Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C069301.10ON1841849491e-132
ZYRO0F18370g1.10ON2201924644e-58
SAKL0C00572g1.10ON3381653971e-46
NDAI0A001901.10ON1711603622e-43
NCAS0B090601.10ON1671663501e-41
KNAG0C002701.10ON1741723413e-40
KAFR0D001901.10ON1851643302e-38
KLLA0C00594g1.10ON1941703173e-36
TPHA0E039601.10ON1771743005e-34
Kwal_33.130231.10ON1931682972e-33
KLTH0F00572g1.10ON1951822591e-27
Kpol_2002.131.10ON1641571681e-14
TBLA0A049701.10ON181541682e-14
Ecym_10121.10ON1771491664e-14
YCL056C (PEX34)1.10ON144159972e-04
Skud_3.81.10ON144142880.002
Suva_3.1571.10ON144141880.002
Smik_3.191.10ON144149820.013
TPHA0J009601.344ON622148770.14
TPHA0H030807.5ON61057672.5
NCAS0A024504.238ON192869664.3
Suva_14.1642.78ON30885654.4
TDEL0C010708.78ON121988664.5
Suva_4.1914.238ON178252646.4
YLR320W (MMS22)4.136ON145433638.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C06930
         (184 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....   370   e-132
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...   183   4e-58
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...   157   1e-46
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...   144   2e-43
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....   139   1e-41
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...   135   3e-40
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...   131   2e-38
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...   126   3e-36
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...   120   5e-34
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...   119   2e-33
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...   104   1e-27
Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...    69   1e-14
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    69   2e-14
Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...    69   4e-14
YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}  PEX...    42   2e-04
Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON} YCL...    39   0.002
Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}...    39   0.002
Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON} YC...    36   0.013
TPHA0J00960 Chr10 (224833..226701) [1869 bp, 622 aa] {ON} Anc_1....    34   0.14 
TPHA0H03080 Chr8 complement(733373..735205) [1833 bp, 610 aa] {O...    30   2.5  
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    30   4.3  
Suva_14.164 Chr14 complement(299978..300904) [927 bp, 308 aa] {O...    30   4.4  
TDEL0C01070 Chr3 complement(180176..183835) [3660 bp, 1219 aa] {...    30   4.5  
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    29   6.4  
YLR320W Chr12 (771940..776304) [4365 bp, 1454 aa] {ON}  MMS22Sub...    29   8.7  

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score =  370 bits (949), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 184/184 (100%), Positives = 184/184 (100%)

Query: 1   MTSGNSSPSSLGKPTGGSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLN 60
           MTSGNSSPSSLGKPTGGSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLN
Sbjct: 1   MTSGNSSPSSLGKPTGGSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLN 60

Query: 61  KGGWGSKLWFVTLLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLM 120
           KGGWGSKLWFVTLLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLM
Sbjct: 61  KGGWGSKLWFVTLLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLM 120

Query: 121 LQKSNAMMRETLLDLLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGFS 180
           LQKSNAMMRETLLDLLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGFS
Sbjct: 121 LQKSNAMMRETLLDLLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGFS 180

Query: 181 SVDV 184
           SVDV
Sbjct: 181 SVDV 184

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score =  183 bits (464), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 129/192 (67%), Gaps = 11/192 (5%)

Query: 4   GNSSPSSLGKPTGGSKT----------SFEDNLIAGLESVCSFFDNVYFAKSLGIIGENN 53
            N  P  +  P  GS+           +FED LIAGLES+C  FDNVY  K+LGII E+N
Sbjct: 29  ANEYPDKIDSPAPGSEVPSPDPNGHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDN 88

Query: 54  FLYRRLNKGGWGSKLWFVTLLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNG-KGLMNDV 112
            LYRRLNKG WGSKLWFVTLLLS RK   ++ +I++ + +LK E+K +   G + L+  V
Sbjct: 89  LLYRRLNKGEWGSKLWFVTLLLSARKSFSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQV 148

