Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C064901.52ON1153115356920.0
ZYRO0F17402g1.52ON1189122033510.0
KAFR0D041001.52ON1117118029830.0
Kpol_2002.461.52ON1123119229750.0
Suva_2.6871.52ON1128116729660.0
NCAS0B086001.52ON1117117929510.0
YDR507C (GIN4)1.52ON1142118729280.0
SAKL0C01716g1.52ON1215122029250.0
Skud_4.7831.52ON1135118429140.0
Smik_4.7891.52ON1136117828990.0
KLTH0F01672g1.52ON1164118628970.0
KNAG0F002901.52ON1125117028580.0
KLLA0C01650g1.52ON1112117328350.0
TPHA0E036401.52ON1137119327380.0
AFR696C1.52ON1142119326170.0
NDAI0A006601.52ON1022117225890.0
CAGL0K05709g1.52ON1103116725740.0
Suva_3.1901.52ON1024115620150.0
Skud_3.391.52ON1017115219400.0
Smik_3.541.52ON1032116519380.0
Ecym_10581.52ON116457918760.0
TBLA0A071501.52ON139153418900.0
YCL024W (KCC4)1.52ON103735714251e-178
Kwal_33.132251.52ON96437311981e-146
Ecym_73922.479ON143443210371e-119
KLLA0F13552g2.479ON126737210271e-119
ABL034W2.479ON142537510341e-119
KLTH0D05566g2.479ON112835510151e-118
SAKL0E02860g2.479ON137742810211e-117
TBLA0I011502.479ON174538510251e-116
Kwal_26.77882.479ON126735510061e-116
KAFR0D032002.479ON144842310081e-115
TDEL0A025502.479ON136940210021e-115
YKL101W (HSL1)2.479ON151838710061e-114
KNAG0A065402.479ON143237610021e-114
Suva_11.1232.479ON152638710001e-114
Skud_11.1262.479ON15183879961e-113
Smik_11.1392.479ON15343879941e-113
NCAS0A057702.479ON14613799841e-112
CAGL0K08514g2.479ON14893859721e-110
Kpol_431.92.479ON15524669611e-108
ZYRO0G03366g2.479ON16163979591e-108
TPHA0G032002.479ON15344298657e-96
NDAI0D027502.479ON15152988471e-93
Kwal_33.13222singletonOFF1481206267e-75
Kpol_1018.655.611ON6014156502e-72
CAGL0M08910g5.611ON6122856502e-72
Smik_4.7545.611ON6323836417e-71
YDR477W (SNF1)5.611ON6333786408e-71
Skud_4.7515.611ON6342886382e-70
Suva_2.6515.611ON6332886382e-70
TDEL0A047805.611ON6212736311e-69
TPHA0C004705.611ON6314366312e-69
KAFR0C058605.611ON6442736312e-69
Ecym_55885.611ON6134426257e-69
KLLA0A03806g5.611ON6022746221e-68
KLTH0G05698g5.611ON5973236202e-68
NCAS0A080805.611ON6232736212e-68
KNAG0B032305.611ON6412786223e-68
TBLA0E033605.611ON6542736224e-68
TPHA0D028405.611ON6342756205e-68
Kpol_495.145.611ON6242736171e-67
SAKL0G06952g5.611ON5992746141e-67
Kwal_47.182335.611ON5982746141e-67
AEL230W5.611ON6082826081e-66
NDAI0H009405.611ON6852766121e-66
ZYRO0A05544g5.611ON6312736054e-66
Kwal_26.87098.654ON8292965323e-55
TPHA0G017108.654ON8052875295e-55
ZYRO0F06842g8.654ON8432965298e-55
KNAG0J015908.654ON8053235261e-54
NDAI0E023208.654ON9323185263e-54
KLTH0D10714g8.654ON8722925245e-54
CAGL0M02519g8.654ON7563045187e-54
TDEL0A060008.654ON7902825198e-54
Suva_16.1698.654ON8582995182e-53
NDAI0E012908.654ON7292965142e-53
Skud_16.1408.654ON8652995173e-53
TBLA0B039708.654ON12083015233e-53
NCAS0C015908.654ON8643065164e-53
Kpol_1072.298.654ON8932905164e-53
YPL141C (FRK1)8.654ON8652995156e-53
NCAS0B014708.654ON7273025097e-53
SAKL0H07084g8.654ON9192955141e-52
Smik_6.3398.654ON8652965112e-52
TPHA0D011408.654ON6222974967e-52
Kpol_1012.68.654ON6282924941e-51
ACR119W8.654ON9313235052e-51
KAFR0A037308.654ON7882925002e-51
CAGL0J03872g8.654ON6612944952e-51
NDAI0J012508.279ON11763345063e-51
KAFR0H025408.654ON8173224984e-51
Smik_15.4178.654ON8062894967e-51
KNAG0A030408.654ON6442924852e-50
Ecym_83398.654ON9202894943e-50
TBLA0C017508.654ON9812914954e-50
Suva_8.2848.654ON8082894871e-49
TPHA0J008208.279ON12182924931e-49
CAGL0M02299g8.668ON8932834881e-49
Skud_15.3998.654ON8072894852e-49
NDAI0B020708.279ON12583464912e-49
Ecym_42918.279ON11452934893e-49
Smik_4.3678.279ON10662834883e-49
YOR233W (KIN4)8.654ON8002894833e-49
AGR058W8.279ON10712904883e-49
NCAS0B037408.279ON10492894874e-49
Suva_2.2838.279ON10892834866e-49
CAGL0M11396g8.279ON11922884841e-48
Skud_4.3838.279ON10652834822e-48
YDR122W (KIN1)8.279ON10642834822e-48
KNAG0G021108.279ON11923034822e-48
SAKL0H16632g8.279ON10622884812e-48
Kpol_1066.468.279ON12252864823e-48
SAKL0H06754g8.668ON8842794773e-48
TBLA0C046008.279ON13152924814e-48
Suva_10.1808.279ON11592884804e-48
KAFR0B028008.279ON10952914761e-47
NCAS0B050908.279ON12103124761e-47
YLR096W (KIN2)8.279ON11472884752e-47
Skud_12.1648.279ON11602884723e-47
TDEL0F040608.279ON11262934715e-47
KLLA0F19536g8.279ON11042924696e-47
KLTH0G13288g8.279ON11422924681e-46
Smik_12.1558.279ON11622884662e-46
CAGL0B01925g8.279ON9442854623e-46
ZYRO0D06776g8.279ON12042834626e-46
KLLA0D07348g8.654ON9092894587e-46
TBLA0B038608.668ON9882834562e-45
NCAS0C016708.668ON8962794523e-45
NDAI0E023908.668ON8832834524e-45
KNAG0H031408.279ON9362834501e-44
TDEL0A061408.668ON8612824481e-44
ACR133C8.668ON8512834462e-44
Kwal_26.87518.668ON8482784434e-44
Skud_16.1328.668ON9242814428e-44
ZYRO0F07194g8.668ON9382944428e-44
KLLA0F11319g8.668ON8432874409e-44
Kpol_1072.198.668ON8962794401e-43
KNAG0J016708.668ON10092774421e-43
YPL150W8.668ON9012824391e-43
Ecym_24058.668ON8552834372e-43
KLTH0H11396g1.374ON4372794183e-43
Suva_16.1608.668ON9182944355e-43
Smik_6.3478.668ON9172824346e-43
TPHA0G016308.668ON8712784338e-43
KLTH0D11044g8.668ON8492744301e-42
SAKL0D07656g1.374ON4322744051e-41
KNAG0I014801.374ON4402794052e-41
NCAS0D006301.374ON4272794006e-41
KNAG0J017008.676ON8202854158e-41
NCAS0A088801.374ON4222793988e-41
NDAI0G053001.374ON4372773991e-40
KLLA0F11143g8.676ON8132784132e-40
Kwal_56.224766.31ON6972294102e-40
Kpol_1069.131.374ON4272793962e-40
KLLA0F23155g1.374ON4272723962e-40
YPL153C (RAD53)8.676ON8213124122e-40
Kwal_0.961.374ON4272753952e-40
KAFR0C044801.374ON4352853953e-40
NCAS0D021006.31ON7262074084e-40
KLTH0D11242g8.676ON7952804085e-40
NDAI0E021108.676ON9032884106e-40
CAGL0F04741g1.374ON4423033936e-40
Kwal_26.87968.676ON7962804077e-40
Skud_16.1298.676ON8273134088e-40
KNAG0D010906.222ON3722793878e-40
TPHA0O011201.374ON4292793911e-39
Smik_6.3508.676ON8223134071e-39
CAGL0M02233g8.676ON7672974051e-39
NDAI0H035201.374ON4582733921e-39
KLTH0C10912g6.31ON6972294031e-39
Suva_16.1578.676ON8323184052e-39
YFR014C (CMK1)1.374ON4462793902e-39
Suva_6.781.374ON4452793883e-39
Skud_15.1441.374ON4492793883e-39
CAGL0K10604g1.374ON4462783884e-39
KAFR0H024308.676ON7842974014e-39
ACL006W6.31ON7082093994e-39
Ecym_30356.31ON7402093995e-39
Suva_15.1551.374ON4522793875e-39
Smik_7.3191.374ON4462793858e-39
YOL016C (CMK2)1.374ON4472793858e-39
TBLA0A020306.214ON4032873829e-39
TBLA0B038408.676ON8582823991e-38
Skud_6.891.374ON4462793831e-38
TDEL0B063201.374ON4442793831e-38
Smik_15.1531.374ON4422793822e-38
SAKL0H06534g8.676ON8042833943e-38
AAR009W1.374ON4532743813e-38
CAGL0L07326g2.352ON5063143843e-38
TDEL0A062208.676ON7942823934e-38
NDAI0C026806.31ON7502073924e-38
SAKL0E01584g6.31ON6952313905e-38
TPHA0J004206.31ON7072353905e-38
Kwal_56.240916.222ON3812143746e-38
Kwal_56.237178.279ON8581893927e-38
ZYRO0E05588g1.374ON4712793798e-38
SAKL0C05368g1.182ON4183173759e-38
Suva_13.1636.31ON7052413889e-38
KLTH0H04180g6.214ON3532713701e-37
Skud_13.1546.31ON7052093871e-37
TBLA0D050101.374ON4342783751e-37
Ecym_12751.374ON4513933761e-37
CAGL0J11638g6.31ON7462083881e-37
TBLA0B004906.31ON7872373881e-37
NCAS0C013708.676ON7992803882e-37
YMR001C (CDC5)6.31ON7052093862e-37
KAFR0F018001.182ON4243153732e-37
Skud_16.766.214ON3822763702e-37
Kpol_1033.506.214ON3842743702e-37
YPL203W (TPK2)6.214ON3802763692e-37
Smik_13.1596.31ON7052093852e-37
NCAS0A011006.214ON3542923672e-37
Smik_6.4086.214ON3812763692e-37
Kpol_1072.168.676ON7952823863e-37
KNAG0D011406.214ON3952763693e-37
ACR142W8.676ON8372863864e-37
Kwal_56.240596.214ON3532713664e-37
KAFR0G026906.31ON7132093834e-37
Kpol_1065.36.222ON3762803675e-37
CAGL0G09020g6.214ON3612713656e-37
TPHA0E028206.222ON3842223667e-37
TPHA0G016008.676ON8452813847e-37
Kpol_1037.206.31ON7042353817e-37
KAFR0I020101.374ON4322793689e-37
KAFR0H025108.668ON8792873821e-36
KNAG0E008506.31ON7112213791e-36
Ecym_23978.676ON8722813811e-36
Suva_16.1046.214ON3832763632e-36
Skud_10.501.182ON3972733642e-36
TPHA0F024306.31ON7982133792e-36
KAFR0K003306.214ON3732943622e-36
SAKL0A04466g6.214ON3732763612e-36
YJL164C (TPK1)1.182ON3973013623e-36
Kpol_1023.266.31ON7392103763e-36
KLLA0C06138g6.31ON7082313753e-36
NDAI0F016006.222ON4122143615e-36
KNAG0C024401.182ON4012843605e-36
Smik_10.661.182ON3973013605e-36
ZYRO0G08844g6.214ON3622763585e-36
NDAI0A009601.182ON4083113606e-36
TBLA0A020506.222ON4342773627e-36
KLLA0B07205g1.182ON4552763637e-36
TDEL0G043806.31ON7222093737e-36
NDAI0F016506.214ON3672763578e-36
Ecym_22036.214ON3522783559e-36
AFL090W6.214ON3462763541e-35
Suva_6.2451.182ON3943013571e-35
KAFR0C042801.336ON5343183642e-35
KAFR0B054108.279ON5392823632e-35
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C06490
         (1153 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...  2197   0.0  
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...  1295   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...  1153   0.0  
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...  1150   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...  1147   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...  1141   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...  1132   0.0  
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...  1131   0.0  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...  1127   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...  1121   0.0  
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...  1120   0.0  
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...  1105   0.0  
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...  1096   0.0  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...  1059   0.0  
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...  1012   0.0  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52   1001   0.0  
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   996   0.0  
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   780   0.0  
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...   751   0.0  
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...   751   0.0  
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   727   0.0  
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   732   0.0  
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...   553   e-178
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   466   e-146
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   404   e-119
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   400   e-119
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   402   e-119
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   395   e-118
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   397   e-117
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   399   e-116
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   392   e-116
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   392   e-115
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   390   e-115
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   392   e-114
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   390   e-114
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   389   e-114
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   388   e-113
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   387   e-113
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   383   e-112
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   379   e-110
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   374   e-108
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   374   e-108
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   337   7e-96
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   330   1e-93
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   245   7e-75
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   254   2e-72
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   254   2e-72
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   251   7e-71
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   251   8e-71
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   250   2e-70
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   250   2e-70
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   247   1e-69
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   247   2e-69
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   247   2e-69
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   245   7e-69
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   244   1e-68
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   243   2e-68
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   243   2e-68
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   244   3e-68
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   244   4e-68
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              243   5e-68
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   242   1e-67
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   241   1e-67
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   241   1e-67
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   238   1e-66
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   240   1e-66
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   237   4e-66
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   209   3e-55
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   208   5e-55
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   208   8e-55
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   207   1e-54
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              207   3e-54
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   206   5e-54
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   204   7e-54
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   204   8e-54
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   204   2e-53
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   202   2e-53
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   203   3e-53
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   206   3e-53
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    203   4e-53
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   203   4e-53
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   202   6e-53
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    200   7e-53
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   202   1e-52
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   201   2e-52
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   195   7e-52
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   194   1e-51
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   199   2e-51
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   197   2e-51
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   195   2e-51
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   199   3e-51
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   196   4e-51
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   195   7e-51
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   191   2e-50
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   194   3e-50
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   195   4e-50
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   192   1e-49
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   194   1e-49
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   192   1e-49
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   191   2e-49
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             193   2e-49
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   192   3e-49
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   192   3e-49
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   190   3e-49
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   192   3e-49
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   192   4e-49
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   191   6e-49
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   191   1e-48
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   190   2e-48
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   190   2e-48
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   190   2e-48
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   189   2e-48
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   190   3e-48
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   188   3e-48
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   189   4e-48
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   189   4e-48
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   187   1e-47
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             187   1e-47
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   187   2e-47
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   186   3e-47
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   186   5e-47
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   185   6e-47
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   184   1e-46
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   184   2e-46
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   182   3e-46
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   182   6e-46
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   181   7e-46
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   180   2e-45
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   178   3e-45
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   178   4e-45
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   177   1e-44
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   177   1e-44
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   176   2e-44
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   175   4e-44
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   174   8e-44
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   174   8e-44
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   174   9e-44
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   174   1e-43
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   174   1e-43
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   173   1e-43
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   172   2e-43
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   165   3e-43
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   172   5e-43
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   171   6e-43
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   171   8e-43
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   170   1e-42
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   160   1e-41
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   160   2e-41
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   158   6e-41
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             164   8e-41
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   157   8e-41
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   158   1e-40
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   163   2e-40
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   162   2e-40
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   157   2e-40
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   157   2e-40
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   163   2e-40
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   156   2e-40
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   156   3e-40
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     161   4e-40
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   161   5e-40
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   162   6e-40
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   155   6e-40
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   161   7e-40
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   161   8e-40
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   153   8e-40
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   155   1e-39
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   161   1e-39
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   160   1e-39
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              155   1e-39
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   159   1e-39
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   160   2e-39
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   154   2e-39
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   154   3e-39
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   154   3e-39
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   154   4e-39
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   159   4e-39
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   158   4e-39
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   158   5e-39
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   153   5e-39
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   152   8e-39
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   152   8e-39
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   151   9e-39
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   158   1e-38
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   152   1e-38
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   152   1e-38
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   151   2e-38
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   156   3e-38
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   151   3e-38
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   152   3e-38
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   155   4e-38
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   155   4e-38
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   154   5e-38
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   154   5e-38
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   148   6e-38
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   155   7e-38
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   150   8e-38
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   149   9e-38
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   154   9e-38
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   147   1e-37
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   153   1e-37
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   149   1e-37
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   149   1e-37
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   154   1e-37
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   154   1e-37
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   154   2e-37
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   153   2e-37
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   148   2e-37
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   147   2e-37
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   147   2e-37
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   146   2e-37
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   152   2e-37
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              145   2e-37
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   146   2e-37
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   153   3e-37
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              146   3e-37
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   153   4e-37
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   145   4e-37
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   152   4e-37
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   145   5e-37
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   145   6e-37
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   145   7e-37
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   152   7e-37
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   151   7e-37
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   146   9e-37
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   151   1e-36
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   150   1e-36
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   151   1e-36
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   144   2e-36
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   144   2e-36
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   150   2e-36
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   144   2e-36
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   143   2e-36
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   144   3e-36
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   149   3e-36
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   149   3e-36
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   143   5e-36
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   143   5e-36
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   143   5e-36
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   142   5e-36
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   143   6e-36
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              144   7e-36
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   144   7e-36
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   148   7e-36
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    142   8e-36
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   141   9e-36
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   140   1e-35
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   142   1e-35
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   144   2e-35
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   144   2e-35
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   143   3e-35
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   146   3e-35
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   146   4e-35
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   139   4e-35
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   140   4e-35
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   140   4e-35
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   140   5e-35
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    139   6e-35
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   141   6e-35
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   140   6e-35
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   142   1e-34
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   142   1e-34
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   139   1e-34
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   139   1e-34
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   138   1e-34
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   139   1e-34
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   145   1e-34
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   141   2e-34
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   137   2e-34
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   140   2e-34
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   138   2e-34
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   137   2e-34
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   140   2e-34
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   137   2e-34
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   137   2e-34
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   144   3e-34
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   138   3e-34
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   137   3e-34
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   140   3e-34
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   144   3e-34
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   136   4e-34
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   144   4e-34
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   137   4e-34
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   140   5e-34
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   138   5e-34
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   139   5e-34
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   136   6e-34
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   137   6e-34
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   137   6e-34
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   138   7e-34
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   136   7e-34
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      137   7e-34
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   137   7e-34
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   137   7e-34
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   139   8e-34
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   142   8e-34
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   136   1e-33
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   135   1e-33
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   140   2e-33
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   142   2e-33
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   134   3e-33
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   135   3e-33
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   135   4e-33
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   137   4e-33
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              137   5e-33
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   135   8e-33
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   139   9e-33
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   139   9e-33
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   137   1e-32
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   139   1e-32
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   138   2e-32
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   135   2e-32
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   135   2e-32
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   138   2e-32
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   138   2e-32
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   138   2e-32
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   131   3e-32
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   138   3e-32
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   137   4e-32
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   134   4e-32
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   133   6e-32
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   137   7e-32
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   133   7e-32
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   134   8e-32
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   133   8e-32
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   133   1e-31
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   136   1e-31
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   129   1e-31
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   132   1e-31
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   135   1e-31
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   135   1e-31
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   132   2e-31
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   135   2e-31
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   132   3e-31
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   135   3e-31
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   131   3e-31
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   135   3e-31
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   135   3e-31
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   133   3e-31
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   128   3e-31
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   132   4e-31
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   134   4e-31
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   134   4e-31
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   131   5e-31
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   127   6e-31
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   130   6e-31
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   134   6e-31
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   132   7e-31
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   133   7e-31
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   132   8e-31
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   134   8e-31
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   133   8e-31
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   133   8e-31
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   133   9e-31
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   128   9e-31
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   133   1e-30
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   133   1e-30
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    132   1e-30
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   133   1e-30
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   131   2e-30
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   131   2e-30
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   130   2e-30
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   130   2e-30
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   131   2e-30
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   131   3e-30
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   130   3e-30
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   131   3e-30
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   131   3e-30
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   131   3e-30
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   132   3e-30
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   130   3e-30
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   131   3e-30
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   128   3e-30
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   128   4e-30
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   131   4e-30
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   131   4e-30
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   130   4e-30
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   130   4e-30
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   131   4e-30
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   131   4e-30
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   130   4e-30
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   130   4e-30
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   130   4e-30
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   130   5e-30
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   126   5e-30
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   130   5e-30
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   131   5e-30
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   130   5e-30
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   131   5e-30
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   129   5e-30
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   127   6e-30
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   129   6e-30
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   127   6e-30
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   127   6e-30
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   128   7e-30
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   130   8e-30
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   130   8e-30
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   130   8e-30
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   130   8e-30
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   129   8e-30
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   128   8e-30
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   129   8e-30
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   129   8e-30
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   128   9e-30
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   129   9e-30
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   129   9e-30
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   130   9e-30
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   129   1e-29
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   128   1e-29
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   127   1e-29
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   129   1e-29
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   127   1e-29
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   129   1e-29
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   130   1e-29
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   129   1e-29
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   127   1e-29
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   129   1e-29
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   128   1e-29
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   128   2e-29
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   129   2e-29
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   128   2e-29
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   129   2e-29
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   126   2e-29
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    129   2e-29
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   129   2e-29
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   129   2e-29
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   126   2e-29
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   127   2e-29
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   124   2e-29
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   124   2e-29
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   128   2e-29
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   128   2e-29
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   128   2e-29
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   129   2e-29
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   127   2e-29
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   128   2e-29
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   128   2e-29
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   128   3e-29
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   128   3e-29
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   124   3e-29
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   126   3e-29
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   127   3e-29
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   127   3e-29
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   125   3e-29
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   128   3e-29
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   128   3e-29
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   127   3e-29
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   127   4e-29
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   127   4e-29
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   127   4e-29
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   127   4e-29
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   127   4e-29
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   126   4e-29
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   126   4e-29
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...   127   4e-29
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   127   4e-29
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   125   5e-29
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   126   5e-29
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   127   5e-29
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   127   6e-29
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   127   6e-29
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             126   6e-29
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   123   6e-29
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   127   6e-29
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   126   7e-29
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   125   7e-29
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   126   7e-29
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   126   7e-29
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   127   7e-29
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   127   8e-29
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   125   9e-29
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   126   1e-28
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   127   1e-28
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   124   1e-28
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   124   1e-28
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   123   1e-28
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   122   1e-28
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   125   1e-28
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   125   1e-28
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   126   1e-28
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...   125   1e-28
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   123   1e-28
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   125   1e-28
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   126   1e-28
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   125   2e-28
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   126   2e-28
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   125   2e-28
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   124   2e-28
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   124   2e-28
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   122   2e-28
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   124   2e-28
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   122   2e-28
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   122   2e-28
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   124   2e-28
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   124   2e-28
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   125   2e-28
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   125   2e-28
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   124   2e-28
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   125   2e-28
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   122   2e-28
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   125   2e-28
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   125   2e-28
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   125   2e-28
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   125   2e-28
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   123   3e-28
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   124   3e-28
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    124   3e-28
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   122   3e-28
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   124   3e-28
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             124   3e-28
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   124   3e-28
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   125   3e-28
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   124   3e-28
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   125   3e-28
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...   125   3e-28
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   124   4e-28
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   124   4e-28
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   123   4e-28
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   124   4e-28
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   124   4e-28
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   124   4e-28
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              124   4e-28
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   124   4e-28
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   124   4e-28
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   124   4e-28
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     125   5e-28
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...   123   5e-28
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   124   5e-28
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   124   5e-28
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   122   5e-28
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   124   5e-28
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   124   5e-28
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   124   5e-28
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   123   6e-28
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   121   6e-28
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   124   6e-28
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   123   6e-28
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   124   6e-28
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   124   6e-28
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   123   7e-28
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   122   7e-28
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   123   7e-28
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   120   7e-28
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   121   8e-28
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   124   8e-28
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   123   8e-28
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   124   8e-28
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...   119   8e-28
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   120   9e-28
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   123   9e-28
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   123   9e-28
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   122   9e-28
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   120   1e-27
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...   119   1e-27
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   123   1e-27
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   122   1e-27
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   120   1e-27
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   120   1e-27
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   123   1e-27
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   120   1e-27
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   123   1e-27
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   123   1e-27
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...   122   1e-27
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   123   1e-27
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   120   1e-27
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   120   1e-27
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   123   1e-27
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   120   1e-27
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   120   2e-27
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   122   2e-27
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   122   2e-27
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   122   2e-27
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   120   2e-27
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   122   2e-27
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   121   2e-27
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...   118   2e-27
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   122   2e-27
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   122   2e-27
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   120   3e-27
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   120   3e-27
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   120   3e-27
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   120   3e-27
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   122   3e-27
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   119   3e-27
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   122   4e-27
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   121   4e-27
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...   117   4e-27
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   121   5e-27
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...   120   5e-27
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   121   5e-27
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   121   5e-27
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...   121   5e-27
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   120   5e-27
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   117   5e-27
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...   117   5e-27
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...   117   6e-27
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   120   6e-27
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   119   6e-27
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   121   7e-27
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...   117   7e-27
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   121   7e-27
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   118   7e-27
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   120   7e-27
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   120   8e-27
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   117   8e-27
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    120   8e-27
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   115   8e-27
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   116   8e-27
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...   120   9e-27
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   119   9e-27
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   120   9e-27
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   120   9e-27
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   120   1e-26
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   118   1e-26
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   119   1e-26
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   120   1e-26
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   117   1e-26
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   120   1e-26
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   119   1e-26
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   119   1e-26
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   118   1e-26
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   120   1e-26
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   120   1e-26
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   117   1e-26
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   119   1e-26
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   119   1e-26
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   120   1e-26
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   115   1e-26
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...   119   1e-26
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   119   1e-26
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   117   2e-26
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   119   2e-26
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   119   2e-26
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   116   2e-26
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   117   2e-26
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...   116   2e-26
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   119   2e-26
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   119   2e-26
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   119   2e-26
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   117   2e-26
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...   115   2e-26
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...   119   2e-26
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   119   2e-26
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   116   2e-26
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   119   2e-26
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...   118   2e-26
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...   115   2e-26
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   116   2e-26
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   118   3e-26
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   119   3e-26
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...   115   3e-26
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   116   3e-26
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   118   3e-26
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...   115   3e-26
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....   118   4e-26
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   118   4e-26
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   115   4e-26
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...   118   4e-26
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...   117   4e-26
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   118   4e-26
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    113   5e-26
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   117   5e-26
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   117   5e-26
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   115   5e-26
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   116   6e-26
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   117   6e-26
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   117   7e-26
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   118   7e-26
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   115   7e-26
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   116   7e-26
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   116   7e-26
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...   115   7e-26
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   117   7e-26
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   117   7e-26
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   110   8e-26
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...   116   8e-26
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   115   8e-26
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   117   8e-26
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...   115   8e-26
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   117   9e-26
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   115   9e-26
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...   117   9e-26
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   117   1e-25
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...   116   1e-25
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...   114   1e-25
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   114   1e-25
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             116   1e-25
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   116   1e-25
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   115   1e-25
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   116   1e-25
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...   114   1e-25
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   117   1e-25
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   114   2e-25
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....   115   2e-25
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   116   2e-25
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   116   2e-25
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...   114   2e-25
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   114   2e-25
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   110   2e-25
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   115   2e-25
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                113   2e-25
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   115   2e-25
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   114   2e-25
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   113   2e-25
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   113   2e-25
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   115   2e-25
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...   114   2e-25
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   116   2e-25
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              114   2e-25
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...   115   2e-25
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   113   2e-25
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...   113   2e-25
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   114   3e-25
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...   114   3e-25
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...   114   3e-25
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   115   3e-25
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   115   3e-25
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   115   3e-25
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   115   3e-25
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   115   3e-25
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   115   3e-25
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...   113   3e-25
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   112   3e-25
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   115   3e-25
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   115   4e-25
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...   115   4e-25
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...   111   4e-25
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   108   4e-25
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   114   4e-25
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   114   5e-25
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   113   5e-25
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...   108   5e-25
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   108   5e-25
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   114   5e-25
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...   110   5e-25
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86      114   7e-25
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            113   7e-25
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....   114   7e-25
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...   113   7e-25
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   108   7e-25
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...   112   8e-25
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   112   8e-25
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}              112   8e-25
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   107   8e-25
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   113   9e-25
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...   110   1e-24
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   113   1e-24
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   114   1e-24
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....   114   1e-24
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   112   1e-24
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   113   1e-24
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   113   1e-24
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   112   1e-24
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   113   1e-24
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...   110   1e-24
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...   112   2e-24
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...   109   2e-24
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    112   2e-24
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   107   2e-24
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   113   2e-24
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   107   2e-24
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...   112   2e-24
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   111   2e-24
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...   108   2e-24
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   107   2e-24
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   111   2e-24
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...   110   2e-24
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...   110   2e-24
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   112   2e-24
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...   112   3e-24
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   109   3e-24
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   112   3e-24
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...   106   3e-24
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...   112   3e-24
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   106   4e-24
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...   109   4e-24
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...   107   4e-24
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...   111   4e-24
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...   110   4e-24
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   109   5e-24
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...   107   5e-24
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...   110   5e-24
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...   111   5e-24
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   111   5e-24
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...   111   5e-24
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....   111   6e-24
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...   105   6e-24
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...   111   6e-24
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...   110   6e-24
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...   110   7e-24
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...   105   8e-24
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...   108   8e-24
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...   107   9e-24
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   110   9e-24
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   110   9e-24
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...   110   9e-24
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...   107   9e-24
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....   110   1e-23
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...   110   1e-23
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...   110   1e-23
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   104   1e-23
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...   108   1e-23
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...   110   1e-23
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   110   1e-23
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...   107   1e-23
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...   105   1e-23
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...   110   2e-23
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...   104   2e-23
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...   103   2e-23
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...   108   2e-23
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...   103   2e-23
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...   109   2e-23
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...   107   2e-23
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              108   2e-23
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   107   2e-23
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...   109   2e-23
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...   109   2e-23
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...   108   2e-23
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...   108   2e-23
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   109   3e-23
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...   108   3e-23
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...   108   3e-23
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...   108   3e-23
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...   108   3e-23
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...   103   3e-23
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...   106   3e-23
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...   107   3e-23
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   108   3e-23
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...   108   3e-23
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...   107   4e-23
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...   107   4e-23
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...   108   4e-23
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...   107   4e-23
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...   106   4e-23
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...   108   4e-23
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...   108   4e-23
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...   103   4e-23
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   102   5e-23
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   108   5e-23
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   108   5e-23
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...   108   5e-23
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...   108   5e-23
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...   102   6e-23
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...   108   6e-23
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...   103   6e-23
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...   102   6e-23
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   107   6e-23
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...   106   6e-23
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}             102   6e-23
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   106   6e-23
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...   102   7e-23
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...   106   7e-23
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...   102   7e-23
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...   107   7e-23
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...   107   8e-23
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...   105   8e-23
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...   107   9e-23
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...   107   9e-23
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...   102   1e-22
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...   107   1e-22
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...   105   1e-22
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...   107   1e-22
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192    102   1e-22
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...   101   1e-22
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...   105   1e-22
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...   105   1e-22
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...   104   1e-22
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   107   1e-22
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...   101   1e-22
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...   105   1e-22
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...   106   1e-22
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...   104   1e-22
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...   105   1e-22
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...   101   2e-22
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...   104   2e-22
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   106   2e-22
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...   101   2e-22
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    105   2e-22
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...   104   2e-22
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...   105   2e-22
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...   100   2e-22
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   106   2e-22
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...   104   2e-22
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24       104   2e-22
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...   100   2e-22
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...   105   3e-22
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...   104   3e-22
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...   104   3e-22
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...   103   3e-22
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...   105   3e-22
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...   101   3e-22
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...   103   3e-22
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...   103   3e-22
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...   103   4e-22
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...   103   4e-22
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...   103   4e-22
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   103   4e-22
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...   101   4e-22
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...   100   4e-22
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....   104   4e-22
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   103   4e-22
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...   104   4e-22
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...   102   5e-22
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...   100   5e-22
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...   100   5e-22
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...   102   6e-22
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   104   6e-22
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...   104   6e-22
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...   102   6e-22
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...   104   7e-22
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...   101   7e-22
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...   100   7e-22
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    99   7e-22
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...   102   7e-22
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   102   7e-22
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...   100   7e-22
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...   103   7e-22
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    99   7e-22
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...   100   7e-22
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...   103   8e-22
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    98   8e-22
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...   103   1e-21
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...   102   1e-21
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...   102   1e-21
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...   102   1e-21
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...   100   1e-21
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   103   1e-21
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180    103   1e-21
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...   102   1e-21
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   103   1e-21
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    97   1e-21
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...   102   1e-21
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...   100   1e-21
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...   101   2e-21
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    99   2e-21
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652    101   2e-21
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...   102   2e-21
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...   102   2e-21
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   102   2e-21
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...   102   2e-21
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    99   2e-21
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...   102   2e-21
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    99   2e-21
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...   100   2e-21
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...   100   2e-21
