Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C069601.6ON35033415150.0
CAGL0B00352g1.6ON33731313110.0
NCAS0B091001.6ON32731713070.0
NDAI0A001501.6ON31731313030.0
Kpol_2002.91.6ON33831413020.0
SAKL0C00484g1.6ON33931512921e-179
KNAG0C002301.6ON34931312751e-176
KLLA0C00506g1.6ON33031012701e-176
Smik_3.151.6ON31631212671e-176
TPHA0E040001.6ON31631512651e-176
YCL059C (KRR1)1.6ON31631212651e-176
Ecym_10091.6ON33631412591e-174
Suva_3.1531.6ON31631212531e-174
Kwal_33.130111.6ON33431412531e-173
ZYRO0F18458g1.6ON31431312491e-173
Skud_3.41.6ON31631412491e-173
KLTH0F00506g1.6ON33231412301e-170
TBLA0A049401.6ON31631512141e-168
KAFR0D001501.6ON34430812121e-167
AFR744W1.6ON34331011961e-165
Ecym_45525.482ON271146900.010
SAKL0G03740g5.482ON266146900.010
Kpol_543.135.482ON268146900.010
Kwal_47.188645.482ON271146890.011
ZYRO0D11440g5.482ON269146890.012
Suva_8.1975.482ON274148890.013
KLTH0G02574g5.482ON271146880.016
TDEL0A034605.482ON272146880.017
NCAS0A119605.482ON270193870.021
CAGL0K09460g5.482ON261146850.033
KLLA0C06446g5.482ON274146840.047
TPHA0J028205.482ON268146840.050
Skud_15.3105.482ON276148840.052
YOR145C (PNO1)5.482ON274148830.069
Smik_15.3265.482ON274148820.076
AFR390C5.482ON311146830.077
KAFR0E036005.482ON276146820.080
KNAG0C046105.482ON277176810.12
NDAI0A043105.482ON274146810.13
AAR002W1.420ON178109780.20
TBLA0D018905.482ON271146750.63
TBLA0H018305.375ON40664741.2
KLTH0E14014g8.798ON48699722.1
Smik_4.4128.361ON50668722.1
KAFR0B030308.309ON46724712.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C06960
         (350 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   588   0.0  
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   509   0.0  
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   508   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   506   0.0  
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   506   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   502   e-179
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   495   e-176
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   493   e-176
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   492   e-176
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   491   e-176
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   491   e-176
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   489   e-174
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   487   e-174
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   487   e-173
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   485   e-173
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   485   e-173
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   478   e-170
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   472   e-168
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   471   e-167
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   465   e-165
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    39   0.010
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    39   0.010
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    39   0.010
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    39   0.011
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    39   0.012
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    39   0.013
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    39   0.016
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    39   0.017
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    38   0.021
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    37   0.033
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    37   0.047
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    37   0.050
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    37   0.052
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    37   0.069
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    36   0.076
AFR390C Chr6 complement(1138631..1139566) [936 bp, 311 aa] {ON} ...    37   0.077
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    36   0.080
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    36   0.12 
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    36   0.13 
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    35   0.20 
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    33   0.63 
TBLA0H01830 Chr8 complement(433992..435212) [1221 bp, 406 aa] {O...    33   1.2  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    32   2.1  
Smik_4.412 Chr4 (748318..749838) [1521 bp, 506 aa] {ON} YDR168W ...    32   2.1  
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    32   2.7  

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/334 (87%), Positives = 291/334 (87%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                VYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKL                  SK
Sbjct: 241 RAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARSK 300

Query: 301 DYIAPKEDVYKSSLEPEXXXXXXXAQHEDNSEDE 334
           DYIAPKEDVYKSSLEPE       AQHEDNSEDE
Sbjct: 301 DYIAPKEDVYKSSLEPEKKKKKRKAQHEDNSEDE 334

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 260/313 (83%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVST+N+DKPWDTEDIDKW++EEFKPEDN SG PFAEESSFMTLFPKYRE YLKSIWNDV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRAL+ HHI C LDL+EGSMTVKTTRKTFDPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN VANK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVV D M+NVHPIY IKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                VYTPFPPAQ PRK+DL+IESGEYFLSKKEKEI KL                   K
Sbjct: 241 KAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300

Query: 301 DYIAPKEDVYKSS 313
           DYIAPKED YKSS
Sbjct: 301 DYIAPKEDEYKSS 313

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  508 bits (1307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/317 (76%), Positives = 266/317 (83%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHNRDKPWDT D+DKW +EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRALN H++ CVLDL+EGSMTVKTTRKTFDPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGP++GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED M+NVHPIY IKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                +YTPFPPAQ PRK+DLEIESGEYFLSK+EKE+ KL                  +K
Sbjct: 241 RKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERNK 300

