Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C069501.7ON1111115558e-75
ZYRO0F18436g1.7ON112931461e-12
YCL058W-A (ADF1)1.7ON1131011452e-12
TBLA0A049501.7ON1131111339e-11
TPHA0E039901.7ON1161111331e-10
Suva_3.1541.7ON113991321e-10
Smik_3.161.7ON1131031261e-09
Skud_3.51.7ON1131011261e-09
NCAS0B090901.7ON1191121182e-08
SAKL0C00506g1.7ON1051081155e-08
Kpol_2002.101.7ON111911061e-06
NDAI0A001601.7ON123107931e-04
CAGL0B00374g1.7ON12189912e-04
KNAG0C002401.7ON126111903e-04
Kwal_YGOB_YCL058W-A1.7ON105111893e-04
Kwal_33.13015singletonOFF105111893e-04
KAFR0D001601.7ON11197850.001
KLTH0F00528g1.7ON104100830.002
KLLA0C00528g1.7ON11678790.008
YKR050W (TRK2)1.224ON88984661.1
KLLA0C03674g3.101ON70887632.4
TBLA0E046004.313ON60994633.2
AFR743CA1.7ON10187594.8
YDR369C (XRS2)5.435ON85443615.0
NDAI0C051108.467ON56136607.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C06950
         (111 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...   218   8e-75
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    61   1e-12
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    60   2e-12
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    56   9e-11
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    56   1e-10
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    55   1e-10
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    53   1e-09
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    53   1e-09
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    50   2e-08
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    49   5e-08
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    45   1e-06
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    40   1e-04
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    40   2e-04
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    39   3e-04
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    39   3e-04
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    39   3e-04
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    37   0.001
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    37   0.002
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    35   0.008
YKR050W Chr11 (527815..530484) [2670 bp, 889 aa] {ON}  TRK2Compo...    30   1.1  
KLLA0C03674g Chr3 complement(335163..337289) [2127 bp, 708 aa] {...    29   2.4  
TBLA0E04600 Chr5 complement(1170035..1171864) [1830 bp, 609 aa] ...    29   3.2  
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    27   4.8  
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...    28   5.0  
NDAI0C05110 Chr3 (1189386..1191071) [1686 bp, 561 aa] {ON} Anc_8...    28   7.2  

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score =  218 bits (555), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 111/111 (100%), Positives = 111/111 (100%)

Query: 1   MAVKNNFKKTGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVK 60
           MAVKNNFKKTGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVK
Sbjct: 1   MAVKNNFKKTGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVK 60

Query: 61  GSARKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
           GSARKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL
Sbjct: 61  GSARKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 60.8 bits (146), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 60/93 (64%), Gaps = 1/93 (1%)

Query: 19  KNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLENRTLQKDW 78
           K  KK+IS  D K+TK +VE L+      SEI KLN S A   ++  +++L  R L++D 
Sbjct: 21  KKPKKSISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRS-ASSKTSNGSSSLLARNLEQDR 79

Query: 79  QKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
           + DQ  R+K+ A+K+E  NN+ +QIE ISGFSL
Sbjct: 80  KMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 60.5 bits (145), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 60/101 (59%), Gaps = 5/101 (4%)

Query: 11  GKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLE 70
           GK VQK     K++IS  + K+TK +VE LN+ + ++   +   AST      +   TL+
Sbjct: 18  GKKVQK-----KRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQEPAKLKAETTLK 72

Query: 71  NRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
              L KD +KD K+RE+ + EK +  +++ KQIE ISGFSL
Sbjct: 73  AEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 55.8 bits (133), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 66/111 (59%), Gaps = 3/111 (2%)

Query: 2   AVKNNFKKTGKGVQKNQKNCKK-AISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVK 60
            V++  KK+GK   +     K   IS  D K+ K +VE +N+  + LS+II LN  +  K
Sbjct: 5   TVRSKLKKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKS--K 62

Query: 61  GSARKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
             A+  NTL ++ L+KD +KD+ +  + K +K++  ++L  QIE ISGFSL
Sbjct: 63  ELAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 55.8 bits (133), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 5/111 (4%)