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    97   2e-21
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...   102   2e-21
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    98   2e-21
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...   102   2e-21
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    98   3e-21
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    98   3e-21
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...   100   3e-21
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...   100   3e-21
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...   102   3e-21
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    97   3e-21
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...   102   3e-21
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....   100   3e-21
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...   101   4e-21
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    97   4e-21
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   101   4e-21
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...   100   4e-21
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...   100   4e-21
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    99   5e-21
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   101   5e-21
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    97   5e-21
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...   100   5e-21
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...   100   5e-21
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   101   5e-21
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...   100   6e-21
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...   101   6e-21
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   101   6e-21
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    96   7e-21
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41     100   7e-21
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    99   8e-21
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...   100   8e-21
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...   100   8e-21
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...   100   9e-21
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    97   9e-21
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    99   9e-21
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    96   1e-20
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    99   1e-20
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    96   1e-20
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    99   1e-20
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    97   1e-20
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    96   1e-20
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...   100   1e-20
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    96   1e-20
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   100   1e-20
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...   100   1e-20
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    96   1e-20
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...   100   1e-20
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    97   1e-20
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...   100   1e-20
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    98   2e-20
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   100   2e-20
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    96   2e-20
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    99   2e-20
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    96   2e-20
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    99   2e-20
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    99   2e-20
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...   100   2e-20
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    97   2e-20
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    95   2e-20
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    98   2e-20
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    98   2e-20
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    99   2e-20
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    99   2e-20
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    99   2e-20
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    96   2e-20
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    96   2e-20
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    96   2e-20
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    97   2e-20
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    96   2e-20
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    95   3e-20
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    99   3e-20
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    99   3e-20
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    99   3e-20
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    96   3e-20
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    99   3e-20
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    97   3e-20
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...   100   3e-20
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    97   3e-20
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    94   3e-20
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    95   3e-20
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    92   3e-20
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    94   3e-20
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    97   3e-20
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    99   3e-20
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    96   3e-20
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    96   3e-20
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    99   4e-20
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    97   4e-20
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    97   4e-20
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    97   4e-20
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    94   4e-20
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    98   4e-20
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    98   5e-20
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    98   5e-20
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    97   5e-20
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    98   5e-20
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    98   5e-20
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    97   6e-20
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    98   6e-20
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    95   6e-20
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    97   6e-20
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    97   6e-20
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    99   6e-20
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    93   7e-20
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    98   7e-20
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    97   7e-20
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    97   8e-20
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     96   8e-20
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    97   8e-20
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    97   8e-20
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    97   8e-20
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    94   9e-20
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    96   9e-20
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    96   9e-20
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    96   1e-19
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    97   1e-19
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    94   1e-19
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    93   1e-19
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    94   1e-19
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    97   1e-19
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    94   1e-19
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    96   1e-19
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     97   1e-19
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       97   1e-19
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    96   2e-19
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    96   2e-19
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    96   2e-19
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    94   2e-19
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    96   3e-19
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    96   3e-19
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    96   3e-19
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    96   3e-19
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    95   3e-19
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    95   3e-19
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    93   4e-19
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    94   4e-19
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    96   4e-19
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    95   4e-19
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    96   4e-19
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    94   4e-19
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    95   4e-19
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    96   5e-19
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    94   5e-19
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    95   5e-19
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    96   5e-19
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    92   5e-19
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    94   5e-19
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    95   5e-19
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    95   5e-19
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    94   5e-19
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    92   6e-19
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    96   6e-19
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    94   6e-19
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    94   6e-19
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    91   6e-19
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    94   6e-19
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    92   6e-19
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    94   6e-19
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    95   6e-19
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    95   7e-19
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    94   7e-19
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    94   7e-19
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    93   7e-19
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    93   7e-19
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    95   7e-19
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    94   8e-19
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    94   8e-19
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    94   8e-19
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    93   8e-19
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    93   8e-19
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    94   8e-19
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    93   8e-19
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    93   8e-19
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    94   8e-19
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    94   9e-19
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    94   9e-19
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    94   9e-19
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    93   1e-18
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    94   1e-18
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    94   1e-18
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    93   1e-18
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    93   1e-18
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    94   1e-18
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    94   1e-18
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    94   1e-18
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    92   1e-18
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    94   1e-18
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    93   1e-18
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    94   1e-18
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    91   1e-18
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    92   1e-18
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    93   1e-18
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    94   1e-18
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    92   1e-18
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    92   1e-18
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    93   1e-18
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    93   1e-18
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    92   1e-18
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    92   1e-18
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    93   2e-18
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    93   2e-18
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    93   2e-18
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    92   2e-18
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    93   2e-18
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    93   2e-18
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    93   2e-18
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    92   2e-18
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               93   2e-18
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    93   2e-18
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    93   2e-18
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    92   2e-18
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    92   2e-18
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    93   2e-18
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    93   2e-18
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    91   2e-18
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    92   2e-18
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    94   2e-18
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    92   2e-18
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    92   2e-18
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    92   2e-18
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    91   2e-18
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    92   2e-18
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    93   2e-18
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    92   2e-18
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    93   2e-18
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    92   2e-18
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    92   2e-18
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    93   2e-18
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    91   3e-18
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    93   3e-18
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    93   3e-18
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    90   3e-18
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    92   3e-18
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    91   4e-18
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    92   4e-18
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    91   4e-18
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    91   4e-18
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    92   4e-18
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    87   4e-18
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    92   4e-18
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    91   4e-18
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    92   4e-18
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    92   4e-18
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    91   4e-18
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    92   4e-18
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     89   4e-18
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    92   4e-18
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    92   5e-18
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    90   5e-18
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    92   5e-18
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    91   5e-18
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    92   5e-18
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    91   5e-18
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    89   5e-18
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    90   5e-18
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    91   5e-18
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    92   6e-18
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    90   6e-18
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    92   6e-18
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    91   6e-18
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    91   7e-18
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    89   7e-18
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    91   7e-18
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    90   7e-18
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    89   7e-18
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    92   7e-18
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    87   7e-18
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    90   7e-18
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    91   8e-18
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    92   8e-18
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    92   8e-18
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    91   8e-18
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    91   9e-18
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    91   9e-18
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    89   9e-18
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    88   9e-18
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    90   1e-17
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    88   1e-17
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    91   1e-17
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              91   1e-17
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    90   1e-17
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    88   1e-17
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    91   1e-17
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    91   1e-17
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    90   1e-17
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    90   1e-17
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    90   1e-17
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    91   1e-17
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    90   1e-17
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    90   1e-17
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    91   1e-17
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    89   1e-17
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    89   1e-17
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    90   1e-17
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    90   2e-17
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    89   2e-17
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    89   2e-17
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    89   2e-17
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    90   2e-17
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              89   2e-17
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    90   2e-17
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    89   2e-17
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    89   2e-17
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    91   2e-17
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    91   2e-17
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               90   2e-17
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    89   2e-17
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    91   2e-17
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    88   2e-17
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    91   2e-17
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    89   2e-17
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    89   2e-17
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    90   2e-17
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    90   2e-17
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    88   2e-17
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    89   2e-17
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    89   2e-17
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    89   2e-17
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    89   2e-17
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    87   2e-17
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    89   2e-17
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    89   2e-17
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    89   2e-17
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    88   2e-17
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    88   2e-17
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    90   2e-17
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    90   2e-17
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    87   2e-17
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    90   2e-17
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    88   3e-17
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    89   3e-17
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    89   3e-17
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    88   3e-17
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    90   3e-17
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    88   3e-17
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    89   3e-17
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    87   3e-17
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    87   3e-17
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    87   3e-17
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    89   3e-17
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    89   3e-17
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    89   3e-17
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    89   3e-17
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    90   3e-17
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    89   3e-17
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    87   4e-17
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    87   4e-17
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    88   4e-17
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      89   4e-17
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    87   4e-17
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    89   4e-17
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    89   4e-17
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    87   4e-17
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    89   4e-17
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    86   4e-17
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     88   5e-17
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    89   5e-17
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    89   5e-17
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    88   5e-17
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    88   6e-17
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    87   6e-17
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      88   6e-17
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    86   7e-17
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    88   7e-17
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    87   7e-17
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    86   7e-17
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    89   8e-17
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    87   8e-17
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     86   8e-17
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             88   8e-17
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    87   8e-17
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    87   8e-17
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    86   8e-17
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    87   9e-17
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    87   9e-17
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    87   1e-16
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    87   1e-16
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     87   1e-16
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    86   1e-16
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     87   1e-16
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    85   1e-16
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    87   1e-16
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    87   1e-16
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    87   1e-16
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    85   1e-16
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    87   1e-16
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    87   1e-16
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    86   1e-16
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    87   1e-16
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    86   1e-16
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    87   2e-16
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    85   2e-16
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    87   2e-16
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    86   2e-16
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    83   2e-16
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    85   2e-16
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    87   2e-16
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    87   2e-16
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    86   2e-16
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    87   2e-16
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    86   2e-16
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    86   2e-16
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    86   2e-16
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    86   2e-16
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    84   2e-16
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    86   2e-16
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    85   2e-16
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     84   2e-16
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    84   2e-16
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    87   2e-16
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    86   2e-16
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    84   2e-16
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    86   2e-16
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    86   2e-16
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    86   2e-16
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    84   3e-16
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    86   3e-16
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    86   3e-16
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    86   3e-16
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    84   3e-16
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    84   3e-16
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    86   3e-16
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    86   3e-16
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    86   3e-16
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    86   3e-16
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    86   4e-16
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    86   4e-16
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    84   4e-16
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    84   4e-16
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    86   4e-16
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    83   5e-16
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    84   5e-16
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    84   5e-16
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    84   5e-16
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    86   5e-16
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    84   5e-16
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    85   5e-16
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    85   6e-16
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    83   6e-16
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    83   6e-16
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    85   6e-16
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    83   6e-16
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    85   6e-16
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    82   6e-16
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    84   7e-16
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    85   7e-16
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    83   7e-16
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    84   7e-16
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    85   7e-16
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    84   7e-16
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     84   7e-16
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    85   7e-16
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    84   8e-16
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    82   8e-16
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    84   8e-16
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    84   9e-16
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    84   1e-15
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    84   1e-15
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    84   1e-15
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    84   1e-15
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    82   1e-15
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    83   1e-15
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    84   1e-15
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    84   1e-15
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    84   1e-15
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    84   1e-15
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    83   1e-15
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    84   1e-15
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    81   1e-15
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    84   1e-15
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    82   1e-15
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    84   1e-15
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    82   1e-15
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    83   1e-15
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    84   1e-15
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    81   1e-15
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    81   1e-15
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    82   2e-15
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    83   2e-15
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    83   2e-15
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    82   2e-15
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    83   2e-15
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    84   2e-15
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    84   2e-15
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    82   2e-15
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    82   2e-15
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    83   2e-15
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    82   2e-15
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    82   2e-15
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    83   2e-15
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    83   2e-15
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    83   2e-15
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     83   3e-15
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              83   3e-15
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    82   3e-15
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    81   3e-15
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    83   3e-15
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    82   3e-15
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    83   3e-15
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    83   3e-15
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    81   3e-15
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    83   3e-15
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    81   3e-15
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    81   4e-15
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    82   4e-15
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      82   4e-15
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    83   4e-15
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    82   4e-15
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    79   4e-15
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    81   4e-15
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    82   5e-15
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    80   5e-15
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    82   5e-15
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    82   5e-15
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    80   5e-15
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    82   6e-15
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    81   6e-15
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    82   6e-15
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    81   6e-15
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     81   7e-15
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    82   7e-15
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    79   8e-15
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    79   8e-15
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    79   8e-15
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    82   9e-15
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    81   9e-15
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    81   1e-14
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    79   1e-14
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    81   1e-14
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    79   1e-14
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    80   1e-14
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              80   1e-14
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    80   1e-14
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    80   1e-14
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    79   1e-14
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    79   1e-14
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    80   1e-14
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    80   1e-14
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    79   1e-14
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    79   1e-14
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    79   2e-14
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    80   2e-14
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    80   2e-14
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    80   2e-14
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    79   2e-14
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    80   2e-14
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    78   2e-14
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    80   2e-14
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    80   2e-14
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    80   2e-14
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    80   2e-14
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    77   2e-14
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    79   2e-14
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    80   2e-14
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    79   2e-14
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    78   3e-14
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    79   3e-14
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    77   3e-14
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    77   3e-14
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    79   3e-14
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    79   3e-14
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    79   3e-14
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    79   3e-14
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    79   3e-14
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    79   4e-14
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    77   4e-14
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    79   4e-14
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    79   5e-14
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    77   5e-14
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    78   5e-14
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    77   5e-14
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    78   5e-14
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    77   5e-14
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    78   5e-14
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    78   6e-14
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    79   6e-14
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    78   6e-14
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    78   6e-14
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    77   6e-14
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    77   7e-14
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    77   7e-14
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    77   7e-14
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    78   7e-14
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    77   7e-14
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    78   8e-14
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    77   8e-14
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    77   8e-14
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    79   8e-14
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    77   8e-14
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    78   1e-13
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    78   1e-13
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    78   1e-13
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    75   1e-13
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    76   1e-13
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    75   1e-13
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    78   1e-13
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    77   1e-13
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    77   1e-13
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    76   1e-13
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    77   1e-13
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    76   1e-13
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    77   1e-13
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    77   1e-13
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    77   1e-13
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    75   1e-13
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    77   2e-13
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    77   2e-13
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    77   2e-13
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    77   2e-13
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    76   2e-13
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    76   2e-13
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    75   2e-13
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    76   2e-13
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    77   2e-13
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    76   2e-13
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    75   2e-13
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    76   2e-13
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    75   2e-13
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    76   2e-13
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    76   2e-13
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    74   3e-13
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    77   3e-13
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    75   3e-13
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    76   3e-13
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    75   3e-13
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    76   3e-13
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    77   3e-13
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    76   3e-13
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    76   4e-13
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    75   4e-13
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    74   4e-13
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    76   4e-13
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    75   5e-13
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    76   5e-13
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    75   6e-13
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    74   6e-13
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    75   6e-13
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    74   6e-13
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    75   6e-13
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    75   6e-13
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    75   6e-13
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    74   7e-13
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    75   7e-13
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             74   7e-13
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    75   8e-13
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    74   8e-13
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    75   8e-13
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    73   9e-13
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    75   9e-13
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    75   1e-12
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    74   1e-12
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               73   1e-12
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    74   1e-12
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    74   1e-12
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    74   1e-12
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     74   1e-12
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    74   1e-12
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    73   1e-12
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    74   1e-12
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    74   1e-12
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    73   1e-12
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    74   1e-12
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    74   1e-12
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    74   1e-12
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               74   1e-12
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    73   2e-12
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      74   2e-12
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    74   2e-12
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    74   2e-12
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    74   2e-12
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    74   2e-12
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    74   2e-12
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    74   2e-12
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    74   2e-12
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    72   2e-12
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    74   2e-12
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    72   2e-12
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    72   2e-12
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    72   2e-12
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    72   2e-12
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    74   2e-12
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    73   2e-12
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    72   2e-12
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    73   2e-12
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    72   2e-12
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    73   2e-12
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    72   3e-12
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    72   3e-12
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    73   3e-12
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    71   3e-12
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    73   3e-12
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    73   3e-12
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    73   3e-12
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    73   3e-12
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    71   4e-12
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    73   4e-12
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    72   4e-12
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    72   4e-12
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    72   4e-12
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    71   4e-12
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    72   4e-12
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    72   5e-12
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    73   5e-12
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    72   5e-12
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    72   6e-12
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    70   6e-12
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    72   6e-12
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    72   7e-12
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    72   8e-12
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    71   8e-12
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    71   8e-12
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    72   9e-12
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    72   9e-12
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    71   9e-12
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    71   1e-11
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    72   1e-11
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    71   1e-11
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    71   1e-11
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    71   1e-11
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     71   1e-11
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    71   1e-11
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    71   1e-11
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    71   1e-11
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    69   1e-11
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     71   1e-11
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    71   2e-11
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    70   2e-11
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    70   2e-11
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    71   2e-11
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    70   2e-11
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    70   2e-11
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    70   2e-11
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    69   2e-11
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    70   2e-11
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    70   3e-11
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    70   3e-11
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               70   3e-11
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       70   3e-11
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    70   3e-11
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    70   3e-11
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    70   3e-11
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    69   3e-11
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    70   3e-11
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    69   4e-11
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    69   4e-11
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               69   4e-11
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    68   4e-11
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    69   4e-11
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    69   4e-11
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    68   5e-11
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    68   5e-11
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    69   5e-11
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    69   5e-11
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    69   5e-11
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    69   5e-11
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    68   5e-11
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    68   6e-11
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    69   6e-11
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    69   6e-11
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    69   6e-11
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    68   8e-11
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    68   8e-11
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    68   8e-11
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    68   9e-11
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    68   1e-10
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    68   1e-10
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    68   1e-10
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    68   1e-10
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    68   1e-10
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    68   1e-10
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    68   1e-10
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    68   1e-10
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    68   1e-10
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    67   1e-10
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    67   1e-10
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    67   1e-10
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    67   2e-10
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    67   2e-10
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    67   2e-10
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    67   2e-10
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    67   2e-10
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     67   2e-10
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    67   2e-10
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    67   2e-10
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    67   2e-10
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    67   2e-10
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    66   3e-10
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    67   3e-10
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    67   3e-10
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    67   3e-10
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    66   3e-10
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    67   3e-10
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    66   4e-10
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    66   4e-10
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    66   4e-10
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    65   5e-10
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    66   5e-10
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    66   5e-10
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    66   5e-10
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    65   6e-10
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    64   6e-10
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    65   6e-10
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    65   6e-10
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    65   6e-10
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    65   7e-10
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    65   7e-10
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    65   7e-10
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    65   8e-10
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    65   8e-10
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    65   8e-10
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    64   9e-10
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    65   9e-10
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    65   9e-10
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    65   1e-09
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    64   1e-09
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    65   1e-09
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    65   1e-09
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    65   1e-09
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    64   1e-09
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    64   1e-09
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    63   2e-09
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    64   2e-09
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    64   2e-09
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    64   2e-09
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    64   2e-09
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    64   2e-09
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    64   2e-09
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    62   2e-09
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    64   3e-09
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               63   3e-09
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    63   3e-09
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    63   3e-09
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    63   3e-09
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    62   3e-09
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    62   3e-09
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    63   3e-09
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    62   3e-09
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    63   4e-09
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    63   4e-09
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    62   4e-09
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    62   5e-09
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    62   6e-09
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    61   6e-09
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    61   6e-09
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    62   7e-09
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    62   7e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    61   7e-09
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    61   9e-09
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    62   1e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    61   1e-08
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    60   1e-08
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    60   1e-08
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    61   1e-08
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    61   1e-08
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    61   1e-08
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    61   1e-08
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    60   2e-08
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    61   2e-08
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    60   2e-08
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    59   2e-08
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    60   2e-08
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    60   2e-08
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    60   2e-08
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    60   2e-08
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    59   2e-08
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    60   2e-08
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    60   2e-08
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    60   3e-08
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    59   4e-08
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    58   6e-08
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    58   6e-08
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    59   6e-08
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    59   6e-08
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    59   6e-08
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    58   7e-08
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    58   7e-08
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    59   7e-08
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    59   8e-08
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    58   8e-08
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               59   9e-08
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    59   9e-08
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    57   1e-07
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    58   1e-07
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    58   1e-07
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    58   2e-07
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    57   2e-07
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    57   2e-07
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    57   2e-07
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    57   2e-07
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    57   2e-07
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    57   3e-07
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    57   3e-07
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    56   4e-07
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    55   5e-07
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    55   6e-07
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    55   9e-07
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    55   1e-06
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    54   1e-06
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    54   1e-06
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    54   2e-06
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    53   2e-06
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    54   2e-06
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    54   2e-06
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    53   2e-06
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    53   2e-06
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    54   3e-06
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    54   3e-06
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    52   4e-06
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    53   4e-06
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    53   4e-06
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    53   4e-06
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    53   5e-06
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    52   6e-06
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    52   6e-06
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    52   8e-06
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    52   1e-05
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    51   1e-05
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    50   2e-05
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    50   2e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    50   2e-05
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    50   3e-05
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    50   3e-05
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    50   3e-05
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    50   4e-05
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    49   5e-05
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    49   9e-05
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    48   9e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    48   1e-04
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     48   1e-04
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    47   1e-04
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    48   2e-04
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    48   2e-04
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    48   2e-04
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    47   3e-04
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    47   3e-04
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    47   3e-04
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    47   4e-04
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    47   4e-04
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    46   4e-04
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    46   5e-04
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    44   5e-04
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    45   5e-04
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    46   6e-04
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    45   7e-04
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     45   0.001
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    45   0.001
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    44   0.002
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    44   0.002
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    44   0.002
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    44   0.002
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    44   0.002
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    42   0.002
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    44   0.003
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    42   0.003
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    44   0.003
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    44   0.003
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    43   0.003
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    43   0.003
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     43   0.004
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    44   0.004
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    43   0.004
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    43   0.004
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    43   0.004
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    43   0.005
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    43   0.005
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    43   0.006
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    43   0.006
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    42   0.006
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    42   0.007
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    43   0.007
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    42   0.007
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    42   0.007
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    42   0.008
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    42   0.008
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    42   0.008
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    42   0.008
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    42   0.009
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    42   0.009
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    42   0.010
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    42   0.011
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    42   0.011
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    42   0.012
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    41   0.013
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    41   0.013
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    41   0.014
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    41   0.015
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    41   0.017
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    41   0.018
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    41   0.018
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    41   0.018
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    41   0.019
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    41   0.019
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    41   0.020
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    41   0.022
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    41   0.023
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    40   0.024
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    41   0.025
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    40   0.029
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    40   0.031
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    40   0.031
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    40   0.031
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    40   0.033
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    40   0.033
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    40   0.033
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    40   0.033
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    40   0.035
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    40   0.035
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.036
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.036
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    40   0.036
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    40   0.036
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    40   0.040
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    40   0.043
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    40   0.043
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    40   0.044
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    40   0.046
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    39   0.054
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    39   0.055
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    39   0.060
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    39   0.064
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    39   0.066
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    39   0.066
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    39   0.079
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    39   0.079
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    39   0.089
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    39   0.10 
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    39   0.10 
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    38   0.13 
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    38   0.14 
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    38   0.15 
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    38   0.16 
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    38   0.17 
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    38   0.17 
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     38   0.18 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    38   0.18 
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    38   0.19 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    37   0.20 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    37   0.21 
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    37   0.21 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    37   0.25 
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    37   0.30 
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    37   0.31 
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    37   0.31 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    37   0.36 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    37   0.42 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    36   0.43 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    37   0.47 
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    36   0.48 
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    36   0.69 
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    36   0.71 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    36   0.75 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     35   0.87 
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    35   1.00 
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    35   1.1  
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    35   1.1  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    35   1.1  
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    35   1.1  
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    35   1.1  
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    35   1.2  
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    35   1.2  
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    35   1.3  
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    35   1.3  
Skud_7.199 Chr7 (356300..358714) [2415 bp, 804 aa] {ON} YGL083W ...    35   1.5  
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    35   1.6  
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    35   1.6  
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    35   1.8  
NDAI0B04190 Chr2 (1057037..1057747) [711 bp, 236 aa] {ON} Anc_2....    34   2.0  
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    34   2.2  
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    34   2.6  
TBLA0C00420 Chr3 (76048..78897) [2850 bp, 949 aa] {ON} Anc_8.20 ...    34   3.0  
KNAG0F02100 Chr6 complement(399443..401944) [2502 bp, 833 aa] {O...    34   3.0  
NCAS0D03690 Chr4 (688360..690804) [2445 bp, 814 aa] {ON} Anc_6.1...    34   3.1  
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    33   3.4  
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    33   3.9  
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    33   4.1  
KLLA0E19207g Chr5 (1709335..1711638) [2304 bp, 767 aa] {ON} simi...    33   6.3  
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    33   6.6  
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    32   9.2  