Query: 113 LKEKILLMLQKSNAMMRETLLDLLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIM 172
           L+ K    L+K + ++++ +L+LLQ   YL IVVI+VFK+N+ ++  +ILEPLS+F+ ++
Sbjct: 149 LRNKFTDALKKCSIIIKDVVLELLQTLAYLAIVVIEVFKINVSQKVIKILEPLSHFIAVI 208

Query: 173 RFFTMGFSSVDV 184
           R FT G++++ V
Sbjct: 209 RIFTTGYTTLTV 220

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score =  157 bits (397), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 77/165 (46%), Positives = 110/165 (66%)

Query: 20  TSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRK 79
            SFED LI GLES+ + FD+VY  K+ GIIGE NF+YR LNKGG GSKLW  TL+LS+RK
Sbjct: 174 ASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRK 233

Query: 80  CLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLLQNS 139
            L Q+F++ R R  L+ E +            ++ +K    + + +  +++ LLD+LQN 
Sbjct: 234 SLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQNL 293

Query: 140 VYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGFSSVDV 184
            YL++V +DVFKL +P R R++LE +S+ VT+ RFF  GFS++ V
Sbjct: 294 AYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGFSTIAV 338

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
           Anc_1.10 YCL056C
          Length = 171

 Score =  144 bits (362), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 109/160 (68%), Gaps = 2/160 (1%)

Query: 19  KTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVR 78
           + + ED++I GLE +C+ FDNVY  KSLGII ENN LYR LNKG +GSK+WFVTL+L+ R
Sbjct: 2   RRTMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTR 61

Query: 79  KCLRQIFQIVRNRIRLKTEIKGMDK--NGKGLMNDVLKEKILLMLQKSNAMMRETLLDLL 136
           K + Q+ + V+ RIRL  E K   +    + L++ VL EK+ + ++K ++M+ + LL+L 
Sbjct: 62  KLVHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELF 121

Query: 137 QNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFT 176
           Q  VYL +V I++FKL    +   +LE LSN + ++R F+
Sbjct: 122 QTLVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMFS 161

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score =  139 bits (350), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 115/166 (69%), Gaps = 3/166 (1%)

Query: 20  TSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRK 79
           T  EDN++  LES+C+ FDNVYF KS+G++ E N LYR LNKG +GSKLWF+TLLLS +K
Sbjct: 2   TGLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKK 61

Query: 80  CLRQIFQIVRNRIRLKTEIKGMDKNG---KGLMNDVLKEKILLMLQKSNAMMRETLLDLL 136
            + ++ + ++ R ++K EI    K     K L+N +L+EK+ L L K   ++R  +L+LL
Sbjct: 62  LITRLTKSLKIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELL 121

Query: 137 QNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGFSSV 182
           Q  +YL I  I+VFK+ +P++ + +LE LSN +TI+R F  G+SS+
Sbjct: 122 QTMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGYSSL 167

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score =  135 bits (341), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 115/172 (66%), Gaps = 8/172 (4%)

Query: 17  GSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLS 76
            +  S+ED L+  LES+CS FDN+Y  KSLGII + NFLYR+LNKG  GSK+WF+TL+LS
Sbjct: 4   AASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILS 63

Query: 77  VRKCLRQIFQIVRNRIRLKTEIKGMDKNGK---GLMNDVLKEKILLMLQKSNAMMRETLL 133
           +RK L+++ ++V+ R +L  EI+ + +  K    L+N+V+  K+   L+K + M+ +T L
Sbjct: 64  IRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFL 123

Query: 134 DLLQNSVYLMIVVIDVFKLNIP---KRARQILEPLSNFVTIMRFFTMGFSSV 182
           DL Q  +YL IV  D F  NIP   K+ ++ L P+SN VTI+R     ++++
Sbjct: 124 DLAQLLIYLFIVSGDCF--NIPPRFKKFKKYLGPMSNVVTILRMLVSVYTTI 173

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score =  131 bits (330), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 72/164 (43%), Positives = 114/164 (69%), Gaps = 8/164 (4%)