Query: 301 DYIAPKEDVYKSSLEPE 317
           +YIAP+E+ YKSSL+ E
Sbjct: 301 NYIAPEEETYKSSLKKE 317

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  506 bits (1303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/313 (77%), Positives = 264/313 (84%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHNRDKPWDTE+I+KW++EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRALN H++ACVLDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKILE+D
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED M+N+HPIY IKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                +YTPFPPAQ PRK+DLEIESGEYFLSK+EKE+ KL                  +K
Sbjct: 241 KKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERNK 300

Query: 301 DYIAPKEDVYKSS 313
           DY+AP E  YKSS
Sbjct: 301 DYVAPSEPTYKSS 313

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  506 bits (1302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/314 (77%), Positives = 263/314 (83%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHN+DKPWDTEDIDKW+VEEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           T+AL+  HIAC LDL+EGSMTVKTTRKTFDP  IL+ARDLIKLLARSVPF QA+KILE+D
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M+NVHPIY IKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP 240

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                VYTPFPPAQQPRK+DLEIESGEYFLSKKEKE+ +L                  SK
Sbjct: 241 KKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERSK 300

Query: 301 DYIAPKEDVYKSSL 314
           DY+AP E+ YKS++
Sbjct: 301 DYVAPMEEEYKSTI 314

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  502 bits (1292), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 244/315 (77%), Positives = 264/315 (83%), Gaps = 1/315 (0%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           M STHN+DKPWDT +IDKW++EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRAL+ HHIAC LDL+EGSM+VKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKILE+D
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           VACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXX-XXXXXXXX 239
           KEVRRVVED M+NVHPIY IKELMIKRELAKRPELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 240 XXXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXS 299
                 VYTPFPPAQ PRK+DLEIESGEYFLSKKEKE+ KL                  +
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 300 KDYIAPKEDVYKSSL 314
           KDY+AP+E  YKS+L
Sbjct: 301 KDYVAPEEAEYKSTL 315

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  495 bits (1275), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 236/313 (75%), Positives = 256/313 (81%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHN+DKPWDT+DIDKW +EEFKPEDNASG PFAEESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           T+AL++HHIAC LDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKIL+ED
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
            ACDVIKIGN+V NKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M NVHPIY IKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                VYTPFPPAQ PRK+DLEIESGEYFL+KKEK+  KL                   K
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300

Query: 301 DYIAPKEDVYKSS 313
           DY APKE  Y ++
Sbjct: 301 DYTAPKEKAYGTT 313

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  493 bits (1270), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 238/310 (76%), Positives = 261/310 (84%), Gaps = 1/310 (0%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHN+DKPWDT+++DKW +EEFKPEDN SGLPFAEESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TR+L+AHHIAC L+L+EGSMTVKTTRKT+DPA+IL+ARDLIKLLARSVPF QAVKILE+D
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           VACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED M+NVHPIY IKELMIKRELAK+PELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                +YTPFPPAQ PRK+DLEIESGEYFLSK+EKE+ KL                  +K
Sbjct: 240 IKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299

Query: 301 DYIAPKEDVY 310
           D+IAPKE  Y
Sbjct: 300 DFIAPKETDY 309

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  492 bits (1267), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 239/312 (76%), Positives = 261/312 (83%), Gaps = 1/312 (0%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHNRDKPWDT+DIDKW++EEFK EDNASG PFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRAL+ H+IACVLDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVED M+NVHPIY IKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXS 299
                 VYTPFPPAQ PRK+DLEIESGEYFLSK+EK++ KL                  +
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 300 KDYIAPKEDVYK 311
           KD+IAP+E+ YK
Sbjct: 301 KDFIAPEEETYK 312

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  491 bits (1265), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 234/315 (74%), Positives = 263/315 (83%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHN++KPWDTEDIDKW++E+FKPEDNASG+PF+EESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           T+AL+ HH+AC L+L++GSMTV TTRKT+DP IIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED MRNVHPIY IKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                VYTPFPP+Q PRK+DLEIESGEYFLSKKEKE+ +L                  SK
Sbjct: 241 KREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300

Query: 301 DYIAPKEDVYKSSLE 315
           +YIAPKE+ Y SS+E
Sbjct: 301 NYIAPKEEKYVSSIE 315

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  491 bits (1265), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 238/312 (76%), Positives = 261/312 (83%), Gaps = 1/312 (0%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHNRDKPWDT+DIDKW++EEFK EDNASG PFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRAL+ H+IACVLDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVED M+N+HPIY IKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXS 299
                 VYTPFPPAQ PRK+DLEIESGEYFLSK+EK++ KL                  +
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 300 KDYIAPKEDVYK 311
           KD+IAP+E+ YK
Sbjct: 301 KDFIAPEEEAYK 312