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1153

 Score = 2197 bits (5692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1083/1153 (93%), Positives = 1083/1153 (93%)

Query: 1    MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG 60
            MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG
Sbjct: 1    MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG 60

Query: 61   SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120
            SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF
Sbjct: 61   SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120

Query: 121  NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180
            NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA
Sbjct: 121  NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180

Query: 181  LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240
            LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR
Sbjct: 181  LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240

Query: 241  NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK 300
            NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK
Sbjct: 241  NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK 300

Query: 301  SIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYA 360
            SIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYA
Sbjct: 301  SIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYA 360

Query: 361  LLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSS 420
            LLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSS
Sbjct: 361  LLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSS 420

Query: 421  SHKRPVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKR 480
            SHKRPVSFNKL                  KRVSVNLSSNKRLSAVYTNSGSPTPASRHKR
Sbjct: 421  SHKRPVSFNKLSNVVSPGSVPSSNSNTPSKRVSVNLSSNKRLSAVYTNSGSPTPASRHKR 480

Query: 481  VSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTY 540
            VSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTY
Sbjct: 481  VSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTY 540

Query: 541  AKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXXXXXX 600
            AKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKF                        
Sbjct: 541  AKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFEQIRREKEELERKVRETKEREERE 600

Query: 601  XXXXXXXXXXXXXXXXDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGAVN 660
                            DLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGAVN
Sbjct: 601  RREKEIEEKRKIQEKQDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGAVN 660

Query: 661  GRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQYTGS 720
            GRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQYTGS
Sbjct: 661  GRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQYTGS 720

Query: 721  EDRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIISTTNDE 780
            EDRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIISTTNDE
Sbjct: 721  EDRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIISTTNDE 780

Query: 781  YETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMYSSKQ 840
            YETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMYSSKQ
Sbjct: 781  YETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMYSSKQ 840

Query: 841  SYTNLADLLNEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDSSHDGRLYEVPED 900
            SYTNLADLLNEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDSSHDGRLYEVPED
Sbjct: 841  SYTNLADLLNEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDSSHDGRLYEVPED 900

Query: 901  SNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLDGKEAKGLGIYQSSSESLPEP 960
            SNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLDGKEAKGLGIYQSSSESLPEP
Sbjct: 901  SNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLDGKEAKGLGIYQSSSESLPEP 960

Query: 961  AQHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNASIPKHRTDGAQKSERMPS 1020
            AQHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNASIPKHRTDGAQKSERMPS
Sbjct: 961  AQHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNASIPKHRTDGAQKSERMPS 1020

Query: 1021 KEGSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAKXXXXXXXXXXXXWKKYGLKGV 1080
            KEGSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAK            WKKYGLKGV
Sbjct: 1021 KEGSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAKQLFNGLQNLLQGWKKYGLKGV 1080

Query: 1081 KSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKGSIVGFRKKSGSTKTLKRLVSEIEK 1140
            KSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKGSIVGFRKKSGSTKTLKRLVSEIEK
Sbjct: 1081 KSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKGSIVGFRKKSGSTKTLKRLVSEIEK 1140