Query: 21  SFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRKC 80
           + ED LI  LE +C+ FDN+YF K+LG+I E+NF+Y++LNKG  GSK+W V+L+LS+R+C
Sbjct: 18  TLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRC 77

Query: 81  LRQIFQIVRNRIRLKTEIKGMDK-----NGKGLMNDVLKEKILLMLQKSNAMMRETLLDL 135
            + +  + R R +  TE+  + K     +  GL+N +LK+K+L  LQK N+++R+ LL+ 
Sbjct: 78  FKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDLLLEF 137

Query: 136 LQNSVYLMIVVIDVFKL-NIPKRARQI--LEPLSNFVTIMRFFT 176
           LQ  +YL+IV+I+VFK+ ++ +  + I  LE LSN +T+ R  T
Sbjct: 138 LQVLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRIIT 181

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score =  126 bits (317), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 107/170 (62%)

Query: 10  SLGKPTGGSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLW 69
           SL         S ED LI  L SV SFFD++Y  +S GII + NFLY++LNKG  GSK+W
Sbjct: 21  SLIANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVW 80

Query: 70  FVTLLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMR 129
            V+LLLS+R+ L +++ ++R +++L+ E   +          ++KEKIL    + +  +R
Sbjct: 81  LVSLLLSIRRSLTRLYTLIRLKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIR 140

Query: 130 ETLLDLLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGF 179
              +DLLQ+ +Y++IV ID+FK+N+  + ++ LE +S+  T+++F +  +
Sbjct: 141 SLCMDLLQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLKFVSSSY 190

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score =  120 bits (300), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 112/174 (64%), Gaps = 9/174 (5%)

Query: 8   PSSLGKPTGGSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSK 67
            S +     G++  FE  L+  LES+ + FD V+F +S G+I ENNF YR LN+   GSK
Sbjct: 3   SSDVFSDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSK 62

Query: 68  LWFVTLLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAM 127
           +WFVTL+LS+RK  + I +  +    LKTE+  ++KN     ND+  + IL  +Q +N +
Sbjct: 63  IWFVTLILSIRKLYKNILKSTKLLSLLKTELTKIEKN-----NDLTSDIILQKIQNNNTI 117

Query: 128 MRET----LLDLLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTM 177
           +++     +++L+Q+ +YL+IV +++FK++I K+    LE LSN V++++FFT+
Sbjct: 118 LKKKIKNFIIELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFTL 171

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score =  119 bits (297), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 101/168 (60%)

Query: 15  TGGSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLL 74
           T     + E+  I+G+ESV   FD+++  KS GII E+N++YR+LNK G+ SK+W ++L+
Sbjct: 26  TNKGGEAIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLV 85

Query: 75  LSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLD 134
           LS RKC+R +  +  +R RL+ E      +    +   L +KI L ++  N  +    L+
Sbjct: 86  LSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVNRRLILVALE 145

Query: 135 LLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGFSSV 182
           ++QN  YL+IV  DVF LN+ +R + +LE  S+ +T+++F  +    V
Sbjct: 146 IMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLKFLFLSIYPV 193

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
           conserved hypothetical protein
          Length = 195

 Score =  104 bits (259), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 97/182 (53%), Gaps = 2/182 (1%)

Query: 3   SGNSSPSSLGKPTG--GSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLN 60
           S   S S   KP+   G   + E  L++GLE++   FD++   +S G+IGENN  Y++LN
Sbjct: 12  SKRGSRSCPDKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLN 71

Query: 61  KGGWGSKLWFVTLLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLM 120
           K G+ SK W V+L LS R+    I  +  +R RLK E     +     +  VL  K+   
Sbjct: 72  KSGFCSKAWLVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVLNAKVTAR 131

Query: 121 LQKSNAMMRETLLDLLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGFS 180
           +Q+ N  +    L+L+QN  YL +V  DV    + ++ +++LE +S+   I R    GFS
Sbjct: 132 IQEINQKLILVALELIQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLLFSGFS 191