Query: 3   VKNNFKKTGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGS 62
           +K +F+  GK V K++KN K  +S +  K TK +VE LN+     S+ I  NA  A+ G 
Sbjct: 9   IKKSFRNNGKNV-KDRKNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDI--NALNALNGK 65

Query: 63  ARKANT--LENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
            R+  T  LE +TL KD  KD+++ EK +++K+E   +L +QIE +SGFSL
Sbjct: 66  KREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 55.5 bits (132), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 58/99 (58%), Gaps = 1/99 (1%)

Query: 13  GVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLENR 72
           GV K Q+  K+ IS  ++K+TK +VE LN+ + ++   +   AS       +  +TLE  
Sbjct: 16  GVGKKQQK-KRPISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTRSTLEAE 74

Query: 73  TLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
            L KD  +D K+RE  + EK +  +++ KQIE ISGFSL
Sbjct: 75  ELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 53.1 bits (126), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 61/103 (59%), Gaps = 7/103 (6%)

Query: 10  TGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKA-NT 68
            GK VQK     +++IS    K+TK +VE LN+ +  +   + L  + A + + RK  +T
Sbjct: 17  VGKKVQK-----RRSISTAVKKRTKLQVEKLNKSSEMMIPTL-LRETGAQEPAKRKTEST 70

Query: 69  LENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
           L+   L KD +KD K+RE  + EK +  +N+ KQIE ISGFSL
Sbjct: 71  LKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 53.1 bits (126), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 57/101 (56%), Gaps = 5/101 (4%)

Query: 11  GKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLE 70
           GK VQK     K+ IS  + K+TK +VE LN+ +  +   +    +T      R  +TL+
Sbjct: 18  GKKVQK-----KRPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKSTLK 72

Query: 71  NRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
              L KD  KD K+RE+ + EK +  +++ +QIE ISGFSL
Sbjct: 73  AEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 50.1 bits (118), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 62/112 (55%), Gaps = 5/112 (4%)

Query: 2   AVKNNFKKTGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLS-EIIKLNASTAV- 59
           A  NN  KTGK   K  KN   +IS  D KK K +VE LN+    L   ++ L     + 
Sbjct: 11  AATNNRNKTGKNQVKKNKN---SISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLS 67

Query: 60  KGSARKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
           K      + L  R+L +D +KD++IR K +AE++   +++EKQIE ISGF+ 
Sbjct: 68  KKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 48.9 bits (115), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 62/108 (57%), Gaps = 15/108 (13%)

Query: 5   NNFKKTGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNA-STAVKGSA 63
           N  KK   G++K+QK           K+T+ +VE LN+    LS++   NA ST  K   
Sbjct: 12  NGSKKPSGGIKKSQK-----------KRTRIQVEQLNKQEFLLSDLNMTNAGSTKTK--- 57

Query: 64  RKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
            K  TL+ + L +D +KD++ R+K + ++++  +N+  Q+E ISGFSL
Sbjct: 58  EKPKTLQAKALAQDQKKDKETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 45.4 bits (106), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 56/91 (61%), Gaps = 1/91 (1%)

Query: 22  KKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTA-VKGSARKANTLENRTLQKDWQK 80
           K  IS+ + K+ K ++E +N++    S+I++LN  T   +    K   LE++ LQ+D  K
Sbjct: 21  KNVISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVK 80

Query: 81  DQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
           D++   K +A K+E  +++ KQIE ++GFSL
Sbjct: 81  DRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%), Gaps = 7/107 (6%)

Query: 10  TGKGVQK--NQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAV-----KGS 62
           TG+ ++K  N  N    I + D KK K +V   N++++    + +LN+ +       + S
Sbjct: 15  TGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDS 74

Query: 63  ARKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGF 109
            RK ++L    L  D +KD +   + + EK+++ +++ +QIE ISGF
Sbjct: 75  LRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGF 121

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 39.7 bits (91), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 25  ISRRDVKKTKFRVENLNRD--TASLSEIIKLNASTAVKGSARKANTLENRTLQKDWQKDQ 82
           IS  + KK+K     LN+D   A L  I +LN +   +   ++   L+   L KD ++D+
Sbjct: 33  ISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQKRDK 92