Query: 1141 VLLKERVLTKESS 1153
            VLLKERVLTKESS
Sbjct: 1141 VLLKERVLTKESS 1153

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
            {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
            YDR507C
          Length = 1189

 Score = 1295 bits (3351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/1220 (58%), Positives = 852/1220 (69%), Gaps = 101/1220 (8%)

Query: 1    MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG 60
            M+ M+ RS PTV+G+K+GPWKLGETLG GSTGKVQLA +E T Q AA+K ISKAIF+ K 
Sbjct: 1    MSGMNKRSAPTVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKT 60

Query: 61   SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120
            +  +SS+AASTPD LPYGIEREIIIMKLLNHPNVLRLYDVWETN +LYMVLEYA+KGELF
Sbjct: 61   APGNSSIAASTPDPLPYGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELF 120

Query: 121  NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180
            NLLVE GPLPE EA+ FFRQI+IG+SYCHALGIVHRDLKPENLLLDH  NIKIADFGMAA
Sbjct: 121  NLLVENGPLPENEAVCFFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAA 180

Query: 181  LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240
            LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASD+WSCGVI FALLTGRLPFD+EDGNIR
Sbjct: 181  LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIR 240

Query: 241  NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK 300
            NLLL+VQSG++EMP DDEISP+AQDL+A+ILTVDPE RIK R+ILKHPLLQKYP+++D+K
Sbjct: 241  NLLLKVQSGKFEMPDDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNK 300

Query: 301  SIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYA 360
            SIRNLPREDTYLHPLS+  S+E+D+NILQNLVVLWHGR   EI  KL++PGANAEKTLYA
Sbjct: 301  SIRNLPREDTYLHPLSDSGSSEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYA 360

Query: 361  LLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSS 420
            LL RFK+DTE ++ +  Q KKR S +N                + SPK+RNR S I+ SS
Sbjct: 361  LLARFKNDTEREAARQKQIKKR-SSLNGTGAGVN-------NNHVSPKKRNRASTINASS 412

Query: 421  SHKRPVSFNKLX--XXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYT--NSGSPTPAS 476
            SHKRPVS  KL                    KR+SVNLSSNKRLS V T  N GSPTPAS
Sbjct: 413  SHKRPVSLIKLSGSSNSNSNSNPSSTSTTPPKRMSVNLSSNKRLSTVKTQGNGGSPTPAS 472

Query: 477  RHKRVSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKL 536
            R KRVSI+  E ++    PPVPI+MLKDY+ T   KRLSR ++RLSFKP+NKRGS+TTKL
Sbjct: 473  RSKRVSII--ESDKNGGAPPVPIDMLKDYNKTPNSKRLSRASVRLSFKPTNKRGSVTTKL 530

Query: 537  ISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXX 596
            ISTYAKLSE+DDWEYIEKETKRTSSDFATL D+IFEHEKF                    
Sbjct: 531  ISTYAKLSEEDDWEYIEKETKRTSSDFATLIDEIFEHEKFEQIRKEKAELERRVKETKER 590

Query: 597  XXXXXXXXXXXXXXXXXXXXDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEH 656
                                  ++R++E Q            E QG    D ++D    +
Sbjct: 591  EERERKEREEKELNEKLENDARQKREMEAQ------------EAQGDDGTDTESDVHSNN 638

Query: 657  GAVNG-RSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKD 715
             A NG RSVS PL++K  D M ++Q++I+++  QRT SLQTRPVSRLDPG+F ++ S + 
Sbjct: 639  QAPNGVRSVSAPLERKKRDSMVNVQSDIEEIFGQRTMSLQTRPVSRLDPGLFYAEESNEP 698

Query: 716  QYTGSEDRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIIS 775
            +   +E+  KL   K ILETIRRSKFLGSSFDI KEL+    NE  K++ S+   DR +S
Sbjct: 699  EAGDTEEEKKLRTQKNILETIRRSKFLGSSFDIGKELQ----NEELKKKASQPHRDRTVS 754

Query: 776  TTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSM 835
             TN+ Y+T++LP  A A+APL+D     EPRKIS+I VPQFTRKSR F DSNKRLSVLSM
Sbjct: 755  QTNEPYDTRVLPTQAVATAPLRDQ----EPRKISEISVPQFTRKSRFFSDSNKRLSVLSM 810

Query: 836  YSSKQSYTNLADLLNE-EASNAKGNRDSP-NDQSG-HEPEFLFENVQ----EDGEVTGDS 888
            YS+K SY NL++LLN+ +AS+ + N  +  +D  G  EPEF FE V+    ED  ++  S
Sbjct: 811  YSTKHSYNNLSNLLNDSDASDGRLNSAAEYSDVKGKKEPEFQFEAVREASDEDNGISRLS 870

Query: 889  SHDGRLYE---------VPEDSNMTKEKLKLNFADRFK----TSNGEDRTAEDKNVRLPT 935
            ++D RL           VP D+  +K  +KLNFADRF     T+   + ++  KNV+LPT
Sbjct: 871  NNDERLRNVSGTSGGSGVPHDNLSSKHNMKLNFADRFSADEPTAGSSNSSSASKNVKLPT 930

Query: 936  LPPLDG-KEAKGLGIYQSSSESLPEPAQHNVKSMIQNDENQP-SETAEVLSIKE------ 987
            LPPLDG  EA GLGIYQSSSES  +  +   KS +Q++ + P  E  E ++ +E      
Sbjct: 931  LPPLDGTSEANGLGIYQSSSESFRDIVEPTPKSKLQDNSSNPEQEVEEEVAGREGSVKHS 990

Query: 988  --DNAQVERQQEA------------------------PLNASIPKHRTD------GAQKS 1015
              D A  ER +                          PLN S+PK R +       A K 
Sbjct: 991  AIDTASKERSKRTDRIDAKKPSSFQENLASAGASKGPPLNDSMPKRRNEDPRNGSTAAKG 1050

Query: 1016 E--RMPSKE---GSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAKXXXXXXXXXXX 1070
            E  R P K+    S+KKRN SFFRKFSKS+ + T G FD E+  +V+AK           
Sbjct: 1051 ENGRAPLKDITTNSDKKRNVSFFRKFSKSNEKDTTG-FDGEINTTVSAKQLFLGLQNLLH 1109

Query: 1071 XWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKGSIVGFRKKSGSTKT 1130
             W +YGLK V+S P+K+TLTGKL+SENILSLRSTLFEMVVWSRGK S+VGFRKKSGS+K 
Sbjct: 1110 GWTQYGLKDVRSHPEKMTLTGKLTSENILSLRSTLFEMVVWSRGKVSVVGFRKKSGSSKA 1169

Query: 1131 LKRLVSEIEKVLLKERVLTK 1150
            ++RLVSE+EKVLLKE V++K
Sbjct: 1170 MRRLVSEVEKVLLKEGVISK 1189

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1117

 Score = 1153 bits (2983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/1180 (55%), Positives = 808/1180 (68%), Gaps = 97/1180 (8%)

Query: 1    MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG 60
            M A +N  +P++KG+++GPWKLGETLGLGSTGKVQLA++++T +QAAIKVISK++FN   
Sbjct: 1    MTASNN--LPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFN-NN 57

Query: 61   SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120
            S + SS+  +TPD+LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYA+KGELF
Sbjct: 58   SAQSSSL--TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELF 115

Query: 121  NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180
            NLLVE+GPL E+EAIRFFRQI+IGISYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAA
Sbjct: 116  NLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 175

Query: 181  LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240
            LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFD+EDGNIR
Sbjct: 176  LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIR 235

Query: 241  NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK 300
            NLLL+VQSG +EMP DDEIS +AQDL+A+ILTVDPE+RI+ARDILKHPLLQKYPSI DSK
Sbjct: 236  NLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSK 295

Query: 301  SIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYA 360
            SIRNLPREDTYL+PLS+  S  ID+ ILQNLVVLWHGR+  EII+KL+EPGANAEKTLYA
Sbjct: 296  SIRNLPREDTYLNPLSDNNST-IDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYA 354

Query: 361  LLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSS 420
            LLDRFK D+E ++ K+ Q +KR S  + V +   KKA S PQ     +R+NR SMISVSS
Sbjct: 355  LLDRFKIDSEKENFKNEQIRKRQSITSSVSRSPAKKA-STPQ-----RRKNRISMISVSS 408

Query: 421  SHKRPVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVY----TNSGSPTPAS 476
            SHK+P SFN+L                     S   S NK+LS +     +N+ SPTPA 
Sbjct: 409  SHKKPASFNRLSSVVHNNLSASSSTTTTPA--SKKFSMNKKLSMIADKSNSNNSSPTPAH 466

Query: 477  RHKRVSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKL 536
            R+KR S+++ +R+                S  +K KR SR++ RLS   + KRGSITTKL
Sbjct: 467  RNKRTSMINTDRQ----------------SILSKNKRASRSSKRLSVMANMKRGSITTKL 510

Query: 537  ISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXX 596
            I+TYAKLSEDDDWEYIEKETKRTSSDFATL D+IFEHEK+                    
Sbjct: 511  IATYAKLSEDDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELARKVRLAKER 570

Query: 597  XXXXXXXXXXXXXXXXXXXXDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEH 656
                                  E +QL++QRQMDEE+ NL  +L+G +  +Q+ +E    
Sbjct: 571  EEEERRRREEEELHKLNEEKKFEAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNED--- 627

Query: 657  GAVNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQ 716
               N RSVS PL K++ +         D+LLRQR FSLQTRP+SRLDPG+F S+ S  ++
Sbjct: 628  ---NYRSVSVPLSKETVN---------DNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEE 675

Query: 717  YTGSEDR----AKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDR 772
               S D      KL+ +K+ILETIRRSKFLGSSFDIN+ELK A     +     K T++ 
Sbjct: 676  KPISPDEPVPNKKLDTEKMILETIRRSKFLGSSFDINRELKAAEKRVMQPPTVQKLTTE- 734

Query: 773  IISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSV 832
              + ++DE     LPK+A  +A L  ++  AE  KISDI+VPQFTRKSR F  SN+RLSV
Sbjct: 735  --NKSSDE-----LPKHAVGTAAL--NSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSV 785

Query: 833  LSMYSSKQSYTNLADLL-NEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDSSHD 891
            LSMYS++QS++NL D+L N EA    G R +P   S  + EF+FE V E+ E TG+SS+D
Sbjct: 786  LSMYSTRQSFSNLVDILKNTEAGTELGQR-TPTPHSAGDSEFIFETVNEEAEYTGNSSND 844

Query: 892  GRLYEVPE-DSNMTKEKLKLNFADRFKTSNGEDRTAEDKNV--RLPTLPPLDGKEAKGLG 948
             +LYEV + D+      +KLNFADRF     ED T   +++  +LP LPPLDGK   GLG
Sbjct: 845  DKLYEVADLDAAEKPSGMKLNFADRFNKKE-EDSTEPSRDIQNKLPVLPPLDGK--AGLG 901

Query: 949  IYQSSSESLPEPAQHNVKS-----MIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNAS 1003
            IYQ+SS   P+  +  VK       I +D  +P +  E+ S+  +    E +  +P+   
Sbjct: 902  IYQTSSPIEPQLLERPVKGDKFMETISSDNEKPEK--EIKSMIPEAVIEEPKNVSPI--E 957

Query: 1004 IPKHRTDGAQKSERMPSKE-------------GSEKKRNTSFFRKFSKSSNEKTNGEFDA 1050
            + K R D  Q+ ++ P  E               EKKR+ SFFRKFS SS      + + 
Sbjct: 958  VQKTRKD--QEHDKRPVMEKKPEVVAPKQRESDQEKKRSVSFFRKFSGSSISSNKSKAET 1015

Query: 1051 E--LYASVAAKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEM 1108
            E  L  ++AA+            W KYGLK V+S+   +T++GKLSS+NILSLRST FE+
Sbjct: 1016 EKVLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEI 1075

Query: 1109 VVWSRGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVL 1148
             V S G+ S V  RKKSGS+K + RL +EIE +  KE VL
Sbjct: 1076 KVTSNGESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVL 1115

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
            (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 1150 bits (2975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/1192 (55%), Positives = 807/1192 (67%), Gaps = 118/1192 (9%)

Query: 5    SNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKD 64
            SN+   +VKG+ IGPWKLGETLGLGSTGKVQLAY+ESTNQQAAIKVISK++F+  G+  +
Sbjct: 4    SNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSSMGN--N 61

Query: 65   SSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
            SS+ +STPDSL YGIEREIIIMKLLNHPNVLRLYDVWETN+NLYMVLEYA+KGELFNLLV
Sbjct: 62   SSMVSSTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLV 121

Query: 125  ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
            E+GPLPE EAIRFFRQI+IG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALETE
Sbjct: 122  EKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETE 181

Query: 185  DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            DKLLETSCGSPHYAAPEIVSG+PYHG  +DVWSCGVILFALLTGRLPFD+EDGNIRNLLL
Sbjct: 182  DKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241

Query: 245  QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRN 304
            +VQ G +EMPGDDEIS +AQDL+ +IL VDPE+RIK+R+ILKHPLLQKYPSI DSK+IRN
Sbjct: 242  KVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRN 301

Query: 305  LPREDTYLHPL--SEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL 362
            LPREDTYL+PL  ++G  A ID+ ILQNLVVLWHGR + +I  KLREPGANAEKTLYALL
Sbjct: 302  LPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALL 361

Query: 363  DRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSH 422
             RFK D+E +++K+ Q KKR S I+     +     + PQ     K++NR S+ISVSSSH
Sbjct: 362  YRFKVDSEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQ-----KKKNRNSVISVSSSH 416

Query: 423  KRPVSFNKLXXXXX-----XXXXXXXXXXXXXKRVSVNLSSNKRLSAV-YTNSGSPTPAS 476
            KRPVS N+L                       KR+S++LSSNK    +  +NSGSPTPA 
Sbjct: 417  KRPVSLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAP 476

Query: 477  RHKRVSIVDLERERENDTPPVPIEMLKDY----SSTAKQKRLSRNNMRLSFKPSNKRGSI 532
            R+KR+S+ +L  E  ++ PP+P++MLKDY    SS A  KR SR + RLS  P+ KRGSI
Sbjct: 477  RNKRMSVQNL--ETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSI 534

Query: 533  TTKLISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXX 592
            TTK+ISTYAKLSEDDDWE+IEKETKR SSDFATL D+IFEHEK+                
Sbjct: 535  TTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKY---------------- 578

Query: 593  XXXXXXXXXXXXXXXXXXXXXXXXDLERRQLEIQRQMDEEVANLG--------------- 637
                                    + E RQ   +RQ + E+A +                
Sbjct: 579  ------EQIRKEKEELERKVRENKEREERQ---KRQKEVELAAIAREREELQRRLEEEET 629

Query: 638  ---KELQGGMNADQDADEGDEHGAVNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSL 694
               KELQ     D    + DE    N RS+S P++        +   + +D   QR+FSL
Sbjct: 630  QITKELQ----QDTKNFQEDEVVHKNVRSISSPVEN------GNEAKSEEDASGQRSFSL 679

Query: 695  QTRPVSRLDPGV--FSSDSSEKDQYTGSEDRAKLNNDKIILETIRRSKFLGSSFDINKEL 752
            QTRPVS+LDPG+   S+   + ++    E    +++ K+ILETIRRSKFLGSSF+I+KEL
Sbjct: 680  QTRPVSKLDPGIKCGSNKPVQMEEIVEDELDKTIDSQKVILETIRRSKFLGSSFNIDKEL 739

Query: 753  KRA-ADNEAKKQRQSKA----TSDRIISTTNDEYETQILPKNATASAPLKDHNHQAEPRK 807
            K+   D E K+ R+S+      S RI+S TN++YETQ+LPKNATA   LKD + + EPRK
Sbjct: 740  KQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLPKNATAFGALKDDSEEVEPRK 799

Query: 808  ISDIKVPQFTRKSRQFGDSNKRLSVLSMYSSKQSYTNLADLLNEEASNAKGNRDSPNDQS 867
            ISDI+VPQFTRKS+ F DSNKRLSVLS+YSS QSYTNLA++L E   +   N  S N + 
Sbjct: 800  ISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVLKEGGVDIGVNEGSNNVEV 859

Query: 868  GHEPEFLFENVQEDGEVTGDSSHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAE 927
              EPEF FE V   G    ++ ++       E++      +KLN+ADRF T+   +    
Sbjct: 860  SEEPEFQFETV---GTEIENNKYEEEKEIENENNLSQGANIKLNYADRFDTAGNVNE--- 913

Query: 928  DKNVRLPTLPPL-DGKEAKGLGIYQSSS-----ESLPEPAQHNVKSMIQNDENQPSETAE 981
               V+LPTLPPL D K + GLGIY S S     ES P P+           EN+  ET  
Sbjct: 914  ---VKLPTLPPLGDDKVSDGLGIYSSKSGSEGNESKPVPSIK---------ENKSEET-- 959

Query: 982  VLSIKEDNAQVERQQEAPLNASIPKHR-TDGAQKSERMPSKEGSEKKRNTSFFRKFSK-- 1038
               +KE N     + + PLN  +PK R T      +   +K  S+K R+TSFFRK SK  
Sbjct: 960  ---LKEKNV----EPKPPLNDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGL 1012

Query: 1039 SSNEKTNGEFDAELYASVAAKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENI 1098
            +    T G +D +L+++V+              WK YGLK +KS  +  +++ +LSS+NI
Sbjct: 1013 TVQNDTTG-YDVKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNI 1071

Query: 1099 LSLRSTLFEMVVWSRGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLTK 1150
            LSLRST  +MVV+S GK S++GFRKKSGS+KTLKRL SE+EKVL KE VL K
Sbjct: 1072 LSLRSTFVDMVVFSEGKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLAK 1123

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] {ON}
            YCL024W (REAL)
          Length = 1128

 Score = 1147 bits (2966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/1167 (55%), Positives = 799/1167 (68%), Gaps = 59/1167 (5%)

Query: 3    AMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSV 62
            A++  S+  +K N IGPWKLGETLGLGSTGKVQLA ++ST Q+AA+KVISKA+FN  G+V
Sbjct: 2    AVNGNSIQAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFN-SGNV 60

Query: 63   KDSSVAAS-TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFN 121
              +S+  S TPD+LPYGIEREIIIMKLLNHPNVLRLYDVWETN++LY+VLEYA+KGELFN
Sbjct: 61   SGTSIVGSNTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120

Query: 122  LLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 181
            LLVERGPLPE EAIRFFRQI+IG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAAL
Sbjct: 121  LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 182  ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRN 241
            ETE KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVILFALLTGRLPFD+EDGNIR 
Sbjct: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRA 240

Query: 242  LLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKS 301
            LLL+VQ G +E+P DDEIS +AQDLI++ILTVDPE+RIKARDILKHPLLQKYPSI DSKS
Sbjct: 241  LLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKS 300

Query: 302  IRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYAL 361
            IR+LPREDTYL PLSE  S+ ID  ILQNLV+LWHGR+   I  KL+EPGANAEKTLYAL
Sbjct: 301  IRDLPREDTYLTPLSESNSS-IDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYAL 359

Query: 362  LDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSS 421
            L RFK DT+ + +K  Q +KR S I  V     K+  + PQ     +RRNR S+ISVSSS
Sbjct: 360  LYRFKCDTQKELIKQQQIRKRQS-IGSVSISPPKRTSTTPQ-----RRRNRESIISVSSS 413

Query: 422  HKRPVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRV 481
             K+P+SFNK                   KR+S N SS K+LS +  N  SPTP+SR+KR 
Sbjct: 414  RKKPISFNKF--TASSASSSNLTTPGSSKRLSKNFSSKKKLSTI-VNQSSPTPSSRNKRT 470

Query: 482  SIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTYA 541
            SI ++++ ++  +          +S+T K KR S++  R+S  PS KR S+TTKL+STYA
Sbjct: 471  SIANVDKNQKRASI---------FSTTKKNKRASKSTRRMSLIPSMKRESVTTKLMSTYA 521