Query: 181 SV 182
           S+
Sbjct: 192 SL 193

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
           complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score = 69.3 bits (168), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 100/157 (63%), Gaps = 5/157 (3%)

Query: 22  FEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRKCL 81
           +ED ++ GLE +CS FD++YF K+LGII + +FLYR++ +  +  KLW  TLLL ++K +
Sbjct: 6   WEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNFSLKLWLATLLLIIKKLV 65

Query: 82  RQIFQIVRNRIRLKTEIKG-----MDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLL 136
            ++FQ  +    LK E+K       + N    +N +L EK+   + +    ++  LLDL+
Sbjct: 66  VKLFQNYKILRFLKIELKQHINNNNNNNKNNHINSILLEKLNKKINQHYNFIKLNLLDLI 125

Query: 137 QNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMR 173
           QN +Y  IV+I++ KL I K+++ ILE L+N +TI++
Sbjct: 126 QNLLYCAIVIIELLKLKISKKSKFILELLANSITIVK 162

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa]
          {ON} Anc_1.10 YCL056C
          Length = 181

 Score = 69.3 bits (168), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 42/54 (77%)

Query: 25 NLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVR 78
          +++ GLES+CS FDN+YF +S+G+I + N  YR LN+   GSK+W +TL+L++R
Sbjct: 12 DILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
           similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score = 68.6 bits (166), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 81/149 (54%), Gaps = 14/149 (9%)

Query: 15  TGGSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKG--GWGSKLWFVT 72
           T GS T+FED L   L S  +F+D +Y  +S+GII ++N +Y+ L  G    GS+L F  
Sbjct: 26  TNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLF-- 83

Query: 73  LLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETL 132
           LLL  RK   ++ ++VR    LK  +       K   N+  K ++        +++R + 
Sbjct: 84  LLLVARKTFLKLLRLVRLWYALKNVLPPASIKKK--YNET-KSRV------KRSILRLS- 133

Query: 133 LDLLQNSVYLMIVVIDVFKLNIPKRARQI 161
           +DLL   VYL++V+ID+FK  +    R++
Sbjct: 134 VDLLDTLVYLIVVLIDLFKFKVSDSTRKL 162

>YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}
           PEX34Peroxisomal integral membrane protein that
           regulates peroxisome populations; interacts with Pex11p,
           Pex25p, and Pex27p to control both constitutive
           peroxisome division and peroxisome morphology and
           abundance during peroxisome proliferation
          Length = 144

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 74/159 (46%), Gaps = 25/159 (15%)

Query: 18  SKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSV 77
           S     +N+ +G+ S+  FF      ++LG++ +      +L   G   K+W     +SV
Sbjct: 11  SAKDIWENIWSGVSSLLDFFA---VLENLGVVND------KLYVSGLLRKVWLCYSCISV 61

Query: 78  RKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLLQ 137
            KC+ ++ ++ + + ++   + G    G GL+    K+K++   +K N  +R     LLQ
Sbjct: 62  IKCVWKLIKLCKVKFKIDQRLDG---EGNGLV----KDKLINFKKKYNEHIRHITAALLQ 114

Query: 138 NSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFT 176
           +  YLM+++             ++ + LSN +T+ R   
Sbjct: 115 DLSYLMVLIYP---------GTRLFKRLSNIITLCRIIV 144

>Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 69/142 (48%), Gaps = 22/142 (15%)

Query: 32  SVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRKCLRQIFQIVRNR 91
           S  S  D     ++LG++ +  +L       G   K+W     +SV +C+ ++ ++ + +
Sbjct: 22  SASSLLDFFAVLENLGVVDDKLYL------SGILRKVWLCYSWVSVVRCIWKLIKLCKVK 75

Query: 92  IRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLLQNSVYLMIVVIDVFK 151
            ++   +     NG+G  N ++KEK++   +  N  +R+ + +LLQ+  YLM+++     
Sbjct: 76  FKIDERL-----NGQG--NGLIKEKLVNFRKMYNDQIRQIIANLLQDLSYLMVLIYP--- 125

