKDKKSEGLVDASNKQKDTISHEFVQQXXXXXXXXXXXXXXXVARVSQEGERNT------ 815
               +     +  + KQK  IS  FV+Q                + ++ E   N       
Sbjct: 941  NVLE-----LKQNTKQKIVISEHFVKQTLSFLTSDENMTNMR-SEINVEKPNNDNDIYSS 994

Query: 816  ---DLNSLKQDSTVKTL--YAPSNIISESERADHEEFDNSVLPVESSYSSVVKSFGFDLN 870
               DL +LK+ ST+K L  Y+   I++E E  D  EF            SV+++FG   +
Sbjct: 995  EVEDLYTLKETSTIKVLNTYSGKPIVNEDE--DGAEFGFKA-------PSVMQTFGSRND 1045

Query: 871  ANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAEVRTTSKLS 924
             NDK K+G K+V +S  Y+T+G ++A+IT+LGK RKL+ PK+S+   R ++  S
Sbjct: 1046 VNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRSSKSPRDSAHRS 1099

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 115/234 (49%), Gaps = 36/234 (15%)

Query: 262 VFTKEAFMQXXXXXXXXXXXXXXQEIKATSPIGRNNDSISEVGTSDVKVLKDKSSGALT- 320
           +FTKEAF+               QE+  +S   R  +++S   +SDV    +     LT 
Sbjct: 338 IFTKEAFLDDFELSG--------QEVDYSSTATRVKETVSNDISSDVSSNTNAVYDNLTD 389

Query: 321 --------AYQRELKE--------KAEIAKGVMLLSESDDEE-DLAVSTSHEAKATVLKL 363
                   AY  E K         K  + + ++L S SD+E      +TS   KA +L +
Sbjct: 390 NFGTITRDAYAEEAKPPLLPLQSMKNTVGQDIILDSSSDEEHASNQFATSTMVKAALLNI 449

Query: 364 KARLSKR---RPPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEK 420
           KA++SK        E      +L  L  +L+ + K+QILD ++E  E++G+  E +E+E+
Sbjct: 450 KAKISKNMNLSKNAEQSINSPTLKQLFISLKKANKKQILDHRREITEKRGISLEQLEQER 509

Query: 421 EIVENLLEQEIARNKRIRMKEKEKAQMNDVPSLALPNRVEEDNDSNYSVSDEDS 474
           E VE+LLEQ+I RN+RIR++EK+K          L  R E+ N+ +   SD D+
Sbjct: 510 EKVEDLLEQKIKRNRRIRLREKKKEN-------ELRLRYEDINNCSTGSSDGDA 556

>NCAS0G00840 Chr7 complement(144027..145442) [1416 bp, 471 aa] {ON}
           Anc_5.612
          Length = 471

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 6/86 (6%)

Query: 596 KQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSD---LEKMIDDFSNTTS 652
           +Q  KQ+ E G   +   +    D  W GV  +D +   D D+    LE MI DF  T  
Sbjct: 311 RQMSKQVHERGGIVILINKTSVGDSSWNGV--IDYQIWSDCDTWVTYLEDMIPDFFKTQK 368

Query: 653 NADQIRQLLMAENKETDLKTVNKILH 678
             +++RQ L  EN E   K ++  +H
Sbjct: 369 QIEKLRQ-LKRENSELKKKKLSSTIH 393

>KNAG0M02440 Chr13 complement(449275..454377) [5103 bp, 1700 aa]
           {ON} Anc_2.653 YKL014C
          Length = 1700

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 31/60 (51%)

Query: 859 SSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAEVR 918
           S +V+++ +    N+     + T+T+ K+ RT+ GN  ++ + G + KL+    S    R
Sbjct: 57  SQIVQAWSYYAQVNNHAMFSKSTITLMKTLRTLEGNPGTVAHGGNLIKLILTDYSKVLYR 116

>NCAS0A03600 Chr1 (717693..721403) [3711 bp, 1236 aa] {ON} Anc_8.78
           YPL012W
          Length = 1236

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 856 SSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNA 915
           SSY+++   FG  +++ND L + R    +++      G  A +TY+  + K++     N 
Sbjct: 740 SSYAALFNIFGTTVSSNDALIQKRAYRIITRLSELESGYAAVLTYVSDIEKIILDNADN- 798

Query: 916 EVRTTSKLSTLGNSKIFRNFESS 938
            V+T++K + L   K   N   S
Sbjct: 799 -VQTSAKSTRLSAIKTLVNMLPS 820

>TDEL0A04790 Chr1 (844870..846291) [1422 bp, 473 aa] {ON} Anc_5.612
           YOR025W
          Length = 473

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 5/64 (7%)

Query: 600 KQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYD---SDLEKMIDDFSNTTSNADQ 656
           KQ+ E G   +   +    D  W GV  +D + + D D   + LE  I DF  T    D+
Sbjct: 306 KQVHERGGIVILVNKTSIGDSSWHGV--IDYQIMRDCDEWVTYLEAQIPDFFKTQEQIDK 363

Query: 657 IRQL 660
           +RQL
Sbjct: 364 LRQL 367

>NDAI0F01500 Chr6 complement(369071..372622) [3552 bp, 1183 aa] {ON}
           Anc_6.234 YPL217C
          Length = 1183

 Score = 32.0 bits (71), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 6/60 (10%)

Query: 612 DMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFS------NTTSNADQIRQLLMAEN 665
           D+EAEE +D +    GV+ ++  DY +DLEK +  F       +  SN D I+   +  N
Sbjct: 577 DIEAEEDEDFFSKKDGVNDKSSPDYQADLEKFVPYFDTLEKLMSKWSNVDAIQNRFIGAN 636

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.125    0.328 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 90,348,454
Number of extensions: 3941759
Number of successful extensions: 24311
Number of sequences better than 10.0: 349
Number of HSP's gapped: 25205
Number of HSP's successfully gapped: 396
Length of query: 941
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 822
Effective length of database: 39,836,145
Effective search space: 32745311190
Effective search space used: 32745311190
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)