Query: 542  KLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXXXXXXX 601
            KL+EDDDWEYIEKETKRTSS+FATL D+IFE+EK+                         
Sbjct: 522  KLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYDQIRKEKEELERKVKEAKALEELER 581

Query: 602  XXXXXXXXXXXXX---XXDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGA 658
                              +L+R+Q E+++Q+D ++++L  EL   +N  ++  EG     
Sbjct: 582  RKRKQEEKERARKLLEKEELKRKQEELKKQIDIDISDLEHEL---INHREEKFEG----- 633

Query: 659  VNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPG-VFSSDSSEKDQY 717
             N RS+S P++ +  + +  L+A+ID++LR+R FSLQTRPVSRLDPG +FSS    +D  
Sbjct: 634  -NIRSISAPMENEENN-INHLEADIDNILRRRNFSLQTRPVSRLDPGIIFSSPIETEDPV 691

Query: 718  TGSE-DRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIIST 776
               + +  +L  +K ILETIRRSKFLGSSF+I+KELK +           + + +RI+S 
Sbjct: 692  EPKKAENERLTTEKKILETIRRSKFLGSSFNIDKELKLSQMEYPGMAAPQRLSEERIVSD 751

Query: 777  TNDEYETQILPKNATASAPLKDHN--------HQAEPRKISDIKVPQFTRKSRQFGDSNK 828
            +N +YE+ +LPK+A   A LKD+            E RKISDI+VPQFTRKSR F +SNK
Sbjct: 752  SNGKYESLVLPKDAKGVAHLKDNTAPTTTELLSNGELRKISDIRVPQFTRKSRHFSESNK 811

Query: 829  RLSVLSMYSSKQSYTNLADLLNEEA--SNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTG 886
            RLSVLSMYS+K+S+TNL D+L       N + N+  P  +S  + EFLFE V E+ E TG
Sbjct: 812  RLSVLSMYSTKESFTNLVDILKNGNLDINPQQNQRVPTPRSADDSEFLFETVNEEAEYTG 871

Query: 887  DSSHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLDGKEAKG 946
            +SS+D RLY+V +     K  LKLNFADRF   NG     E KN+ LPTLPPL+GK+  G
Sbjct: 872  NSSNDERLYDVGDSCIKDKNTLKLNFADRF---NGSTNEKETKNLHLPTLPPLNGKDEAG 928

Query: 947  LGIYQSSSESLPEPAQHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNASIPK 1006
                +   E L E  Q  VKSMI  + +  S   +    +ED  +  +  E PLN S+ K
Sbjct: 929  KQGEEQEKEDLHE--QPKVKSMIP-ESDSLSHAEKEQKEREDQQRGGKDLEPPLNKSVQK 985

Query: 1007 HR---TDGAQKSERMPSKEGSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAKXXXX 1063
             R    D   K++    K       N SFFRKFSKSS  +       ELYA V+AK    
Sbjct: 986  TREKNNDTQAKNQSTDPKPNKNVSGNGSFFRKFSKSSTSEK----STELYAKVSAKQLFN 1041

Query: 1064 XXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKGSIVGFRK 1123
                    W +YGLK VKS P+ LTLTGKLSSEN+ SLRSTLFE+ ++ +GK S+V F+K
Sbjct: 1042 GLEKLLRGWNQYGLKNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIYQKGKVSVVEFKK 1101

Query: 1124 KSGSTKTLKRLVSEIEKVLLKERVLTK 1150
             SGS KT+K+LV E+E VL KE VL K
Sbjct: 1102 ISGSFKTVKKLVKEVENVLNKEGVLQK 1128

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_5.591
            YDR466W
          Length = 1117

 Score = 1141 bits (2951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/1179 (54%), Positives = 806/1179 (68%), Gaps = 99/1179 (8%)

Query: 3    AMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSV 62
            A + +++PT+KG+ IGPWKLGETLGLGSTGKVQLA++E+TNQQAAIK+ISK+IFN K + 
Sbjct: 5    AENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNS 64

Query: 63   KDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNL 122
             ++S+ A+TPDSLPYGIEREIIIMKLL H NVL LYDVWETNSNLYM+LEYA+KGELFNL
Sbjct: 65   NETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNL 124

Query: 123  LVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 182
            LVE+GPLPEKEA+RFFRQI+IGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE
Sbjct: 125  LVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 184

Query: 183  TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNL 242
            TEDKLLETSCGSPHYAAPEIVSGIPYHGF SDVWSCGVILFALLTGRLPFD+EDGNIRNL
Sbjct: 185  TEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNL 244

Query: 243  LLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSI 302
            LL+VQSG++EMP DDE+S DAQDLI+RILTVDP +RIK R+ILKHPLLQKYPSI DSKSI
Sbjct: 245  LLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSI 304

Query: 303  RNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL 362
            +NLPREDTYL PLS+  S  ID +ILQNLVVLWHGR++ +I  KL+E GANAEKT+YALL
Sbjct: 305  KNLPREDTYLFPLSDNNSV-IDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALL 363

Query: 363  DRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSH 422
             RFK + EN S K  Q K++ S I        KK+ +   T   P+++NR S +SVSSS 
Sbjct: 364  YRFKIEAENLSAKQEQVKRKQSII--------KKSTANVST--PPRKKNRISTMSVSSSR 413

Query: 423  KRPVSFNKLXXXXXXXXX----------XXXXXXXXXKRVSVNLSSNKRLSAVYT----- 467
            KRPVSFN+L                            KR+S+NLSSNKRLS +       
Sbjct: 414  KRPVSFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRLSINLSSNKRLSNLLVQGHSN 473

Query: 468  -NSGSPTPASRHKRVSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPS 526
             NS SPTP SR KR+S+++L+    +  PP+P+ +LKDY + +   +  R + RL+F  +
Sbjct: 474  GNSNSPTP-SRSKRISLINLD---NSTAPPIPVNVLKDYKNKSSSSKNKRASKRLTFLGN 529

Query: 527  NKRGSITTKLISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXX 586
             KRGSITTKL+STYAKLSEDD+WEYIEKETKRTSSDFATL D+IFEHEK+          
Sbjct: 530  GKRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEEL 589

Query: 587  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLERRQLEIQRQMDEEVANLGKELQGGMNA 646
                                          +LER+QLE+Q  +D+E++NL  +L    N 
Sbjct: 590  ARKVREAKEGEARERREQESEKQRKQREREELERQQLELQNHIDQEISNLKADL---ANE 646

Query: 647  DQDADEGDEHGAVNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGV 706
             + A+  +     N RSVS PL+++  +P A ++ +I+DL  +R  SLQTRP SRLDPG+
Sbjct: 647  TKGAEPYE-----NPRSVSAPLERE--NPEA-IERDINDLFARRNVSLQTRPKSRLDPGI 698

Query: 707  FSSDSSEK-DQYTGSEDRAKLNNDKIILETIRRSKFLGSSFDINKEL----KRAADNEAK 761
              S  +E       S+   +++ +K ILETIRRS+FLGSS++INKEL    K A    +K
Sbjct: 699  LYSAPAETVSNPLLSDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKTALAETSK 758

Query: 762  KQRQSKATSDRIISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSR 821
            K+++SK TS  I++   D+    ++P N T          +A  RKIS+IKVPQFTRKSR
Sbjct: 759  KEKRSKVTSQNIVA---DKAAIGVIPLNDT----------EAGLRKISEIKVPQFTRKSR 805

Query: 822  QFGDSNKRLSVLSMYSSKQSYTNLADLLNEEASN-AKGNRDSPNDQSGHEPEFLFENVQE 880
             F +SN+RLSVLSMYS+KQSYTNL D+L E   N A    ++   ++  EPEF FE+V E
Sbjct: 806  HFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNLASEANNTTTSKASTEPEFQFESVNE 865

Query: 881  DGEVTGDSSHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLD 940
                 G ++    L E PE +++ KE             +G+ +    KNV+LPTLPPL 
Sbjct: 866  -----GTANKLYELQEEPEYTDVNKE-------------DGKPK----KNVKLPTLPPLH 903

Query: 941  GK--EAKGLGIYQSSSESLPEPA--QHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQ 996
             K  +A GL IYQSSS+   +P   Q   +SMI   ++  + +A V    +    VE + 
Sbjct: 904  EKTNQANGLAIYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASV----KKTPVVEPES 959

Query: 997  EAPLNASIPKHRTDGAQKSERMPSKE---GSEKKRNTSFFRKFSKSSNEKT---NGEFDA 1050
            +A    + PK R    ++ ER P  E     EKKRN SFFRKFSKSS   T   NG FD 
Sbjct: 960  QATKKINKPKQR-QPKKEEERKPLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNG-FDY 1017

Query: 1051 ELYASVAAKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVV 1110
            E+Y +V+A             W KYGLK VKS  + + LTGKLS++NILSLRST+FEM+V
Sbjct: 1018 EVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIV 1077

Query: 1111 WSRGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLT 1149
             S+GK S+VGF K SGS+KT++RL  EIEKVL +E VL+
Sbjct: 1078 ESKGKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVLS 1116

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
            GIN4Protein kinase involved in bud growth and assembly of
            the septin ring, proposed to have kinase-dependent and
            kinase-independent activities; undergoes
            autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 1132 bits (2928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/1187 (53%), Positives = 796/1187 (67%), Gaps = 85/1187 (7%)

Query: 3    AMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSV 62
            A++  S+P +K N IGPWKLGETLGLGSTGKVQLA + ST Q+AA+KVISKA+FN     
Sbjct: 2    AINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVS 61

Query: 63   KDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNL 122
              S V ++TPD+LPYGIEREIIIMKLLNHPNVLRLYDVWETN++LY+VLEYA+KGELFNL
Sbjct: 62   GTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121

Query: 123  LVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 182
            LVERGPLPE EAIRFFRQI+IG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE
Sbjct: 122  LVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181

Query: 183  TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNL 242
            TE KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVILFALLTGRLPFD+EDGNIR L
Sbjct: 182  TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241

Query: 243  LLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSI 302
            LL+VQ G +EMP DDEIS +AQDLI +ILTVDPE+RIK RDILKHPLLQKYPSI DSKSI
Sbjct: 242  LLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSI 301

Query: 303  RNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL 362
            R LPREDTYL PLSE  S+ ID  ILQNLV+LWHGR+   I  KLREPGANAEKTLYALL
Sbjct: 302  RGLPREDTYLTPLSESNSS-IDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360

Query: 363  DRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSH 422
             RFK DT+ + +K  Q KKR   I+ V    +KK  + PQ     +RRNR S+ISV+SS 
Sbjct: 361  YRFKCDTQKELIKQQQVKKR-QSISSVSVSPSKKVSTTPQ-----RRRNRESLISVTSSR 414

Query: 423  KRPVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRVS 482
            K+P+SFNK                   KR+S N SS K+LS +  N  SPTPASR+KR S
Sbjct: 415  KKPISFNKF--TASSASSSNLTTPGSSKRLSKNFSSKKKLSTI-VNQSSPTPASRNKRAS 471

Query: 483  IVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTYAK 542
            ++++E+ ++  +          +S+T K KR SR+  R+S  PS KR S+TTKL+STYAK
Sbjct: 472  VINVEKNQKRASI---------FSTTKKNKRSSRSIKRMSLIPSMKRESVTTKLMSTYAK 522

Query: 543  LSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXXXXXXXX 602
            L+EDDDWEYIEKETKRTSS+FATL D+IFE+EK+                          
Sbjct: 523  LAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERR 582

Query: 603  XXXXXXXXXXXX---XXDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGAV 659
                             DL+R+Q E+++Q++ ++++L +EL        D          
Sbjct: 583  RRKQEEKERARKLLEKEDLKRKQEELKKQIEIDISDLEQELSKHKEEKLDG--------- 633

Query: 660  NGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGV-FSSDSSEKDQYT 718
            N RS+S P++ +  + +  L+ +ID++LR+R FSLQTRPVSRLDPG+ FSS + E     
Sbjct: 634  NIRSISAPMENEEKN-INHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVE 692

Query: 719  GSE-DRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIISTT 777
                +  +L  +K ILETIRRSKFLGSSF+I+KELK +           + + +R++S +
Sbjct: 693  PKRTENERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRLSEERVVSDS 752

Query: 778  NDEYETQILPKNATASAPLKDHNHQAEP------RKISDIKVPQFTRKSRQFGDSNKRLS 831
            ND YE+ ILPK+    + LKD      P      RKIS+I+VPQFTRKSR F +SNKRLS
Sbjct: 753  NDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLS 812

Query: 832  VLSMYSSKQSYTNLADLL---NEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDS 888
            VLSMYS+K+S+TNL D+L   N + +N +  R  P  +S  + EFLFE V E+ E TG+S
Sbjct: 813  VLSMYSTKESFTNLVDILKNGNLDVNNQQSQR-IPTPRSADDSEFLFETVNEEAEYTGNS 871

Query: 889  SHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLDG-KEAKGL 947
            S+D RLY+V + +   K  LKLNFADRF   NG +   +  N+ LP LPPL+G  E +  
Sbjct: 872  SNDERLYDVGDSTIKDKSALKLNFADRF---NGSNEAKQTDNLHLPILPPLNGDNELRK- 927

Query: 948  GIYQSSSESLPEPAQHNVKSMIQNDENQPSETAEVLSI-----------KEDNAQVERQQ 996
               Q+S E   + A   +KSMI  +    S T +               K++  Q +R++
Sbjct: 928  ---QNSQEG--DQAHPKIKSMIP-ESGSSSHTEKEEENEEKEEKKPEQHKQEEDQEKREK 981

Query: 997  -----EAPLNASIPKHRTDGAQKSERMPSKEGSEKKR--------NTSFFRKFSKSSNEK 1043
                 E PLN S+ K R   A    +  SK+  ++ +        N SFFRKFSKSS++ 
Sbjct: 982  VVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHKQDKNTAIGNGSFFRKFSKSSDK- 1040

Query: 1044 TNGEFDAELYASVAAKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRS 1103
                   ELYA ++AK            W +YGLK +KS P+ LTLTGKLSS+NI SLRS
Sbjct: 1041 -----TMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRS 1095

Query: 1104 TLFEMVVWSRGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLTK 1150
            TLFE+ ++ RGK S+V F+K SGS K +K+LV+E+E VL KE VL K
Sbjct: 1096 TLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVLQK 1142

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 1131 bits (2925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1220 (53%), Positives = 797/1220 (65%), Gaps = 99/1220 (8%)

Query: 11   TVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAAS 70
            T+K +KIGPWKLG  LG GS GKV +A  E+T QQAA+K++SK+IF        S++  S
Sbjct: 17   TLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGS 76

Query: 71   T-PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPL 129
              PD LPYGIEREIIIMKLLNH NVLRLYDVWET SNLYMVLEY +KGELFNLLVERGPL
Sbjct: 77   NDPDLLPYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLVERGPL 136

Query: 130  PEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE 189
            PE EA+RFFRQI+IGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE++DKLLE
Sbjct: 137  PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLE 196

Query: 190  TSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSG 249
            TSCGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFD+++GNIR+LLL+VQSG
Sbjct: 197  TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIRSLLLKVQSG 256

Query: 250  RYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPRED 309
             YEMPG+DEIS +AQDLIA+ILTVDP++RIK R+ILKHPLLQKYPSI DSKSIRNLPRED
Sbjct: 257  EYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKSIRNLPRED 316

Query: 310  TYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFKSDT 369
            TYL+PL  G+ + ID+ ILQNLVVLWHGR++ EI+ KL EPGAN EKT Y LL RFK D 
Sbjct: 317  TYLNPLDHGDGS-IDDGILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYVLLFRFKHDV 375

Query: 370  ENDSVKHPQSK------------------KRVSQINPVRQPTTKKAPSK------PQTNA 405
                 +  Q +                  ++   ++P +    K A  K           
Sbjct: 376  HQQQQQQQQQQQQQQQQQQQQQQQQQQQSRQSGYVSPKKLAMKKSASRKSITSTSLSGTT 435

Query: 406  SPKRRNRTSMISVSSSHKRPVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAV 465
            +PK++NR SMISVSSSHKRPVSFNKL                  KR+S++LSS+KRLSA+
Sbjct: 436  TPKKKNRVSMISVSSSHKRPVSFNKL-STAGKSDSACGTPGSSTKRMSISLSSSKRLSAM 494

Query: 466  YTNSGSPTPASRHKRVSIVDLERERENDTPPVPIEMLKDYSST----AKQKRLSRNNMRL 521
              N+ SPTPA  +KR+S+ D+    ++  PPVP+++L DY+S        KR SR + RL
Sbjct: 495  GPNT-SPTPA--NKRMSVRDM----DSSAPPVPMDVLNDYTSALPNRKATKRASRASKRL 547

Query: 522  SFKPSNKRGSITTKLISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXX 581
            SF P+ KRGSITTKLI+TYAKLSE+DDWEYIEKETKRTS+DFATLCDQIFEHEK+     
Sbjct: 548  SFLPNIKRGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCDQIFEHEKYEQIRK 607

Query: 582  XXXX---------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLERRQLEIQRQMDEE 632
                                                          + +Q E+Q  M +E
Sbjct: 608  EKQELERKVREAKEREERERRKRQEEQEEQERKRRAEEERVLRELEDAKQQELQELMAKE 667

Query: 633  VANLGKELQGGMNADQDADEGDEHGAVNGRSVSEPLQKKSA------DPMADLQANIDDL 686
            VA L  +        +   E +E GA   R VS P+   SA      D +A L  +IDDL
Sbjct: 668  VAMLRADY------GEPQTEPEEQGASKNRCVSAPIASSSAKDDGKRDSIARLSGDIDDL 721

Query: 687  LRQRTFSLQTRPVSRLDPGVFSSDSSEKDQYTGSE--DRAKLNNDKIILETIRRSKFLGS 744
            L++RT SLQTRPVSRLDPG+ ++++     Y  ++  D   L  +K ILETIRRS+FLGS
Sbjct: 722  LKRRTVSLQTRPVSRLDPGIVAAENLGSVIYEEADGVDETTLRTEKTILETIRRSRFLGS 781

Query: 745  SFDINKELKRAADNE----AKKQRQSKATSDRIISTTNDEYETQILPKNATASAPLKDHN 800
            SFDI KEL+RA   +    A++ +Q   +S    S TND YE++ LPKNA A   L D  
Sbjct: 782  SFDIKKELERAQRKKEEALARQHQQRILSSATAASATNDAYESRALPKNAAAVDTLNDER 841

Query: 801  HQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMYSSKQSYTNLADLLNEEASNAKGNR 860
            +  EPRKIS+IKVPQFTR+SR F  SNKRLSVLSMYS+K S+TNLAD L   A   + + 
Sbjct: 842  N-PEPRKISEIKVPQFTRRSRHFTASNKRLSVLSMYSTKSSFTNLADHLKGGADLQEVSG 900

Query: 861  DSPN-DQSGHEPEFLFENV-QEDGEVTGDSSHDGRLYEVPEDS----NMTKEKLKLNFAD 914
             +P+  +   EPEFLFE+V +ED E T D++ D RLYEVP+ S      TK  ++LNFAD
Sbjct: 901  SAPSTTKITQEPEFLFESVHEEDSEETPDTTADSRLYEVPDGSESSKTSTKAAMRLNFAD 960

Query: 915  RFKTSNGEDRTAEDKNVRLPTLPPLD---GKEAKGLGIYQSSSESLPEP------AQHNV 965
            RF T  G++      +V+LP LPPL+    K+  GLGIYQS      +P       +  V
Sbjct: 961  RFNTRAGDNPA----DVKLPPLPPLEKNGSKKPNGLGIYQSPERPRADPNPTSMVHEPKV 1016

Query: 966  KSMIQND------ENQPSETAEV---LSIKEDNAQVERQQEAPLNASIPKHRTDGAQKSE 1016
             SMI +D        +P+E+  V    + K +        +AP  AS P       + ++
Sbjct: 1017 FSMIPDDIAGPAKSTKPAESENVPTSATKKSEPKNALHSADAP-EASQPPLNGMMRKNND 1075

Query: 1017 RMPSKE---GSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAKXXXXXXXXXXXXWK 1073
            R P ++    +EKKRN SFFRKFS+SS EK +  FDA+L  SV A             WK
Sbjct: 1076 RKPLEDITPAAEKKRNRSFFRKFSRSSEEKKSDNFDAKLNTSVEAVQMFNALGKLLGGWK 1135