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  489 bits (1259), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/314 (75%), Positives = 261/314 (83%), Gaps = 1/314 (0%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHN+DKPWDT DIDKW++EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS WNDV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRAL+ HH+AC L+L+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKILE+D
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           VACDVIKIGN  +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED M+NVHPIY IKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMF-KKRNIARKKPKK 239

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                VYTPFPPAQ PRK+DLEIE+GEYFLSK EK++ KL                  ++
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299

Query: 301 DYIAPKEDVYKSSL 314
           DYIAP E  YK++L
Sbjct: 300 DYIAPDEKEYKNAL 313

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  487 bits (1253), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/312 (75%), Positives = 260/312 (83%), Gaps = 1/312 (0%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHNRDKPWDT+D+DKW +EEFK EDNASG PFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRAL+ H+I+CVLDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVED M+NVHPIY IKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXS 299
                 VYTPFPPAQ PRK+DLEIESGEYFLSK+EK++ KL                  +
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 300 KDYIAPKEDVYK 311
           K+++AP+E+ YK
Sbjct: 301 KNFVAPQEEAYK 312

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  487 bits (1253), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 235/314 (74%), Positives = 257/314 (81%), Gaps = 1/314 (0%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           M STHN+DKPWDT DIDKW++EEFKPEDN SGLPF+EESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRAL  H I+CVLDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVED M+NVHPIY IKELMIKRELAKRP+LAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXS 299
                 VYTPFPP QQPRK+DL+IESGEYFLSKKEKE  KL                  +
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 300 KDYIAPKEDVYKSS 313
           KDY+AP E  Y S+
Sbjct: 301 KDYVAPSEKEYGST 314

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  485 bits (1249), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 235/313 (75%), Positives = 254/313 (81%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHN+DKPWDT +IDKW  +EFK EDNASGLPFAEESSFMTLFPKYRE YLKSIWNDV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           T+ALN +H+ACVLDL+EGSMTVKTTRKT DPAIIL+ARDLIKLLARSVPF QAVKILE++
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
            ACDVIKIGN VANKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+ MG YKGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDTM+N+HPIY IKELMIKRELAKRPELA EDWSRFLP F             
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                VYTPFPPAQ PRK+DLEIESGEYFL+K+EKE  KL                   K
Sbjct: 241 RKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERRK 300

Query: 301 DYIAPKEDVYKSS 313
           D++ PKE+ YK S
Sbjct: 301 DFLPPKEEDYKKS 313

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  485 bits (1249), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 235/314 (74%), Positives = 260/314 (82%), Gaps = 1/314 (0%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHNR+KPWDT+DIDKW++EEFK EDN SG PFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRAL+ H+IACVLDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVED M+N+HPIY IKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXS 299
                 VYTPFPPAQ PRK+DLEIESGEYFLSK++K++ KL                  +
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 300 KDYIAPKEDVYKSS 313
           KD+ AP+E+ YK S
Sbjct: 301 KDFTAPEEESYKPS 314

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  478 bits (1230), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 238/314 (75%), Positives = 260/314 (82%), Gaps = 1/314 (0%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           M STHN+DKPWDT DIDKW++EEFKPEDN SG+PFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRAL+ H+IACVLDL+EGSMTVKTTR+T+DPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
            ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVED MRN+HPIY IKELMIKRELAKRP+LAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXS 299
                 VYTPFPPAQQPRKIDL+IESGEYFL+KKEKE  KL                  +
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 300 KDYIAPKEDVYKSS 313
           KDY+AP E  Y+ S
Sbjct: 301 KDYVAPIEKGYEGS 314

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  472 bits (1214), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 234/315 (74%), Positives = 260/315 (82%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVSTHNRDKPWDT DI+KW+++EFKPEDNASGLPF EESSFMTLFPKYRE YL+ +W DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           T++L+ +H+AC LDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVP+ QA++IL++D
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGNVV NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED M+NVHPIY IKELMIKREL+KRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                VYTPFPPAQ PRK+DLEIESGEYFLSKKEKEI KL                   K
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERRK 300