Query: 152 LNIPKRARQILEPLSNFVTIMR 173
                   ++   LSN +T+ R
Sbjct: 126 ------GTRLFRRLSNIMTLCR 141

>Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 69/141 (48%), Gaps = 22/141 (15%)

Query: 33  VCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRKCLRQIFQIVRNRI 92
           V S  D     ++LG++ +  +L       G   K+W     +SV +C+ ++ ++ R + 
Sbjct: 23  VSSLLDFFAVLENLGVVDDKLYL------SGILRKVWLCYSWISVVRCVWKLIKLCRVKF 76

Query: 93  RLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLLQNSVYLMIVVIDVFKL 152
           ++   +     NG+G  N ++KEK++   +  N  +++   +LLQ+  YLM+++      
Sbjct: 77  KINERL-----NGQG--NGLIKEKLINFGKMYNDQIKQITANLLQDLSYLMVLIYP---- 125

Query: 153 NIPKRARQILEPLSNFVTIMR 173
                  ++ + LSN +T+ R
Sbjct: 126 -----GTRLFKRLSNVITLCR 141

>Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 36.2 bits (82), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 71/149 (47%), Gaps = 25/149 (16%)

Query: 25  NLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRKCLRQI 84
           N+  G+ S+  FF      ++LG++ +      +L   G   K+W     +SV KC+ ++
Sbjct: 18  NVWNGVSSLLDFFA---VLENLGVVDD------KLYVSGVLRKVWLCYSWISVIKCVWKL 68

Query: 85  FQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLLQNSVYLMI 144
             + + + ++   +     NG G  N ++KEK++   ++    +R+    LLQ+  YLM+
Sbjct: 69  INLCKVKFKIDQRL-----NGPG--NGLVKEKLMNFKKRYRDQIRQITATLLQDLSYLMV 121

Query: 145 VVIDVFKLNIPKRARQILEPLSNFVTIMR 173
           ++             ++ + LSN +T+ R
Sbjct: 122 LIYP---------GTRLFKRLSNIITLCR 141

>TPHA0J00960 Chr10 (224833..226701) [1869 bp, 622 aa] {ON} Anc_1.344
           YBR259W
          Length = 622

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 68/148 (45%), Gaps = 30/148 (20%)

Query: 24  DNLIAGLESVCS--FFDNVYFAKSLGIIGENN---FLYRRLNKGGWGSKLWFVTLLLSVR 78
           DN I  L+S+ S  F+  + F+    I+ ++N   FL R LN  G  SKL FV   +  +
Sbjct: 144 DNYINSLDSLSSNKFYAIIDFSVEYHILNQDNVDKFLNRSLNVKGLNSKLPFVAEAMMWK 203

Query: 79  KCLRQIFQIVRNRIRLKTEIKGMDKNG----KGLMNDV-------------------LKE 115
           + L +IF+ +  +I L   I     N     KG  ND+                   + +
Sbjct: 204 RRL-EIFEYLY-QINLIPSIYPAYSNYNIIFKGFFNDISLTKLSQHDIGTLLFSGMNIDD 261

Query: 116 KILLMLQKSNAMMRETLLDLLQNSVYLM 143
            ++ +  KS  + ++  +D+L +S+YL+
Sbjct: 262 PLIQLFVKSRCITQDKNIDILLHSIYLI 289

>TPHA0H03080 Chr8 complement(733373..735205) [1833 bp, 610 aa] {ON}
           Anc_7.5 YAL058W
          Length = 610

 Score = 30.4 bits (67), Expect = 2.5,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 9/57 (15%)

Query: 5   NSSPSSLGKPTGGSKTSFEDNLIAGLESVCSFFDNVYFAKSLG---IIGENNFLYRR 58
           +S+PS L +P GG    F         S+   FDN+Y  KS+    +IG   F  +R
Sbjct: 398 DSTPSKLSEPVGGILFEFYSG------SIDLLFDNIYVGKSIKEAEMIGNATFKAKR 448