Query: 1074 KYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVW-SRGKGSIVGFRKKSGSTKTLK 1132
             YGLK V+      T+TGKLSS+NILSLRST+FE++V     KGS+V F KKSGSTKT K
Sbjct: 1136 DYGLKEVRVQGPTKTITGKLSSDNILSLRSTMFEILVRDDSSKGSVVWFVKKSGSTKTFK 1195

Query: 1133 RLVSEIEKVLLKERVLTKES 1152
            RLV E+EKVL +E VLT  S
Sbjct: 1196 RLVKEVEKVLERENVLTSTS 1215

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] {ON}
            YDR507C (REAL)
          Length = 1135

 Score = 1127 bits (2914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/1184 (53%), Positives = 789/1184 (66%), Gaps = 86/1184 (7%)

Query: 3    AMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSV 62
            A++  SVP +K N IGPWKLGETLGLGSTGKVQLA ++ST Q+AA+KVISKA+FN     
Sbjct: 2    AVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMS 61

Query: 63   KDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNL 122
              S V + TPD+LPYGIEREIIIMKLLNHPNVLRLYDVWETN++LY+VLEYA+KGELFNL
Sbjct: 62   GTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121

Query: 123  LVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 182
            LVERGPLPE EAIRFFRQI+IG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE
Sbjct: 122  LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181

Query: 183  TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNL 242
            TE KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVILFALLTGRLPFD+EDGNIR L
Sbjct: 182  TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241

Query: 243  LLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSI 302
            LL+VQ G++E+P DDE+S +AQDLI +ILTVDP++RIKARDILKHPLLQKYPSI DSKSI
Sbjct: 242  LLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSI 301

Query: 303  RNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL 362
            R LPREDTYL PLSE  S+ ID  ILQNLV+LWHGR+   I  KL+EPGANAEKTLYALL
Sbjct: 302  RGLPREDTYLTPLSESNSS-IDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360

Query: 363  DRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRR-NRTSMISVSSS 421
             RFK DT+ + ++  Q KKR S         +  +P+K  T  +P+RR NR S+ISV+SS
Sbjct: 361  YRFKCDTQKELIRQQQIKKRQSI-----SSVSTSSPNKIST--TPQRRKNRESIISVTSS 413

Query: 422  HKRPVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRV 481
             K+P+SFNK                   KR+S N SS KRLS +  N  SPTPASR+KR 
Sbjct: 414  RKKPISFNKF--TASSASSSNLTTPGSSKRLSKNFSSKKRLSTI-VNQASPTPASRNKRT 470

Query: 482  SIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTYA 541
            SI+++++ +   +          +S+  + K+ SR+  +LS  PS KR S+TTKL+STYA
Sbjct: 471  SIINVDKNQRRASV---------FSTAKRNKKTSRSTKKLSLIPSMKRESVTTKLMSTYA 521

Query: 542  KLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXX---XXXXXXXXXXXXX 598
            KL+ DDDWEYIEKETKRTSS+FATL D+IFE+EK+                         
Sbjct: 522  KLAADDDWEYIEKETKRTSSNFATLIDEIFEYEKYEKIRKEKKELELKVREAKAREELER 581

Query: 599  XXXXXXXXXXXXXXXXXXDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGA 658
                              +L+R+Q E+++Q++ ++++L  EL        D         
Sbjct: 582  RKRKQEEKEHSRKVLEKEELKRKQQELKKQIEIDISDLEHELSKHKEEKPDG-------- 633

Query: 659  VNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQYT 718
             N RS+S P++ +  + +  L+ +ID++LR+R FSLQTRPVSRLDPG+  S   EK+   
Sbjct: 634  -NIRSISAPMESEEKN-INHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESAV 691

Query: 719  GSE--DRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIIST 776
              +  +  +L  +K ILETIRRSKFLGSSF+I KELK +           + + +RI+S 
Sbjct: 692  EPKRTENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVSD 751

Query: 777  TNDEYETQILPKNATASAPLKDHN--------HQAEPRKISDIKVPQFTRKSRQFGDSNK 828
             +D+Y + +LPK+A   + L+DH            E RKIS+++VPQFTRKSR F +SNK
Sbjct: 752  PSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNK 811

Query: 829  RLSVLSMYSSKQSYTNLADLL---NEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVT 885
            RLSVLSMYSSK+S+TNL D+L   N +    +  R  P  +S  + EFLFE V E+ E T
Sbjct: 812  RLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQR-IPTPKSADDSEFLFETVNEEAEYT 870

Query: 886  GDSSHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLDG---- 941
            G+SS+D RLY+V + +   K  LKLNFADRF  S  E  T   +N+ LPTLPPL+G    
Sbjct: 871  GNSSNDERLYDVGDSTIKDKSALKLNFADRFNASTNEKET---ENLHLPTLPPLNGGDEV 927

Query: 942  ---KEAKGLGIYQSSSESLPEPAQHNVKSMI-QNDENQPSETAEVLSI--------KEDN 989
               K+   LGI            Q  VKSMI Q+D +  +   E            +E +
Sbjct: 928  NKQKDEDVLGI------------QPKVKSMIPQSDSSSHTGKEEEKEEKGEEGREDQEKD 975

Query: 990  AQVERQQEAPLNASIPKHRTD--GAQ-KSERMPSKEGSEKKRNTSFFRKFSKSSNEKTNG 1046
            A+  +  E PLN S+ K R +  G Q KS     K+      N SFFRKFSKSS      
Sbjct: 976  AKGAKDIEPPLNKSVQKTRANDSGPQVKSHPREPKKDRNISGNGSFFRKFSKSS----TS 1031

Query: 1047 EFDAELYASVAAKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLF 1106
            +   ELYA V+AK            W +YGLK +KS P+ LTLTGKLSSENI SLRSTLF
Sbjct: 1032 DKSVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLF 1091

Query: 1107 EMVVWSRGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLTK 1150
            E+ ++ RGK S+V F+K SG+ K +K+LV+E+E VL KE VL K
Sbjct: 1092 EISIYPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] {ON}
            YDR507C (REAL)
          Length = 1136

 Score = 1121 bits (2899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/1178 (53%), Positives = 788/1178 (66%), Gaps = 73/1178 (6%)

Query: 3    AMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSV 62
            A++  SVP +K N IGPWKLGETLGLGSTGKVQLA ++ST Q+AA+KVISK +FN     
Sbjct: 2    AVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNVS 61

Query: 63   KDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNL 122
              S V ++TPD+LPYGIEREIIIMKLLNHPNVLRLYDVWETN++LY+VLEYA+KGELFNL
Sbjct: 62   GTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFNL 121

Query: 123  LVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 182
            LVERGPLPE EAIRFFRQI+IG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE
Sbjct: 122  LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181

Query: 183  TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNL 242
            TE KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVILFALLTGRLPFD+EDGNIR L
Sbjct: 182  TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241

Query: 243  LLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSI 302
            LL+VQ G +E+P DDEIS +AQDLI+RILTVDPE+RIK RDILKHPLLQKYPSI DSKSI
Sbjct: 242  LLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKSI 301

Query: 303  RNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL 362
            R LPREDTYL PLSE  S+ ID  ILQNLV+LWHGR+   I  KLRE GANAEKTLYALL
Sbjct: 302  RGLPREDTYLTPLSESNSS-IDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALL 360

Query: 363  DRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSH 422
             RFK DT+ + VK  Q KKR   I+ +    +KK  + PQ     +R+NR SMISVSSS 
Sbjct: 361  YRFKCDTQKELVKQQQIKKR-QSISSLSISPSKKLSTTPQ-----RRKNRESMISVSSSR 414

Query: 423  KRPVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRVS 482
            K+P+SFNK                   KR+S N SS K+LS +  N  SPTPASR+KR S
Sbjct: 415  KKPISFNKF--TASSASSSNLTTPGSSKRLSKNFSSKKKLSTI-VNQSSPTPASRNKRAS 471

Query: 483  IVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTYAK 542
            ++++E+ ++  +          +S+  K KR S++  R+S  PS KR S+TTKL+STYAK
Sbjct: 472  VINIEKNQKRASV---------FSTAKKNKRTSKSIKRMSLIPSMKRESVTTKLMSTYAK 522

Query: 543  LSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXXXXXXXX 602
            L+EDDDWEYIEKETKRTSS+FATL D+IFE+EK+                          
Sbjct: 523  LAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERR 582

Query: 603  XXXXXXXXXXXX---XXDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGAV 659
                             +L+ +Q E+++Q++ ++++L +EL        D          
Sbjct: 583  RRRQEEKERTRKLLEKEELKMKQEELKKQIEMDISDLEQELSRHKEEKPDG--------- 633

Query: 660  NGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQYTG 719
            N RS+S P++ +  + +  L  +ID++LR+R FSLQTRPVSRLDPG+  S+  E   Y  
Sbjct: 634  NIRSISAPMENEEKN-IDHLGTDIDNILRRRNFSLQTRPVSRLDPGIVFSNPIE-TVYPV 691

Query: 720  SEDRA---KLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIIST 776
               R+   +L  +K ILETIRRSKFLGSSF+I KELK +           K + +R++S 
Sbjct: 692  EPKRSENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSVLAPEKLSGERVVSD 751

Query: 777  TNDEYETQILPKNATASAPLKD--------HNHQAEPRKISDIKVPQFTRKSRQFGDSNK 828
             N +YE+ ILPK+A   + LKD        H    + RKIS+++VPQFTRKSR F +SNK
Sbjct: 752  LNGKYESLILPKDAKGVSQLKDDITSTTTEHLSDGKLRKISEVRVPQFTRKSRHFSESNK 811

Query: 829  RLSVLSMYSSKQSYTNLADLL---NEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVT 885
            RLS+LSMYS+K+S+TNL D+L   N + +N +  R  P  +S  + EFLFE V E+ E T
Sbjct: 812  RLSLLSMYSTKESFTNLVDILKNSNLDVNNQQSQR-IPTPRSADDSEFLFETVNEEAEYT 870

Query: 886  GDSSHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLDGKEAK 945
            G+SS+D RLY+V + +   K  LKLNFADRF   N      E  N+ LP+LPPL G +  
Sbjct: 871  GNSSNDERLYDVGDSTIKDKTALKLNFADRF---NESTEYKETDNLHLPSLPPLSGDDE- 926

Query: 946  GLGIYQSSSESLPEPAQHNVKSMI-QNDENQPSETAEVLSIKEDNAQVERQQEA-----P 999
             +    S  +SL +P    VKSMI Q+D +  +E  E    +    Q E ++EA     P
Sbjct: 927  -MRKQNSEEDSLVQP---KVKSMIPQSDSSSHTEKVEEKEGESQEVQEESEKEAKDIEPP 982

Query: 1000 LNASIPKHRTDGA-------QKSERMPSKEGSEKKRNTSFFRKFSKSSNEKTNGEFDAEL 1052
            LN S+ K R           Q+      K+      N+SFFRKFSKSS      +   EL
Sbjct: 983  LNKSVQKLREKNPGPQEKDHQRDHLKEHKQDRNTTGNSSFFRKFSKSS----ASDKLVEL 1038

Query: 1053 YASVAAKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWS 1112
            YA V+A+            W ++GLK +KS P+ LTLTGKLSSENI SLRSTLFE+ ++ 
Sbjct: 1039 YAKVSARQLFNGLEKLLRGWTQFGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEINIYP 1098

Query: 1113 RGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLTK 1150
            +G+ S+V F+K SGS K +K+LV+E+E VL KE VL K
Sbjct: 1099 KGRMSVVQFKKISGSFKAVKKLVNEVENVLNKEGVLQK 1136

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 1120 bits (2897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/1186 (53%), Positives = 798/1186 (67%), Gaps = 82/1186 (6%)

Query: 8    SVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSS- 66
            ++ T+KG+KIGPWKLG TLG GSTGKV +A  EST QQAA+K++SK+IF   G+  +SS 
Sbjct: 14   TLTTLKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIF---GNQSNSST 70

Query: 67   -VAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVE 125
             V ++ PD LPYGIEREIIIMKLLNHPNVLRLYDVWETNS+LYMVLEY +KGELFNLLV+
Sbjct: 71   IVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVD 130

Query: 126  RGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED 185
            RGPLPE EA+RFFRQI+IGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE++D
Sbjct: 131  RGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKD 190

Query: 186  KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQ 245
            KLLETSCGSPHYAAPEIVSG+PYHGF SDVWSCG+ILFALLTGRLPFD+EDGNIRNLLL+
Sbjct: 191  KLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK 250

Query: 246  VQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNL 305
            VQSG++EMP  +EIS +AQDLIA+ILTVDP  RIK+R ILKHPLLQKYPSI DSKSIRNL
Sbjct: 251  VQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSIRNL 310

Query: 306  PREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRF 365
            PREDTYL+PL +     ID+ I+ NLVVLWHGR++ EI NKL+EPGAN EKT YALL RF
Sbjct: 311  PREDTYLNPL-DSVDGTIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRF 369

Query: 366  KSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSHKRP 425
            K D++ + +K  Q + +  Q++P +    K    +   + +PK++ R  +IS SSSHKRP
Sbjct: 370  KHDSQQEQLKQ-QRRSQAMQVSPKKTGLRKSNSRRSINSTTPKKKTRAPVISASSSHKRP 428

Query: 426  VSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRVSIVD 485
            VSF++L                  KR SVNLSSNKR+SA+   + SPTPAS  KR S+  
Sbjct: 429  VSFSRL-SYSNGSNTDHNTPNSSGKRSSVNLSSNKRISALINPNSSPTPAS--KRASL-- 483

Query: 486  LERERENDTPPVPIEMLKDYSSTAKQ--KRLSRNNMRLSFKPSNKRGSITTKLISTYAKL 543
              RE +   PP+P++MLKDY+  A +  ++ SR + RLSF P NKRGSITTKLI+TYAK+
Sbjct: 484  --RELDPSAPPIPVDMLKDYNKAAPKANRKSSRISKRLSFLPGNKRGSITTKLIATYAKI 541

Query: 544  SEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXXXXXXXXX 603
            SED+DWEYIEKETKRTS+DFATLCD+IFEHEK+                           
Sbjct: 542  SEDNDWEYIEKETKRTSADFATLCDEIFEHEKYEQIRREKEELERRVREAKEQEERERRQ 601

Query: 604  XXXXXXXXXXXXXDLER--------RQLEIQRQMDEEVANL--GKELQGGMNADQDADEG 653
                           +R        RQ E+Q  +D E+A L  G E   G++ +++    
Sbjct: 602  REEEERRQREEELARQREFEEERYHRQREVQENIDREMALLKEGYETSSGVDPNKN---- 657

Query: 654  DEHGAVNGRSVSEPLQ------KKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVF 707
                    RSVS P++      K+S+  M  L  +I DLL +RTFSL+TRP SRLDPG++
Sbjct: 658  --------RSVSAPVESVLKVDKRSS--MDALDGDIMDLLNRRTFSLETRPKSRLDPGIY 707

Query: 708  S-SDSSEKDQYTGSEDRAKLNNDKIILETIRRSKFLGSSFDINKEL---KRAADNEAKKQ 763
            +  +    D   G  D   L  +K ILETIRRSKFLGSSFDINKEL   +R  +  A   
Sbjct: 708  TLEEVPNSDIKDGGRD---LKTEKTILETIRRSKFLGSSFDINKELARERRLKEERAAAL 764

Query: 764  RQSKATSDRIIST-----TNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTR 818
            +Q K   DR++S      + + YE Q LPKNA A+    D    ++PRKIS+++VPQFTR
Sbjct: 765  KQRKK-EDRVVSNATGNYSENGYEPQTLPKNAAATKISNDAG--SDPRKISEVQVPQFTR 821

Query: 819  KSRQFGDSNKRLSVLSMYSSKQSYTNLADLLNEEASNAKGNRDSPNDQSGHEP--EFLFE 876
            +SR F  SNKRLSVLSMYS+K S+TNLAD L  + ++ +    SP   S  EP  EF+FE
Sbjct: 822  RSRHFTASNKRLSVLSMYSTKASFTNLADHLRGK-TDLQSINGSPPSTSRMEPETEFMFE 880

Query: 877  NVQEDGEVTGDSSHDGRLYEVPEDSN---MTKEKLKLNFADRF-KTSNGEDRTAEDKN-V 931
            +V  +G+ T D+S D RLYEV E ++     +  ++LNFADRF K ++   ++ ED N +
Sbjct: 881  SVDGEGKETADTSADSRLYEVAEGNDPKGAARSAVRLNFADRFNKPTSPPPQSVEDPNGI 940

Query: 932  RLPTLPPLDGKEA---KGLGIYQSSSESLPEPAQHNVKSMIQNDENQPSETAEVLSIKED 988
            +LP+LPPLD  ++    GLG+YQ +S+S      H  KSMI  D  Q  E AE  +  E+
Sbjct: 941  KLPSLPPLDKAKSDGVNGLGLYQPASDSSETEIHHQPKSMIPVDAEQ-KEAAE--AKPEE 997

Query: 989  NAQVE----RQQEAPLNASIPKHRTDGAQKSERMPSKEGSEKKRNTSFFRKFS-KSSNEK 1043
              QV         APLN  + K+    A+K++       + KK N SFFR+FS KS +EK
Sbjct: 998  QKQVPPKDVESAPAPLNKVMKKNTE--AEKNQPNQPAPNAVKKNNKSFFRRFSGKSDDEK 1055

Query: 1044 TNGEFDAELYASVAAKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRS 1103
              GE+D +    +               WK YGLK V + P +  + GK+SS+N+LSLRS
Sbjct: 1056 RPGEYDFKFDTVIEGTQMFNALSKLLAAWKDYGLKDVVASPSQKKIKGKMSSDNMLSLRS 1115

Query: 1104 TLFEMVVWSRGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLT 1149
            TLFE+ + S+G+GSIVGF KKSGSTKT K+LV EIEK+L  ++ L 
Sbjct: 1116 TLFEISIVSKGEGSIVGFTKKSGSTKTFKKLVKEIEKILESKKALV 1161

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
            YDR507C
          Length = 1125

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/1170 (52%), Positives = 780/1170 (66%), Gaps = 75/1170 (6%)

Query: 4    MSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVK 63
            ++N++ PT+KG++IG WK+GETLGLGSTGKVQLAY+++T  QAAIKVISK IF  + S  
Sbjct: 2    ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIF--QDSNV 59

Query: 64   DSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLL 123
             S V  +TPD+LPYGIEREI+IMKLLNH NVLRLYDVWETNSNLYMVLEYA+KGELFNLL
Sbjct: 60   TSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119

Query: 124  VERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 183
            VERGPLPE EAIRFFRQI+IGISYCHALGIVHRDLKPENLLLD K+NIKIADFGMAALET
Sbjct: 120  VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179

Query: 184  EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLL 243
            EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVIL+ALLTGRLPFD+EDGNIRNLL
Sbjct: 180  EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239

Query: 244  LQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIR 303
            L+VQ+G++EMP DDEIS +AQ+LI++IL V+P +RI ARDILKHPLLQKYPSI DSKSIR
Sbjct: 240  LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIR 299

Query: 304  NLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLD 363
            NLPREDTYLHPL+E  SA IDENILQNLVVLWHGR+  EI  KL+E GANAEKTLYA+L+
Sbjct: 300  NLPREDTYLHPLAETNSA-IDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLN 358

Query: 364  RFKSDTE-----NDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISV 418
            RFK D E     N+ +K+ QS  + + + P    +T    S    N +P+++NR S+ISV
Sbjct: 359  RFKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISV 418

Query: 419  SSSHKRPVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRH 478
            +SSHKRP+SF KL                  +R  ++  S   +S V   +GSPTPASR 
Sbjct: 419  TSSHKRPISFQKLPTLNSTSSLAAITPSTSARRKRLSKISGYPVSNV---NGSPTPASRK 475

Query: 479  KRVSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLIS 538
            KR S+ +++  R +         +K  ++  K  R S+   R+S  P+NK G+I +KLIS
Sbjct: 476  KRNSMANIQAARSS--------TIKKTNTFKKNNRASK---RVSILPNNKNGTIASKLIS 524