Query: 301 DYIAPKEDVYKSSLE 315
           D+IAP E  YKSSL+
Sbjct: 301 DFIAPSEKEYKSSLQ 315

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  471 bits (1212), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 236/308 (76%), Positives = 256/308 (83%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVST+N++KPWDTEDIDKWQ EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           T+AL  HHIAC+LDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QA+KILE++
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED M NVHPIY IKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                VYTPFPP Q PRK+DLEIESGEYFLSKKEKE+ KL                   K
Sbjct: 241 RKEKKVYTPFPPTQLPRKVDLEIESGEYFLSKKEKEVKKLEERKEEQAKKQEEKEKERKK 300

Query: 301 DYIAPKED 308
           +YIAPKE+
Sbjct: 301 NYIAPKEE 308

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  465 bits (1196), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 234/310 (75%), Positives = 254/310 (81%), Gaps = 1/310 (0%)

Query: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60
           MVST N+DKPWDT D+DKW +EEF PED+ASGLPFAEESSFMTLFPKYRE YLKSIW +V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120
           TRAL  HHIAC L+L+EGSM+VKTTRKT+DPAIIL+ARDLIKLLARSVP  QA+KIL++D
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180
           +ACDVIKIGN+VA+KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED MRN+HPIY IKELMIKRELAKRPELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLXXXXXXXXXXXXXXXXXXSK 300
                VYTPFPPAQ PRK+DLEIE+GEYFLSKKEKE  KL                  +K
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERAK 299

Query: 301 DYIAPKEDVY 310
           DYIAP E  Y
Sbjct: 300 DYIAPAEPEY 309

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTT-RKTFDPAIILRARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + +  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  +D+  +  +I +V   N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + +  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
            A       A+ +L  +D+  +  ++ +V     +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAV 239

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTT-RKTFDPAIILRARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + +  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  +D+  +  +I +V   N +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   ++ ++T  K T DP  + +  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L  +D+  +  +I +V   N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTT-RKTFDPAIILRARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ +++  R+T DP  + +  D IK 
Sbjct: 97  PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRSHPRQTTDPGALQKGADFIKA 156

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  +D+  +  ++ +V   N +   +   R+ G +G T  A+E  T+
Sbjct: 157 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 216

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++    + ++G +  ++  R  V
Sbjct: 217 TRIVLADAKIHILGGFTHIRMAREAV 242

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLI 101
           + P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + +  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELL 159
           K  A       ++ +L  +D+  +  ++ +V     +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSVMGPYKGLKEVRRVV 187
           T+  I++  + + ++G +  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   ++ ++T  K T DP  + +  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L  +D+  +  +I +V   N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTT-RKTFDPAIILRARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + +  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  +D+  +  +I +V   N +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 83/193 (43%), Gaps = 10/193 (5%)

Query: 4   THNRDKPWDTEDIDKWQVEE-----FKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWN 58
           TH+  +P   ++     ++E     F   + A G     ES  + + P +R   L++ W 
Sbjct: 52  THDDTQPTQKKEAKGVVLDEEGKPRFSSANKAEGAKVKLESRKVPV-PPHRMTPLRNSWT 110

Query: 59  DVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLIKLLARSVPFAQAVKI 116
            +   L  H  +   ++L   S+ ++T  K T DP  + +  D IK          ++ +
Sbjct: 111 KIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIAL 170

Query: 117 LE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVM 174
           L  +D+  +  +I +V     +   +   R+ G +G T  A+E  T+  I++    + ++
Sbjct: 171 LRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADTKIHIL 230

Query: 175 GPYKGLKEVRRVV 187
           G +  ++  R  V
Sbjct: 231 GGFTHIRMAREAV 243

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLIKL 103
           P +R   L++ WN +   L  H  +   ++L   ++ ++T  K T DP  + +  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  +D+  +  ++ +V     +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAV 234

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLIKL 103
           P +R   LK+ W+ +   L  H  +   ++L   S+ ++T  K T DP  + +  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNVVANKERFVKRR-QRLVGPNGNTLKALELLTK 161
                    ++ +L  +D+  +  +I +V   +   + R   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLIKL 103
           P +R   L++ W+ +   L  H  +   ++L   S+ ++T  K T DP  + +  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  +D+  +  +I +V   + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++    + ++G +  ++  R  V
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAV 241

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 30/148 (20%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLI 101
           + P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + +  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  +D+  +  ++ +V     +   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSVMGPYKGLKEVRRVV 187
           T+  I++  + + ++G +  ++  R  V
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESV 249

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 36.6 bits (83), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 30/148 (20%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLI 101
           + P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + +  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  +D+  +  ++ +V     +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSVMGPYKGLKEVRRVV 187
           T+  I++  + + ++G +  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 36.2 bits (82), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 30/148 (20%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLI 101
           + P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + +  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  +D+  +  ++ +V     +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSVMGPYKGLKEVRRVV 187
           T+  I++  + + ++G +  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>AFR390C Chr6 complement(1138631..1139566) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR145C
           (PNO1)
          Length = 311