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
           Anc_4.238 YDL058W
          Length = 1928

 Score = 30.0 bits (66), Expect = 4.3,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 2/69 (2%)

Query: 117 ILLMLQKSNAMMRETLLDLLQNSVYLMIVVIDVFKLNIPKRARQI-LEPLSNFVTIMRFF 175
           + L ++ S+ + ++  L LL+++V LMIV+   F   IPKR R I L   S+ +    F 
Sbjct: 311 VALTVEPSSTVAKKHQLFLLESNV-LMIVLRLAFYPGIPKRVRPIALLTASDMIRNNEFT 369

Query: 176 TMGFSSVDV 184
              F+ +DV
Sbjct: 370 QAAFAKIDV 378

>Suva_14.164 Chr14 complement(299978..300904) [927 bp, 308 aa] {ON}
           YNL177C (REAL)
          Length = 308

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 39/85 (45%), Gaps = 17/85 (20%)

Query: 97  EIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLLQNSVYLMIVVID-------- 148
           E   +D++   L ND L ++ ++ LQ+   +  E+LL  L+  +Y     ++        
Sbjct: 76  EAAEVDRDSITLKNDKLLQQHIISLQQPEKLASESLLSPLKREIYKANCELNNGFYKKDT 135

Query: 149 ---------VFKLNIPKRARQILEP 164
                     +KLN+ K+  ++LEP
Sbjct: 136 IVKLPNSNKRYKLNLTKKEIEVLEP 160

>TDEL0C01070 Chr3 complement(180176..183835) [3660 bp, 1219 aa] {ON}
           Anc_8.78 YPL012W
          Length = 1219

 Score = 30.0 bits (66), Expect = 4.5,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 40/88 (45%)

Query: 84  IFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLLQNSVYLM 143
           ++Q V  R  +    + + ++    +N  L + ILL    S A  +ETL  L   +  L+
Sbjct: 595 LYQKVELRTTICHAFRVLVESNLAYINGALADDILLQQHFSVARAQETLTYLKGKAANLL 654

Query: 144 IVVIDVFKLNIPKRARQILEPLSNFVTI 171
            V+ +V+    P     ILE +  ++ I
Sbjct: 655 AVLFNVYTQTAPNARGYILETIEAYLKI 682

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
           (REAL)
          Length = 1782

 Score = 29.3 bits (64), Expect = 6.4,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 134 DLLQNSVYLMIVVIDVFKLNIPKRARQI-LEPLSNFVTIMRFFTMGFSSVDV 184
           ++L +S  LM+V+   F  NIPKR R I L   +N +    +  + FS +DV
Sbjct: 325 NVLFDSSVLMVVLRLAFFHNIPKRVRPIALLTAANMIRSNEYAQIEFSKIDV 376

>YLR320W Chr12 (771940..776304) [4365 bp, 1454 aa] {ON}
           MMS22Subunit of an E3 ubiquitin ligase complex involved
           in replication repair; stabilizes protein components of
           the replication fork, such as the fork-pausing complex
           and leading strand polymerase, preventing fork collapse
           and promoting efficient recovery during replication
           stress; required for accurate meiotic chromosome
           segregation
          Length = 1454

 Score = 28.9 bits (63), Expect = 8.7,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 133 LDLLQNSVYLMIVVIDVFKLNIPKRARQILEPL 165
           L +L+N + L+IV+   F LN+ KR +++  PL
Sbjct: 896 LSVLKNRLNLLIVLATRFDLNLEKRFQELTRPL 928

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,057,646
Number of extensions: 778332
Number of successful extensions: 2331
Number of sequences better than 10.0: 33
Number of HSP's gapped: 2353
Number of HSP's successfully gapped: 33
Length of query: 184
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 81
Effective length of database: 41,670,801
Effective search space: 3375334881
Effective search space used: 3375334881
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 62 (28.5 bits)