Query: 539  TYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXXXX 598
            TYAKLSEDD+WEY+E+ETKRTSS+FATL D+IFEHEK+                      
Sbjct: 525  TYAKLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIRKEKEELARKVREAKEREE 584

Query: 599  XXXXXXXXXXXXXXXXXXDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGA 658
                                E    + QR M+EE+ NL KEL          D     G 
Sbjct: 585  AERKQKELQEREKQRERERKENETNDRQRIMEEEIENLKKEL----------DMMSHEGK 634

Query: 659  VNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKD--- 715
               RSVSEPL KK       ++  + +LLRQR  +LQTRP SRLDPG+F  DS+E D   
Sbjct: 635  TESRSVSEPLNKK----QGGVEIEVKELLRQRNAALQTRPKSRLDPGLF-FDSAESDTRN 689

Query: 716  ---QYTGSEDRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDR 772
               Q    E   KL  +K ILETIRRSKFLGSSFDI+KELK A    + +   S+A   R
Sbjct: 690  PSLQVFEGEVDNKLKTEKAILETIRRSKFLGSSFDISKELKSA----SARSDYSRAPG-R 744

Query: 773  IISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSV 832
            +I+  ++   + +LPKNA A+APL+ H+ Q E RKISDIKVPQFTRKSR F +S+KRLSV
Sbjct: 745  VITAPSNLERSDVLPKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSV 804

Query: 833  LSMYSSKQSYTNLADLLNEEASNA-----KGNRDSPNDQSGHEPEFLFENVQEDGEVTGD 887
            LSMYS++QS+ NL+D++N E+ N      +G   +PN  S  + EFLFE+V E+ E T +
Sbjct: 805  LSMYSTRQSFKNLSDMMNFESENTDAAENRGQIATPN--SAGQSEFLFESVNEEAENTNN 862

Query: 888  SSHDGRLYEVPEDSNMTKEK-LKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLDGKEAKG 946
            +S DG+LYEV E    + +K L++N +DR+  +N E     D   +LP LPPLD  E  G
Sbjct: 863  TSTDGKLYEVSESPESSSKKGLRVNLSDRYNKANSE----ADMENKLPILPPLD-PEIAG 917

Query: 947  LGIYQSSSESLPEPAQHNVKSMIQNDENQPSETAEVLSIKED--NAQVERQQEAPLNASI 1004
            LGIYQ       +P + N K   +  +++ +ET ++   + +  + + E  ++AP     
Sbjct: 918  LGIYQD------QPEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKAPQPPIT 971

Query: 1005 PKHRTDGAQKSERMPSKEGSEKKRNTSFFRKFSKSSNEKTNG----EFDAE--LYASVAA 1058
             K + D  ++     +K   E   + +F RK S  SN  T      +  AE  ++ +V+A
Sbjct: 972  EKKKLDAKKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSA 1031

Query: 1059 KXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKGSI 1118
                         W  YGLK +K   + +T+TGKL+SENILSLRST+FE+++   GKGS 
Sbjct: 1032 TQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSK 1091

Query: 1119 VGFRKKSGSTKTLKRLVSEIEKVLLKERVL 1148
            V  +KKSGSTK + RL  E++ VL+KE V+
Sbjct: 1092 VDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1173 (52%), Positives = 773/1173 (65%), Gaps = 91/1173 (7%)

Query: 4    MSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVK 63
            M+   + T+KG+ IGPWKLG TLG+GSTGKV +AY+E+  QQAA+K+ISK+IFN +GS  
Sbjct: 1    MNGNGITTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGS-- 58

Query: 64   DSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLL 123
             + +  + PD LPYGIEREIIIMKLLNHPNVLRLYDVWET+ +LYMVLEY +KGELFNLL
Sbjct: 59   -TMIGGNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLL 117

Query: 124  VERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 183
            VERGPLPE EA+RFFRQI+IGISYCHALGIVHRDLKPENLLLDHKFN+K+ADFGMAALE+
Sbjct: 118  VERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALES 177

Query: 184  EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLL 243
            +DKLLETSCGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFD+EDGNIRNLL
Sbjct: 178  KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLL 237

Query: 244  LQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIR 303
            L+VQSG++EMPGDDEIS +AQDLIARILTVDPEQRIK R+ILKHPLL+KYPSI DSKSIR
Sbjct: 238  LKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIR 297

Query: 304  NLPREDTYLHPLS-EGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL 362
            NLPREDTYL+PLS EG +  +DE ILQNLVVLWHGR + +II KL EPGAN EKT YALL
Sbjct: 298  NLPREDTYLNPLSLEGGNQCVDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALL 357

Query: 363  DRFKSDTENDSVKHPQSKKRVS-QINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSS 421
             RFK D   D +K  + +K+ S   N +    +  +P+K  +  +  ++ RTS+I  SSS
Sbjct: 358  HRFKHDNYQDQLKQQELQKKQSVSSNSLMYVGSLPSPNKSDSPVTTPKKKRTSIIVASSS 417

Query: 422  HKRPVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRV 481
            HKRPVS  KL                  KR+S    SNKR+S + +NS SPTPA+ HKRV
Sbjct: 418  HKRPVSMQKL----SSQHSSPVKNGSIGKRLSKTFPSNKRISQLVSNSSSPTPAA-HKRV 472

Query: 482  SIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTYA 541
            S     R  ++  PPVP EML+DY   +K     R + R S  P+ KRGSITTKLI+TYA
Sbjct: 473  S-----RINDSAAPPVPKEMLRDYKRQSK-----RQSKRFSLLPNMKRGSITTKLIATYA 522

Query: 542  KLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXX----XXXXXXXXXXXXX 597
            KLSED +WEYIEKETKRTS DFATL DQIFEHEK+                         
Sbjct: 523  KLSEDSEWEYIEKETKRTSQDFATLMDQIFEHEKYEQIRKEKEELERKVNEAREKEEAER 582

Query: 598  XXXXXXXXXXXXXXXXXXXDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHG 657
                                   RQ E+Q QM++E+A L  E +    +       DE  
Sbjct: 583  KERERIEREEQERLEREERKRAERQKELQDQMEDEIAKLKAEYEAVQGS------SDERN 636

Query: 658  AVNGRSVSEPLQKKSA----DPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSE 713
              NGRSVS P++        D    ++ +I++L+  R FSLQTRPVSRLDPG+ +++S  
Sbjct: 637  TANGRSVSAPIETDRTANKRDSTFGIKNDINELINTRNFSLQTRPVSRLDPGIIAAES-- 694

Query: 714  KDQYTGSEDRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRI 773
              + + + +  + + +K ILETIRRSKFLGS F++N EL++A  +   K+RQ +    R 
Sbjct: 695  --RLSANLEDDQASKEKTILETIRRSKFLGSQFNLNVELEKAQKDLVSKERQEQL---RK 749

Query: 774  ISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVL 833
             S    +YE Q LPKNA A A L+D   + EPRK+S++KVPQFTR+S+ F  SNKR SVL
Sbjct: 750  YSEQTAKYEVQKLPKNAKAVATLRD--DEVEPRKLSEVKVPQFTRRSKHFSSSNKRFSVL 807

Query: 834  SMYSSKQSYTNLADLLNEE--ASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDSSHD 891
            S+YS+K S+TNL D L  +       G  +  + +   EPEF+FE V+E  E       +
Sbjct: 808  SLYSTKTSFTNLVDHLKNDNYLEPLPGQPEYSSSKVAQEPEFMFETVEELDE-------N 860

Query: 892  GRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPL-------DGKEA 944
             +L+EVPE      E+ KL  A R ++++   ++  DK++ LP+LPPL       D   A
Sbjct: 861  SKLFEVPE-----TEEGKLASAARKESTDARKQSTNDKDINLPSLPPLQVSHDVADENGA 915

Query: 945  KGLGIYQSSSESLPEPAQHNVKSMIQN---DENQPSETAEVLSIKEDNAQVERQQEAPLN 1001
             GLGIYQ + ++     Q   K+M+ +   DEN        +S   D ++ E  ++ PLN
Sbjct: 916  LGLGIYQPNDQT-----QKPHKTMLIDESIDEN--------ISSTSDVSRTEVVKKPPLN 962

Query: 1002 ASIPKHRTDGAQKSERMPSKEGS---EKKRNTSFFRKFSKSSNEKTNGE-FDAELYASVA 1057
              + K+       +ER P +E +   E KR  SFFRKFS+ S +K   E FD++L A V+
Sbjct: 963  DVVRKN------NNERKPLEEITPKVENKRKISFFRKFSQGSEKKLGPESFDSQLKAGVS 1016

Query: 1058 AKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVW-SRGKG 1116
            A             W  YGLK V+S P+   ++GKL+S+NILSLRST F++ V    G G
Sbjct: 1017 APKMYKALDRLLNEWTNYGLKHVESSPNDFVISGKLTSDNILSLRSTGFKITVLPGEGNG 1076

Query: 1117 SIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLT 1149
            SI+ F KKSGSTKT  RLV EIEK+L KE+VL 
Sbjct: 1077 SIIQFTKKSGSTKTFNRLVKEIEKILEKEKVLV 1109

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1137

 Score = 1059 bits (2738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/1193 (52%), Positives = 766/1193 (64%), Gaps = 106/1193 (8%)

Query: 5    SNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFN------- 57
            +N S  TV GN IGPWKLGETLG GSTGKVQLA +E TNQQAAIK+ISK++F+       
Sbjct: 4    ANISDVTVTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHLVNSNN 63

Query: 58   ------VKGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVL 111
                      V + SV  +  ++LPYGIEREIIIMKLLNH NVLRLYDVWETN+NLYMVL
Sbjct: 64   NNNSALAASDVNNGSVQHNQ-EALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNLYMVL 122

Query: 112  EYAQKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNI 171
            EYA+KGELFNLLVE+GPL E EA+RFFRQI+IG+SYCHALGIVHRDLKPEN+LLDHK NI
Sbjct: 123  EYAEKGELFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKSNI 182

Query: 172  KIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLP 231
            KIADFGMAALETEDKLLETSCGSPHYAAPEIVSG+PY+G  +D+WSCGVILFALLTGRLP
Sbjct: 183  KIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLTGRLP 242

Query: 232  FDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
            FD+EDGNIRNLLL+VQ G +EMPG DE+S +AQDLI +ILTV+P+QRIK R+ILKHPLLQ
Sbjct: 243  FDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKHPLLQ 302

Query: 292  KYPSINDSKSIRNLPREDTYLHPLSE--GESAEIDENILQNLVVLWHGREQLEIINKLRE 349
            KYP+I DSK+IR+LPREDTYL+PL++  G   EIDE+ILQNL VLWHG+++ EII KL+E
Sbjct: 303  KYPNIKDSKTIRDLPREDTYLNPLADNNGVDTEIDESILQNLTVLWHGKDKNEIIKKLKE 362

Query: 350  PGANAEKTLYALLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKR 409
            PGANAEKTLY LL RFK DTE ++ K+ Q +KR S +      ++       Q N   +R
Sbjct: 363  PGANAEKTLYVLLHRFKEDTERENHKNSQLRKRQSLMKASSSSSSN------QGNVPRRR 416

Query: 410  RNRTSMISVSSSHKRPVSFNKLXXXXXXXX------XXXXXXXXXXKRVSVNL-SSNKRL 462
            +NR SMISV+SSHK+PVS+NK+                        KR+S++L SSNKR 
Sbjct: 417  KNRNSMISVTSSHKKPVSYNKIAMVGGSSKDVISLPSSSNTTPASSKRISLSLSSSNKRN 476

Query: 463  SAVYT--NSGSPTPASRHKRVSIVDLERERENDTPPVPIEMLKDYSSTAKQ-KRLSRNNM 519
            S +YT  NS SPTPA R +R S  +L   +E++ PP+P+++LKDY+  + Q KR SR + 
Sbjct: 477  SRLYTQSNSSSPTPAPRSRRSSNQNL-INKESEAPPIPVDVLKDYNKISNQNKRGSRLSK 535

Query: 520  RLSFKPSNKRGSITTKLISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXX 579
            R SF  +NKRGS+TTK++STYAKL+EDDDWE+IEKETKR SSDFATL D+IFEHEKF   
Sbjct: 536  RYSFLLNNKRGSVTTKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLIDEIFEHEKFEKI 595

Query: 580  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLERRQL-----EIQRQMDEEVA 634
                                                 + E  ++     ++Q  +DEE A
Sbjct: 596  RKEKEELERKVIEAKQKEERERKEAEAAAKEEARVRREKELARMNKEEEQLQNDIDEE-A 654

Query: 635  NLGKELQGGMNADQDADEGDEHGAVNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSL 694
             L K+    +N     DE  E+  +N RSVSEP++    D              QR FSL
Sbjct: 655  RLLKDEFNFVN-----DETQEN-PINSRSVSEPVKNGGTDEKG-----------QRNFSL 697

Query: 695  QTRPVSRLDPGVFSSDSSEKDQYTGSEDRAKLNNDKIILETIRRSKFLGSSFDINKELKR 754
            QTRP+SRLDPG+  S   + D  +  ++   +NN K ILETIRRSKFLGSSFDINKEL  
Sbjct: 698  QTRPISRLDPGLMFSKLGDVDNNSSVDENLTMNNQKTILETIRRSKFLGSSFDINKELNN 757

Query: 755  AADNEAKKQRQSKAT-------SDRIISTTNDEYETQILPKNATASAPLKDHNHQAEPRK 807
             A+ E K+ RQ +          +RI ST+    E Q+L KNA     LKD +   EPRK
Sbjct: 758  -ANEERKRLRQLQLQKQKELEEKERIASTSYVSNENQVLSKNAIGVVDLKDFSSDVEPRK 816

Query: 808  ISDIKVPQFTRKSRQFGDSNKRLSVLSMYSSKQSYTNLADLLNEEASNAKGNRDSPNDQS 867
            IS+++VPQFTRKS+ F +SNKRLSVLS YSSKQSYTNL D++ E   N   + D   D  
Sbjct: 817  ISEVQVPQFTRKSKYFSESNKRLSVLSFYSSKQSYTNLVDMIKE---NPVEDEDVTED-- 871

Query: 868  GHEPEFLFENVQEDGEVTGDSSHDGRLYEVP---EDSNMTKEK----LKLNFADRFKTSN 920
               P F FE+ Q D     + +      EVP   +D    +EK    +KLNFADRF   N
Sbjct: 872  ---PGFNFEDSQYDYLEEKNEAPLEVSDEVPKEVDDKVQEEEKNSVSMKLNFADRFSNVN 928

Query: 921  GEDRTAEDKNVRLPTLPPLDGKEAKGLGIYQSSSESLPEPAQHNVKSMIQNDENQPSETA 980
               +       + P +    G E  GLG+Y  + ++ P+P    VKSMI           
Sbjct: 929  SNTKQESSFEDKFPNILSKSGTE--GLGLYSKNEKTEPKP----VKSMIP---------- 972

Query: 981  EVLSIKEDNAQVERQQEAPLNASIPKHRTDGAQKSERMPSKEGSEKKRNT-SFFRKFS-K 1038
                 +ED        EAPLN  + K R +    S + PS  GS+K  NT SF RK S K
Sbjct: 973  -----EEDKVNSSPVVEAPLNKVVNKTRAENKSTS-KGPS--GSQKVSNTSSFLRKISGK 1024

Query: 1039 SSNEKT-NGEFDAELYASVAAKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSEN 1097
            SSN     G F+  LY+SV               W  YGLK VK    K  + GKLS++N
Sbjct: 1025 SSNSTVAKGAFEVNLYSSVTETQLFNGLQNLLKGWTNYGLKDVKVDKQKKMIVGKLSNDN 1084

Query: 1098 ILSLRSTLFEMVVWSRGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLTK 1150
            ILSLRST+ E+ V++  K S++G RKKSGS+KT++RL SEIEKVL KE VL K
Sbjct: 1085 ILSLRSTIVELCVFTESKFSVIGIRKKSGSSKTMRRLASEIEKVLSKEGVLQK 1137

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR507C
            (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 1012 bits (2617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/1193 (50%), Positives = 758/1193 (63%), Gaps = 107/1193 (8%)

Query: 6    NRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDS 65
            N +V +++G++IGPWKLGETLG GSTGKV LA +  T Q AA+KVISK++FN +GS   +
Sbjct: 5    NNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGS---T 61

Query: 66   SVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVE 125
             V ++ PD LPYGIEREIIIMKLLNHPNVLRLYDVWET  +LYMVLEY +KGELFNLLV+
Sbjct: 62   FVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQ 121

Query: 126  RGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED 185
            RGPLPE EA+RFFRQI+IGISYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAALE++D
Sbjct: 122  RGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKD 181

Query: 186  KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQ 245
            KLLETSCGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFD+EDGNIRNLLL+
Sbjct: 182  KLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241

Query: 246  VQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNL 305
            VQSG+YE+PG+DEISP+A+DLI +ILTV+PEQRIK R+ILKHPLLQKYPSI DSKSIRNL
Sbjct: 242  VQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNL 301

Query: 306  PREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRF 365
            PREDTYL+PL   +   ID+ ILQNLVVLWHGR++ EI  KL+EPGAN EKT YALL RF
Sbjct: 302  PREDTYLNPLDHNDGT-IDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRF 360

Query: 366  KSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTN---ASPKRRNRTSMISVSSSH 422
            K + E   +K  Q  KR+S  +   Q    K+ S+   N   ++PK++ R+S I+VSS+H
Sbjct: 361  KFENEQQQLKQQQIAKRISSTSSSPQQNIVKSSSRRSINNILSTPKKK-RSSAINVSSAH 419

Query: 423  KRPVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRVS 482
            KRPVS  KL                  K+ S+   SN++LSAV   S S +P+   KR+S
Sbjct: 420  KRPVSIQKL------NDCGTLNPTSPSKKRSL---SNRKLSAVLAGSNSSSPS--RKRMS 468

Query: 483  IVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTYAK 542
            +         D PPVP  +L+DY+     KR SR + RLSF PS KRGSITTK+I+TYAK
Sbjct: 469  V-------GQDAPPVPTAVLRDYN-----KRASRASKRLSFLPS-KRGSITTKIIATYAK 515

Query: 543  LSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXXXXXXXX 602
            LSED+DWEYI++E KRTSSDFATL D IFEHEK+                          
Sbjct: 516  LSEDNDWEYIDREAKRTSSDFATLIDNIFEHEKYEQIRREKEELERKVREAKEREERERR 575

Query: 603  XXXXXXXXXXXXXXDLER-------RQLEIQRQMDEEVANLGKELQGGMNADQDADEGDE 655
                             R       RQ E+Q+ ++E+VA L  E+       + +   ++
Sbjct: 576  ARAEAERRKREEEERRRRREVEELIRQRELQKSLEEQVARLKAEVAATKQEKRISLAQEQ 635

Query: 656  HGAVNGRSVSEPLQKKSADP-----MADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSD 710
            H     RS+SEP+++K   P        LQ NI+ LL++RT SL+TRP+SRLDPG+  S+
Sbjct: 636  H----VRSISEPMERKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGIRLSE 691

Query: 711  SSE--KDQYTGSEDRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKK------ 762
             +   +D    +EDR ++  +K ILETIRRSKFLGS +DI+KEL+R    + +K      
Sbjct: 692  ENTILEDDLECNEDRLRV--EKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKS 749

Query: 763  ------------QRQSKATSDRIISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISD 810
                        Q Q   +    +++++++ E+ ILPKN TA   LKD   ++EPRK+S+
Sbjct: 750  QDRKLEPGLHSRQEQRFVSDGTTVTSSHEDSESIILPKNVTAIGVLKD--EESEPRKLSE 807

Query: 811  IKVPQFTRKSRQFGDSNKRLSVLSMYSSKQSYTNLADLLNEEASNAKGNRDSPND-QSGH 869
            +K+PQFTR+S+ F  S+KRLSVLSMYS+K SYTNLAD LN +         +P   +   
Sbjct: 808  VKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADYLNNDVQLKSLQPSAPTSIKIPQ 867

