Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C069401.8ON86863224e-40
Ecym_10101.8ON82792686e-32
AFR743W1.8ON82812661e-31
SAKL0C00528g1.8ON110862621e-30
KLTH0F00550g1.8ON82862555e-30
Kpol_2002.111.8ON86822557e-30
ZYRO0F18414g1.8ON87762522e-29
CAGL0B00396g1.8ON88842462e-28
TPHA0E039801.8ON86862426e-28
Kwal_33.130161.8ON82792357e-27
TBLA0A049601.8ON96732323e-26
NDAI0A001701.8ON96782314e-26
NCAS0B090801.8ON93712305e-26
KNAG0C002501.8ON94852281e-25
Smik_3.171.8ON97962244e-25
YCL057C-A (MOS1)1.8ON97962245e-25
KAFR0D001701.8ON90892236e-25
Skud_3.61.8ON97982175e-24
KLLA0C00550g1.8ON82862166e-24
Suva_3.1551.8ON97962115e-23
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C06940
         (86 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   128   4e-40
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   107   6e-32
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   107   1e-31
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   105   1e-30
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   102   5e-30
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   102   7e-30
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   101   2e-29
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...    99   2e-28
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...    98   6e-28
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...    95   7e-27
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...    94   3e-26
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...    94   4e-26
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...    93   5e-26
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...    92   1e-25
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...    91   4e-25
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...    91   5e-25
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...    91   6e-25
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...    88   5e-24
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...    88   6e-24
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...    86   5e-23

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  128 bits (322), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 67/86 (77%), Positives = 67/86 (77%)

Query: 1  MSEKSQAQLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGI 60
          MSEKSQAQLQVAAPSRSILNDKWDVVLSNM                   KRRAFPVWLGI
Sbjct: 1  MSEKSQAQLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGI 60

Query: 61 GFGLGRGYAEGDAIFRSAAGLRSVKA 86
          GFGLGRGYAEGDAIFRSAAGLRSVKA
Sbjct: 61 GFGLGRGYAEGDAIFRSAAGLRSVKA 86

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  107 bits (268), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 59/79 (74%)

Query: 8  QLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGIGFGLGRG 67
          +L+VAAPSRSILNDKWDVVLSN+                   KRRAFPVWLGIGFGLGRG
Sbjct: 4  KLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRG 63

Query: 68 YAEGDAIFRSAAGLRSVKA 86
          YAEGDAIFRS AGLR++KA
Sbjct: 64 YAEGDAIFRSHAGLRTMKA 82

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  107 bits (266), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 59/81 (72%)

Query: 6  QAQLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGIGFGLG 65
            QL+V+APSRSILNDKWDVVLSN+                   KRRAFPVWLG+GFGLG
Sbjct: 2  SGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLG 61

Query: 66 RGYAEGDAIFRSAAGLRSVKA 86
          RGYAEGDAIFRS AGLR+V+A
Sbjct: 62 RGYAEGDAIFRSHAGLRAVRA 82

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  105 bits (262), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 54/86 (62%), Positives = 61/86 (70%), Gaps = 4/86 (4%)

Query: 1   MSEKSQAQLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGI 60
           MSE    QLQV+ P++SILNDKWDVVLSN+                   KRRAFPVWLG+
Sbjct: 29  MSE----QLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGV 84

Query: 61  GFGLGRGYAEGDAIFRSAAGLRSVKA 86
           GFGLGRGYAEGDAIFRS+AGLR+V A
Sbjct: 85  GFGLGRGYAEGDAIFRSSAGLRTVNA 110

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  102 bits (255), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 53/86 (61%), Positives = 61/86 (70%), Gaps = 4/86 (4%)

Query: 1  MSEKSQAQLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGI 60
          MSE    QL+V+  SRS+LNDKWDVVLSN+                   KRRAFPVW+G+
Sbjct: 1  MSE----QLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGV 56

Query: 61 GFGLGRGYAEGDAIFRSAAGLRSVKA 86
          GFGLGRGYAEGDAIFRS+AGLR+VKA
Sbjct: 57 GFGLGRGYAEGDAIFRSSAGLRTVKA 82

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  102 bits (255), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 57/82 (69%)