 Score = 36.6 bits (83), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTT-RKTFDPAIILRARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  R T DP  + +  D IK 
Sbjct: 139 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPRHTTDPGALQKGADFIKA 198

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  +D+  +  +I +V   + +   +   R+ G +G +  A+E  T+
Sbjct: 199 FTLGFDLDDSISLLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKSKFAIENATR 258

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 259 TRIVLADSKIHILGGFTHIRMAREAV 284

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 36.2 bits (82), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + +  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  +D+  +  ++ +V     +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  V
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAV 249

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  IDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDVTRALNAH-HIACVLD 74
           +D+     F   + AS      ES  + + P +R   L++ W  +   L  H  +   ++
Sbjct: 76  LDEQGKPRFSSANKASETKIKAESRKVAV-PPHRMTPLRNNWTKIYPPLVDHLKLQVRMN 134

Query: 75  LMEGSMTVKTTRK-TFDPAIILRARDLIKLLARSVPFAQAVKILE-EDVACDVIKIGNV- 131
           L   S+ ++T  K T DP  + +  D IK          ++ +L  +D+  +  ++ +V 
Sbjct: 135 LKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 194

Query: 132 VANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGLKEVRRVV 187
             + +   +   R+ G +G T  A+E  T+  I++  + + ++G +  ++  R  V
Sbjct: 195 TLHGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 250

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + +  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  +D+  +  +I +V     +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++    + ++G +  ++  R  V
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESV 247

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 47/109 (43%), Gaps = 16/109 (14%)

Query: 54  KSIWNDVTRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQA 113
           +++W +V RAL+    A    L  GS +V            +  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSECTAALFPRLELGSGSV------------IAPRTLLELLRRAGGSQQA 51

Query: 114 VKILEEDVACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKC 162
                  V  D + +  V   K    KRRQ+L GP    L+ +  L KC
Sbjct: 52  G---TAAVGADGLVLA-VPKKKVSHQKRRQKLYGPGKKQLQMVHHLGKC 96

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 29/146 (19%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREPYLKSIWNDVTRALNAH-HIACVLDLMEGSMTVKTTRK-TFDPAIILRARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + +  D IK 
Sbjct: 99  PPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFAQAVKILE-EDVACDVIKIGNV-VANKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  +D+  +  ++ +V     +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPYKGLKEVRRVV 187
             I++  + + ++G +  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESI 244

>TBLA0H01830 Chr8 complement(433992..435212) [1221 bp, 406 aa] {ON}
           Anc_5.375 YDR331W
          Length = 406

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 79  SMTVKTTRKTFDPAIILRARDLIKLLAR-SVPFAQAVKILEEDVACDVIKI--GNVVANK 135
           ++ V T+R  F+   +  A  + +   R  VP +Q + +L +DVAC+   +  G+V  NK
Sbjct: 30  AVIVSTSRFWFNYRHMANALSMYRTFKRLGVPDSQIILMLSDDVACNSRNLFPGSVFNNK 89

Query: 136 ERFV 139
           +RF+
Sbjct: 90  DRFL 93

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGLKEVRRVVEDTMRNVH 195
           RF+ KRR RLVG  G  +  + L  KC +  Q N        + ++  R        N+H
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYQ-----------IKELMIKRELAKRPELAEEDWSRF 223
            IY            I+ L   R+    P+ +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

>Smik_4.412 Chr4 (748318..749838) [1521 bp, 506 aa] {ON} YDR168W
           (REAL)
          Length = 506

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 92  AIILRARDLIKLLARSVPFAQAVKILEEDVACDVIKIGNVVANKERFVKRRQRLV-GPNG 150
           AI+ +  D I  +   +P A+A KILE     D+I I  ++ N++ F   + + V G + 
Sbjct: 418 AIMTKNLDNINKVFEDIPIAEAEKILEVFNDIDIIGIKAILENEKDFQSLKDQYVQGHDD 477

Query: 151 NTLKALEL 158
            T++ L L
Sbjct: 478 ATIEGLAL 485

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTL+ L+  +KC I ++G
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG 174

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,789,420
Number of extensions: 1194488
Number of successful extensions: 2892
Number of sequences better than 10.0: 49
Number of HSP's gapped: 2924
Number of HSP's successfully gapped: 49
Length of query: 350
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 240
Effective length of database: 40,868,139
Effective search space: 9808353360
Effective search space used: 9808353360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)