Query: 83  KIREKSKAEKEEMANNLEKQIEDISGFSL 111
           K+RE  +    E  +++ KQ+E +SGFSL
Sbjct: 93  KVREHIEKINSETNSDMLKQLELMSGFSL 121

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 39.3 bits (90), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 59/111 (53%), Gaps = 13/111 (11%)

Query: 12  KGVQKNQK-NCKKAISRRDVKKTKFRVENLNRDTASL---------SEIIKLNASTAVKG 61
           K VQK++K    K I   + K+ K +VE LNR T  +         +EI K N    V+G
Sbjct: 18  KRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQE--VEG 75

Query: 62  SARKAN-TLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
             R  + +L+   L +D  KD+ I+E+   +++E   ++  QIE ISGFSL
Sbjct: 76  QNRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 38.9 bits (89), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 56/111 (50%), Gaps = 6/111 (5%)

Query: 1   MAVKNNFKKTGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVK 60
           M +K   KK      +  KN    I +    +TK +VE  N++   +SE   LN     K
Sbjct: 1   MGLKGPSKKLPTSKPRGSKNV---IKKHQKIRTKLKVEQANKEVFLISE---LNKREDTK 54

Query: 61  GSARKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
             +    +L+   L KD +KDQ  +++ +++++    N+ +Q+E ISGFSL
Sbjct: 55  RQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 38.9 bits (89), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 56/111 (50%), Gaps = 6/111 (5%)

Query: 1   MAVKNNFKKTGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVK 60
           M +K   KK      +  KN    I +    +TK +VE  N++   +SE   LN     K
Sbjct: 1   MGLKGPSKKLPTSKPRGSKNV---IKKHQKIRTKLKVEQANKEVFLISE---LNKREDTK 54

Query: 61  GSARKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
             +    +L+   L KD +KDQ  +++ +++++    N+ +Q+E ISGFSL
Sbjct: 55  RQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 37.4 bits (85), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 54/97 (55%), Gaps = 8/97 (8%)

Query: 19  KNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKA----NTLENRTL 74
           K+ K  IS+ + KK K  VE  N+ T  ++ + +LN    +K   R+     N LE + L
Sbjct: 19  KSRKNVISQSERKKNKLIVEKFNQQT--ITNVQELNKD--LKKDKRRLSKTKNALETKKL 74

Query: 75  QKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
             D  +D ++++  + + +E  +++ KQIE ISGFSL
Sbjct: 75  LHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 36.6 bits (83), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 13/100 (13%)

Query: 22  KKAISRRDVKK----------TKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLEN 71
           KK  S RDV K          TK +VE  N+++  +SE   LN             +L+ 
Sbjct: 8   KKPRSTRDVSKGVIRKHQKIRTKLKVEQANKESFLISE---LNEREHNTKRTPALESLKV 64

Query: 72  RTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111
             L +D +KD+ +++K + +K+   NN+ +Q+E ISGFSL
Sbjct: 65  SDLIEDREKDKSMQKKMEEQKQSTDNNIIEQLELISGFSL 104

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 35.0 bits (79), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 46/78 (58%), Gaps = 4/78 (5%)

Query: 34  KFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLENRTLQKDWQKDQKIREKSKAEKE 93
           + +V  L++   S+++I+   A    + SA    +LE + +++ +++D+++ +K   EK+
Sbjct: 43  QMQVRQLDKLDLSIADIVPNKAQKKPRSSA----SLEGQKVREHYKEDKEVVKKHDKEKK 98

Query: 94  EMANNLEKQIEDISGFSL 111
                +E Q+E ISGFSL
Sbjct: 99  ATEKKIEDQLELISGFSL 116

>YKR050W Chr11 (527815..530484) [2670 bp, 889 aa] {ON}
           TRK2Component of the Trk1p-Trk2p potassium transport
           system
          Length = 889

 Score = 30.0 bits (66), Expect = 1.1,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 12/84 (14%)