Query: 1  MSEKSQAQLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGI 60
          MS++SQ     +AP+RSILNDKWDVVLSN                    KRRAFPVWLGI
Sbjct: 1  MSQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI 60

Query: 61 GFGLGRGYAEGDAIFRSAAGLR 82
          GFG+GRGY+EGDAIFRSAAGLR
Sbjct: 61 GFGIGRGYSEGDAIFRSAAGLR 82

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  101 bits (252), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 55/76 (72%)

Query: 11 VAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGIGFGLGRGYAE 70
          V AP++SILNDKWDVVLSN+                   KRRAFPVWLGIGFGLGRGYAE
Sbjct: 12 VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAE 71

Query: 71 GDAIFRSAAGLRSVKA 86
          GDAIFRSAAGLR+ KA
Sbjct: 72 GDAIFRSAAGLRTSKA 87

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score = 99.4 bits (246), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 56/84 (66%)

Query: 3  EKSQAQLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGIGF 62
          E+++A+     P RSILNDKWDVVLSNM                   KRR+FPVWLG+GF
Sbjct: 5  EETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGF 64

Query: 63 GLGRGYAEGDAIFRSAAGLRSVKA 86
          G GRGY+EGDAIFRS AGLRSVK 
Sbjct: 65 GAGRGYSEGDAIFRSTAGLRSVKV 88

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score = 97.8 bits (242), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 60/86 (69%), Gaps = 2/86 (2%)

Query: 1  MSE-KSQAQLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLG 59
          MSE K+   L++ +P +SILNDKWDVVLSNM                   KRRAFPVWLG
Sbjct: 1  MSEQKNNNNLELTSP-KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLG 59

Query: 60 IGFGLGRGYAEGDAIFRSAAGLRSVK 85
          IGFG+GRGY++GDAIFRSAAGLRS +
Sbjct: 60 IGFGVGRGYSDGDAIFRSAAGLRSTR 85

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score = 95.1 bits (235), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (70%)

Query: 8  QLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGIGFGLGRG 67
          Q ++A  SRS+LNDKWDVVLSN+                   KRRA PVW+G+GFGLGRG
Sbjct: 4  QAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRG 63

Query: 68 YAEGDAIFRSAAGLRSVKA 86
          Y+EGDAIFRS+AGLR+VKA
Sbjct: 64 YSEGDAIFRSSAGLRTVKA 82

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score = 94.0 bits (232), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 50/73 (68%)

Query: 13 APSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGIGFGLGRGYAEGD 72
            +RSILNDKWD+V+SNM                   KRRAFPVWLG+GFGLGRGY+EGD
Sbjct: 23 TSNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGD 82

Query: 73 AIFRSAAGLRSVK 85
          AIFRS AGLRS +
Sbjct: 83 AIFRSTAGLRSFQ 95

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score = 93.6 bits (231), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 46/78 (58%), Positives = 51/78 (65%)

Query: 8  QLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGIGFGLGRG 67
          Q Q+A   +SILNDKWD+VLSN                    KRR FPVWLGIGFG GRG
Sbjct: 18 QQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFKRRTFPVWLGIGFGAGRG 77

Query: 68 YAEGDAIFRSAAGLRSVK 85
          YAEGDAIFRS+AG+RSV 
Sbjct: 78 YAEGDAIFRSSAGIRSVN 95

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score = 93.2 bits (230), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 46/71 (64%), Positives = 48/71 (67%)

Query: 16 RSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGIGFGLGRGYAEGDAIF 75
          RSILNDKWDVVLSNM                   KRR FPVWLGIGFG+GRGYAEGDAIF
Sbjct: 23 RSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGDAIF 82

Query: 76 RSAAGLRSVKA 86
          RS AGLR+ K 
Sbjct: 83 RSPAGLRTAKV 93

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score = 92.4 bits (228), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 45/85 (52%), Positives = 55/85 (64%), Gaps = 1/85 (1%)

Query: 2  SEKSQAQLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGIG 61
          ++ +  QL      RS+LNDKWDVVLSNM                   +RRAFPVWLGIG
Sbjct: 11 TQNNNGQLATKI-DRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIG 69

Query: 62 FGLGRGYAEGDAIFRSAAGLRSVKA 86
          FG+GRGY+EGDAIFRS +G+R+VK 
Sbjct: 70 FGVGRGYSEGDAIFRSTSGIRTVKV 94

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score = 90.9 bits (224), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 59/96 (61%), Gaps = 11/96 (11%)

Query: 1  MSEKSQAQLQV-AAPSR----------SILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXX 49
          MSE++QAQ      PS+          ++L+ KWD+VLSNM                   
Sbjct: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 50 KRRAFPVWLGIGFGLGRGYAEGDAIFRSAAGLRSVK 85
          KRRAFPVWLGIGFG+GRGYAEGDAIFRS+AGLRS K
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score = 90.9 bits (224), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 59/96 (61%), Gaps = 11/96 (11%)

Query: 1  MSEKSQAQLQV-AAPSR----------SILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXX 49
          MSE++Q Q    + PS+          +IL+ KWD+VLSNM                   
Sbjct: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 50 KRRAFPVWLGIGFGLGRGYAEGDAIFRSAAGLRSVK 85
          KRRAFPVWLGIGFG+GRGYAEGDAIFRS+AGLRS K
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score = 90.5 bits (223), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 56/89 (62%), Gaps = 4/89 (4%)

Query: 1  MSEKSQ----AQLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPV 56
          MSE+ +    A+    +  RSILNDKWD+VLSNM                   KRRAFPV
Sbjct: 1  MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPV 60

Query: 57 WLGIGFGLGRGYAEGDAIFRSAAGLRSVK 85
          WLGIG+G GR Y+EGDAIFRS AGLRSV+
Sbjct: 61 WLGIGYGFGRAYSEGDAIFRSNAGLRSVQ 89

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score = 88.2 bits (217), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 58/98 (59%), Gaps = 15/98 (15%)

Query: 1  MSEKSQAQLQVAAPSRS-------------ILNDKWDVVLSNMXXXXXXXXXXXXXXXXX 47
          MSE  QA+LQ  A S S             IL+ KWD+V+SNM                 
Sbjct: 1  MSE--QAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVL 58

Query: 48 XXKRRAFPVWLGIGFGLGRGYAEGDAIFRSAAGLRSVK 85
            KRRAFPVWLGIGFG+GRGYAEGDAIFRS+AGLRS K
Sbjct: 59 FFKRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score = 87.8 bits (216), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 48/86 (55%), Positives = 54/86 (62%), Gaps = 4/86 (4%)

Query: 1  MSEKSQAQLQVAAPSRSILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXXKRRAFPVWLGI 60
          MSE  Q Q   A PS  IL+ +WDVVLSN+                   KRRAFPVW+G+
Sbjct: 1  MSE--QVQTTKAVPS--ILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGV 56

Query: 61 GFGLGRGYAEGDAIFRSAAGLRSVKA 86
          GFGLGRGYAEGDAIFR+ AGLR V A
Sbjct: 57 GFGLGRGYAEGDAIFRTNAGLRKVNA 82

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score = 85.9 bits (211), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 57/96 (59%), Gaps = 11/96 (11%)

Query: 1  MSEKSQAQLQV-AAPSR----------SILNDKWDVVLSNMXXXXXXXXXXXXXXXXXXX 49
          MSE++QA     + PS           ++L+ KWD+VLSNM                   
Sbjct: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60

Query: 50 KRRAFPVWLGIGFGLGRGYAEGDAIFRSAAGLRSVK 85
          KRRAFP WLGIGFG+GRGYAEGDAIFRS+AGLRS K
Sbjct: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,466,889
Number of extensions: 101454
Number of successful extensions: 255
Number of sequences better than 10.0: 20
Number of HSP's gapped: 236
Number of HSP's successfully gapped: 20
Length of query: 86
Length of database: 53,481,399
Length adjustment: 58
Effective length of query: 28
Effective length of database: 46,830,771
Effective search space: 1311261588
Effective search space used: 1311261588
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)