Query: 23  KAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVK------------GSARKANTLE 70
           K +SR D +++   V   + DT++LS I  LN S++ +             S R+ + ++
Sbjct: 185 KFVSREDPRQSASDVPMDSPDTSALSSISPLNVSSSKEESSDTQSSPPNFSSKRQPSDVD 244

Query: 71  NRTLQKDWQKDQKIREKSKAEKEE 94
            R + K     QK +EKS A   +
Sbjct: 245 PRDIYKSIMMLQKQQEKSNANSTD 268

>KLLA0C03674g Chr3 complement(335163..337289) [2127 bp, 708 aa] {ON}
           similar to uniprot|Q05379 Saccharomyces cerevisiae
           YOL095C HMI1 Mitochondrial inner membrane localized ATP-
           dependent DNA helicase required for the maintenance of
           the mitochondrial genome not required for mitochondrial
           transcription,
          Length = 708

 Score = 28.9 bits (63), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 7/87 (8%)

Query: 4   KNNFKKTGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEI-IKLNASTAVKGS 62
           +N  +K   GV   + NC++ I   D   ++  +  L   +A LS+I I    ++  K  
Sbjct: 311 ENIVEKHPSGVYPIKYNCEELIDELDFIVSE--ICQLVCSSAKLSDIGILARTNSHSKAI 368

Query: 63  ARKANTL----ENRTLQKDWQKDQKIR 85
           A   +T        T Q DW  DQ+IR
Sbjct: 369 ADHLSTFGIPVSKLTTQPDWMSDQRIR 395

>TBLA0E04600 Chr5 complement(1170035..1171864) [1830 bp, 609 aa]
           {ON} Anc_4.313 YLR433C
          Length = 609

 Score = 28.9 bits (63), Expect = 3.2,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 4/94 (4%)

Query: 17  NQKNCKKAISRR--DVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLENRTL 74
           + KN ++A+  +   + K       L  ++  +  +  +N     KG+    +T  N TL
Sbjct: 506 DDKNRRRALRNKILAIAKVSRMYSVLREESDKVQHLKAMNQGVLPKGALAHGSTSLNETL 565

Query: 75  Q--KDWQKDQKIREKSKAEKEEMANNLEKQIEDI 106
              +  ++D +I E+     EEM    EK  EDI
Sbjct: 566 SAFERAKRDDRINERLPPSIEEMQKEQEKYFEDI 599

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 27.3 bits (59), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 25  ISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLENRTLQKDWQKDQKI 84
           IS+ D K+ K +VE L++            A       A K   L+  +L +D + D + 
Sbjct: 22  ISKADKKRAKLQVEKLDKRGVL-------LAELTAAAPAAKTGVLQAASLAQDQRSDAQA 74

Query: 85  REKSKAEKEEMANNLEKQIEDISGFSL 111
           +++   E+  +   + +Q+E I+GFSL
Sbjct: 75  QQQRAQERSNVDKKVVQQLEAIAGFSL 101

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score = 28.1 bits (61), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 6/43 (13%)

Query: 62  SARKANTLENRTLQKDWQKDQ------KIREKSKAEKEEMANN 98
           ++R     EN  ++ +W K +      K+R KSKA KEE  NN
Sbjct: 618 TSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNN 660

>NDAI0C05110 Chr3 (1189386..1191071) [1686 bp, 561 aa] {ON}
           Anc_8.467
          Length = 561

 Score = 27.7 bits (60), Expect = 7.2,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 65  KANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLE 100
           K + L N+ + K+W+ D+KI  + KA+K  ++ NL+
Sbjct: 12  KRSQLYNK-IPKEWRFDEKILNRLKADKTSLSKNLD 46

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.121    0.313 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,901,135
Number of extensions: 392890
Number of successful extensions: 3673
Number of sequences better than 10.0: 323
Number of HSP's gapped: 3620
Number of HSP's successfully gapped: 336
Length of query: 111
Length of database: 53,481,399
Length adjustment: 81
Effective length of query: 30
Effective length of database: 44,193,453
Effective search space: 1325803590
Effective search space used: 1325803590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 59 (27.3 bits)