Query: 870  EPEFLFENVQEDGEVTGDSSHDGRLYEVP----EDSNMTKEKLKL----NFADRFKTSNG 921
            EPEF+FE+  ++      +  D  L E P    E  +   E ++L    +  DR K  + 
Sbjct: 868  EPEFMFESAGQENRYQAAAPTDTYL-ERPKVGVEGDHEPGEPVELIELDDSEDRSKQYSE 926

Query: 922  EDRTAEDKNVRLPTLPPLDG-KEAKGLGIYQSSSESLPEPAQHNVKSMIQND---ENQPS 977
            ED       V+LP LPPLD   +  GLGIYQ+ +       Q  +KSMI +D   +  P+
Sbjct: 927  EDIA----KVKLPILPPLDHLNKPNGLGIYQAPAPPKEPLGQPVMKSMIPDDIKIKCVPN 982

Query: 978  ETAEVLSIKEDNAQVERQQEAPLNASIPKHRTDGAQKSERMPSKEGSEKKRNTSFFRKFS 1037
            +      +       ER  E  L  ++P          ER+ + E             F 
Sbjct: 983  Q------LSPRRRATERAPEKKLTKTVP----------ERVIAAETFPPPNTKKKPSFFK 1026

Query: 1038 KSSNEKTNGEFDAELYASVAAKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSEN 1097
            K S EK + + D +L  +V               W  YGLK V+SMP   T+TGKLSS+N
Sbjct: 1027 KFSREKMHSDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDN 1086

Query: 1098 ILSLRSTLFEMVVWSRG-KGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLT 1149
            ILSLRST FE+V+ S    GS V F KKSGS KT  RLV+EIEK+L KE VL 
Sbjct: 1087 ILSLRSTAFEIVILSVADTGSSVKFTKKSGSKKTFTRLVNEIEKILEKESVLV 1139

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/1172 (50%), Positives = 739/1172 (63%), Gaps = 194/1172 (16%)

Query: 12   VKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSS-VAAS 70
            +KG+ IGPWKLG+TLGLGSTGKV+LAY+E+T+QQAAIK+ISK+IF+ +G+V +SS V+ S
Sbjct: 10   MKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIFS-QGTVGESSMVSNS 68

Query: 71   TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLP 130
            +PD+LPYGIEREIIIMKLL HPNVL LYDVWETNS LYM+LEYA+KGELFNLLVERGPLP
Sbjct: 69   SPDALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLP 128

Query: 131  EKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLET 190
            EKEAIRFFRQI+IGISYCHALGIVHRDLKPENLLLDHK NIKIADFGMAALET+DK+LET
Sbjct: 129  EKEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALETKDKMLET 188

Query: 191  SCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGR 250
            SCGSPHYAAPEIVSG+PYHGF SDVWSCGVILFALLTGRLPFD+EDGNIRNLLL+VQSG 
Sbjct: 189  SCGSPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE 248

Query: 251  YEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDT 310
            YEMP DDEIS +AQDLI RILTVDPEQRIK RDILKHPLLQKYPSI DS+SI+NLPREDT
Sbjct: 249  YEMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPREDT 308

Query: 311  YLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFKSDTE 370
            YL+PLSE  S  ID++ILQNLV LWHGR++ +I  KLRE GA+AEKT+YALL RFK + E
Sbjct: 309  YLYPLSENNSI-IDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLYRFKVEAE 367

Query: 371  NDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSHKRPVSFNK 430
                                         K  T +SP+R+NR SMISVSSSHKRPVS  K
Sbjct: 368  -----------------------------KMNTCSSPRRKNRISMISVSSSHKRPVSMKK 398

Query: 431  LXXXXXXXXXXXXXXXXXXKRVSVNLSSN--KRLSAV--YTNSGSPTPASRHKRVSIVDL 486
            +                  +R+S++LSS   KR+S +  +TNS SPTP SR KR+S++++
Sbjct: 399  I-------STVQNNTPPSNRRLSISLSSTQRKRMSGILQHTNS-SPTP-SRTKRISVINI 449

Query: 487  ERERENDTPPVPIEMLKDYSSTAKQKRLS-------RNNMRLSFKPSNKRGSITTKLIST 539
            +       PPVP+EML+DY + +K  R +       +NN RL+   +NKR SITTKL+ST
Sbjct: 450  DDSENKAPPPVPMEMLEDYKNNSKNVRRTIKKKKKKKNNYRLTL-VNNKRVSITTKLLST 508

Query: 540  YAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXXXXX 599
            YAKLSEDD+WEYIE+ETKRTSSDFATL D++FEHEK+                       
Sbjct: 509  YAKLSEDDNWEYIERETKRTSSDFATLIDELFEHEKYERIRKEKEELERKVRETRVREQR 568

Query: 600  XXXXXXXXXXXXXXXXXDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGAV 659
                               +R QL++Q+++DEE++ L           +DA E D     
Sbjct: 569  REEEERAEL----------QREQLKLQQKIDEEISKL----------KEDALEKD----- 603

Query: 660  NGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQY-- 717
            N RSVS P+++   +       N ++L  +R FSLQTRPVSRLDPG+  S  +E   Y  
Sbjct: 604  NFRSVSAPIKENEDE-----DENENELRNRRQFSLQTRPVSRLDPGILYSAPAEIPSYER 658

Query: 718  ---TGSEDRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRII 774
                 S +++     + ILETIRRSKFLGSSF+I +EL+ +  N     ++     D + 
Sbjct: 659  VVVNESGNKSSAQQQRKILETIRRSKFLGSSFNIQQELEFSQRNVLVPTKEQVVDVDEV- 717

Query: 775  STTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLS 834
                                       +   RKIS++K+PQFTRKSR F DSNKRLSVLS
Sbjct: 718  -------------------------KLEGGLRKISEVKIPQFTRKSRHFSDSNKRLSVLS 752

Query: 835  MYSSKQSYTNLADLL---NEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDSSHD 891
            MYS+KQSYTNL  +L    EE+  AK             PE LFE           S  D
Sbjct: 753  MYSTKQSYTNLGHILKDGTEESEPAKKT-----------PELLFE-----------SGRD 790

Query: 892  GRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPL----------DG 941
             RLYEV E+  + +EK  +                  + V LP LPPL          + 
Sbjct: 791  DRLYEVSEEPEIQEEKEDI------------------ETVTLPQLPPLKQSANTNANANE 832

Query: 942  KEAKGLGIYQSSSESLPEPAQHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAPLN 1001
             E  GL I++       E     VK +I      PS+              +  ++ P+ 
Sbjct: 833  TEINGLAIFRPKENIELEDITKEVKEVI------PSQ--------------DHGKDKPIA 872

Query: 1002 ASIPKHRTDGA---QKSERMPSKEG-SEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVA 1057
             + PK R +     Q  E  P+K G +EKKRN SFFRKF  S+N  T   +D E+Y ++ 
Sbjct: 873  INNPKQRLEVKPERQLDEIAPNKVGTTEKKRNVSFFRKF--SNNSATIKGYDHEIYVNIG 930

Query: 1058 AKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRG-KG 1116
            ++            W +YGLK V+S    + +TGKL+++NILSLRSTLFE++V  +G K 
Sbjct: 931  SRQLYTGLRKLLEGWTQYGLKDVRSDNTAMKITGKLANDNILSLRSTLFELLVEPKGSKY 990

Query: 1117 SIVGFRKKSGSTKTLKRLVSEIEKVLLKERVL 1148
            S++GF K  GS+K ++RL +EIEKVL KE VL
Sbjct: 991  SLIGFTKVQGSSKVVRRLFTEIEKVLNKEGVL 1022

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa] {ON}
            similar to uniprot|Q12263 Saccharomyces cerevisiae
            YDR507c GIN4
          Length = 1103

 Score =  996 bits (2574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/1167 (49%), Positives = 751/1167 (64%), Gaps = 85/1167 (7%)

Query: 1    MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG 60
            M+A+S+ +V  +K N+IGPWKLGETLG GSTGKV LA +E+T QQAA+KVISKA+F    
Sbjct: 1    MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFE--- 57

Query: 61   SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120
            ++ +S       ++LPY IE+EIIIMKLLNHPNVLRL+DVWETNS+LY+VLEYA+KGELF
Sbjct: 58   AMNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELF 117

Query: 121  NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180
            N+LVERGPLPE EA+R FRQI+IGISYCH+LG+VHRDLKPENLLLD+K NIKIADFGMAA
Sbjct: 118  NMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAA 177

Query: 181  LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240
            LE+EDKLLETSCGSPHYAAPEI+SG+PY GF+SDVWSCGVILFALLTGRLPFD+EDGNIR
Sbjct: 178  LESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIR 237

Query: 241  NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK 300
            NLLL+VQ G +EMP DDEI+ +AQDL+AR+LTVDP +RI  R+ILKHPLLQKYPSI DS+
Sbjct: 238  NLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSR 297

Query: 301  SIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYA 360
            SIRNLPREDTYL PL++  S +ID+ ILQNLV+LWHG++  EI  KLREPGAN EKTLYA
Sbjct: 298  SIRNLPREDTYLSPLADTNS-KIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYA 356

Query: 361  LLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSS 420
            LL RFK DT+ ++    + + ++ Q N   + T  ++PSK +T    K+  R S+I  +S
Sbjct: 357  LLYRFKCDTQREA-NRARRQSKIVQRNSTIRSTAPESPSKKKTYTPQKKNKRASII--AS 413

Query: 421  SHKRPVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKR 480
            S KRPVS  K                   KR+S+N S+ KR+SA+Y    SPT  SR +R
Sbjct: 414  SSKRPVSVTK-TATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGTRDSPTKTSRSRR 472

Query: 481  VSIV--DLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLIS 538
             SI+  D    R  D+            S +  KR S+++ R+S  P+ KR S+TTKL++
Sbjct: 473  SSIITKDFLGNRPRDS----------VISMSHNKRASKSSKRISLVPNLKRQSVTTKLMA 522

Query: 539  TYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXXXX 598
            TYAKLSEDDDWEYIE+ETKRTSSDFATL D+IFE+EK+                      
Sbjct: 523  TYAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAELERKVRETKEREE 582

Query: 599  XXXXXXXXXXXXXXXXXXDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGA 658
                               +E+++ +I RQMDEE++NL KEL G    DQD ++      
Sbjct: 583  RERKERQEKELQERLERERIEKQKEDIARQMDEEISNLKKELVG----DQDNED------ 632

Query: 659  VNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGV-FSSDSSEKDQY 717
               RSVSEPL+ KS   + D++ +ID +LR R +SLQTRPVSRLDPG+ F     + +Q+
Sbjct: 633  -KFRSVSEPLESKSKK-IEDIEEDIDGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQH 690

Query: 718  ---TGSEDRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRII 774
               T + +      ++ ILETIRRSKFLGSSFDI KEL+       K+ RQ+    ++  
Sbjct: 691  VPETVNLEPELEETEQKILETIRRSKFLGSSFDIKKELE-----NVKRHRQTSQPIEK-- 743

Query: 775  STTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLS 834
                 E     LP+    +   K+ +     RKISDIKVPQFTRKSR F  SN+RLSVLS
Sbjct: 744  -----EMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLS 798

Query: 835  MYSSKQSYTNLADLLNEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDSSHDGRL 894
            MYS+K+SY+NLAD+L       +  + +P  +S  + + LF+ + E  +     S + RL
Sbjct: 799  MYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSDQLFDTIDE-ADTPASVSREERL 857

Query: 895  YEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDK--NVRLPTLPPL--DGKEAKGLGIY 950
            YEV E+S       K++ AD   +     ++ E++  +++LP LPPL  DG         
Sbjct: 858  YEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLFEDG--------- 908

Query: 951  QSSSESLPEPAQHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNASIPKHR-- 1008
              S++   E ++  +   +Q+ E+Q         I+++N+     +   LN  + KHR  
Sbjct: 909  --STKETKEQSKSMIPENMQSSESQK-------QIEKNNS----DEGGSLNPFMTKHRDV 955

Query: 1009 TDGAQKSER--MPSKEGSE-----KKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAKXX 1061
            +D     E+  +  K  SE     KKRN SF RK SK S+   +   D  L  SV++K  
Sbjct: 956  SDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRKLSKGSSSSKDN-VDVTLSTSVSSKQL 1014

Query: 1062 XXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKGSIVGF 1121
                      W KYGLKG+       T+TGKL+++NILS RST F ++++S+ KGS V F
Sbjct: 1015 FSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTF 1074

Query: 1122 RKKSGSTKTLKRLVSEIEKVLLKERVL 1148
            RK SGS K ++RL  E++KVL KE VL
Sbjct: 1075 RKVSGSGKAVRRLSDEVKKVLSKEGVL 1101

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
            {ON} YDR507C (REAL)
          Length = 1024

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1156 (43%), Positives = 669/1156 (57%), Gaps = 163/1156 (14%)

Query: 15   NKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDS 74
            N IGPW+LGETLG GSTG+VQLA  E T  + A+KVISK IF+ +       +A      
Sbjct: 8    NTIGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDTEDGGGXXXLA------ 61

Query: 75   LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEA 134
            LPY IEREI++MKLL+HPNVL LYDVWETN+NLY++LEYA+KGELFNLLV+RGPLPEKEA
Sbjct: 62   LPYNIEREIVVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEA 121

Query: 135  IRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGS 194
            ++ FRQI+I ISYCHALGIVHRDLKPENLLLD+ +NIKIADFGMAAL+T+ +LLETSCGS
Sbjct: 122  VKCFRQIIIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARLLETSCGS 181

Query: 195  PHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMP 254
            PHYAAPEIVSG+PY GFASDVWSCGVILFALLTGRLPFD+++GN+R+LLL+VQ G++EMP
Sbjct: 182  PHYAAPEIVSGLPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMP 241

Query: 255  GDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHP 314
               EIS DAQ+LI+RIL VDP QR+K RDIL HPLL+KY +I DSKSIRNLPRE+TYL+P
Sbjct: 242  DATEISKDAQNLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYP 301

Query: 315  LSEG---ESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFKSDTEN 371
            L++     +A ID +ILQNLVVLWHGR   EI+  L++ G N EKTLYALL RFK +  N
Sbjct: 302  LADAGNHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFKQEA-N 360

Query: 372  DSVKHPQSKKRVSQINPVRQPTTKKAPSKP--QTNASPKRRNRTSMISVSSSHKRPVSFN 429
               +H   K            TTKK P  P     +S    NR S  +      +  S N
Sbjct: 361  KRSRHKIKK------------TTKKNPPYPSMSILSSSSSHNRLSGSTPRRRTPKRRSMN 408

Query: 430  KLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRVSIVDLERE 489
                                      L+SN       +++GSP P+   KR S  +    
Sbjct: 409  FSSSKKRSSFI---------------LASN-------SSNGSPMPSRNSKRSSFFNTASA 446

Query: 490  RENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTYAKLSEDDDW 549
               + PPVP+++L  Y   +K     R++ RLS+ P+ KRGS+T+K +S Y  L ++DDW
Sbjct: 447  ---NVPPVPVKLLNSYKRNSK-----RSSKRLSYVPNVKRGSLTSKSLSKYTNLIDEDDW 498

Query: 550  EYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 609
            EYIEK+TKRTSS+FATL D+IFE EKF                                 
Sbjct: 499  EYIEKDTKRTSSNFATLIDEIFEPEKF--------------------------------- 525

Query: 610  XXXXXXXDLERRQ-LEIQRQMDE------EVANLGKELQGGMNADQDADEGDEHGAVNGR 662
                   +L RR+  E+QR++ E      +VA L +E  G      DA E  E   +N +
Sbjct: 526  -------ELARREKAELQRKVQEAKRGKSDVAKLNQE-NGNETGKSDAME--ELKKINNK 575

Query: 663  SVSEPLQKKSADPMADLQANIDDLLRQRT-FSLQTRPVSRLDPGVFSSDSSEKDQYTGSE 721
             VS PL          LQ +I+ LL  R   S  TRP+S+LDPG+  +  +         
Sbjct: 576  -VSSPLINYEYSQQELLQ-DINTLLTNRCQLSAYTRPISKLDPGLMPTPETIPYDIKEKT 633

Query: 722  DRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIISTTNDEY 781
            D   L+ +  ILETIR+SK L SS ++ KE+ R AD      R        I STT    
Sbjct: 634  DLL-LDTEMKILETIRKSKILDSSLNLRKEVSRDAD------RLPSVEESPIASTT---- 682

Query: 782  ETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMYSSKQS 841
                         PL  +N   E  KISDI+VP FTRKS+ F  +N R SVLS+YSS+ S
Sbjct: 683  -------------PLVYNNDSKEVCKISDIQVPHFTRKSKCFTPTNNRRSVLSLYSSRHS 729

Query: 842  YTNLADLLNEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDSSHDGRLYEVPEDS 901
            +  L+ +LN +  +A  N  S  +    E   L E++     +  +++++ RLY+V E +
Sbjct: 730  FKGLSRILNSKDPSA--NPYSHINGPLSEEIDLTEDIANMKNIENNNNNNNRLYDVSESA 787

Query: 902  NMTKEKLKLNFADRFKTSNG--------EDRTAEDKNVRLPTLPPLDGKEAKGLGIYQSS 953
             + +     +  D  +  +G         + T     V+LP+L     K A GLGIYQ  
Sbjct: 788  ILLQGNDDDDDDDDNENDDGSQSIQSSVSNNTEPTTFVKLPSLSSFQEKNASGLGIYQ-- 845

Query: 954  SESLPEPAQHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNASIPKHRTDGAQ 1013
             E   EP+   ++S I   E  P+ T  +  + ED  + E Q E  +  S+     D  +
Sbjct: 846  REPSIEPS---IESSI---EPLPNVTIAIEDVDED-GENEIQHEN-ITTSL---SNDNIK 894

Query: 1014 KSERMPSKEGSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAKXXXXXXXXXXXXWK 1073
            K++   +K+   +  N SF +KFSK          + E++A + A+            WK
Sbjct: 895  KNDD--TKDTIREYSNVSFLKKFSKGK------ILELEIHAKIPAERLFEGLHKLLEGWK 946

Query: 1074 KYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVW-SRGKGSIVGFRKKSGSTKTLK 1132
            +YGLK +      + +TGKL ++NILSLRSTLFE++V  +R   S++ F KK+GSTKTLK
Sbjct: 947  QYGLKNLGFDTANMIITGKLVNDNILSLRSTLFEIIVLPNRDDRSLIKFNKKTGSTKTLK 1006

Query: 1133 RLVSEIEKVLLKERVL 1148
            +L  EI+ VL KE VL
Sbjct: 1007 KLGYEIQIVLQKEGVL 1022

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (REAL)
          Length = 1017

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/1152 (41%), Positives = 662/1152 (57%), Gaps = 170/1152 (14%)

Query: 17   IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
            IGPWKLGETLG+GS GKV+LA  E T  + A+K+ISK+IFN +G+  +          LP
Sbjct: 18   IGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIFNTEGNYGNHGSV------LP 71

Query: 77   YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIR 136
            Y IEREI+IMKLL+HPNVL LYDVWETN+NLY++LEYA+KGELFNLLV+RG LPE+EA++
Sbjct: 72   YNIEREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPEREAMK 131

Query: 137  FFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 196
             FRQI+I +SYCHALGIVHRDLKPENLLLD  +NIK+ADFGMAAL+T+  LLETSCGSPH
Sbjct: 132  CFRQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAALLETSCGSPH 191

Query: 197  YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGD 256
            YAAPEIVSG+PY GF+SDVWSCGVILFALLTGRLPFD+E+GNIR LLL+VQ G++EMP D
Sbjct: 192  YAAPEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDD 251

Query: 257  DEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHPLS 316
             EIS DAQDLI++IL VDP QRIK RDIL HPLL++Y +I DSKSI++LPREDTYL+PL+
Sbjct: 252  TEISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYPLA 311

Query: 317  EGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFKSDTENDSVKH 376
            +  +A ID++ILQNLVVLWHGR   EI  KL+  G N EKTLYALL RFK ++  +S K 
Sbjct: 312  DAGAA-IDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALLYRFKLESMRESNKR 370

Query: 377  PQSKKRVSQINPVRQPTTKKAPSKPQT-NASPKRRNRTSMISVSSSHKRPVSFNKLXXXX 435
             + K + ++    R+ +T  +  K +   ++P++R        S +H    S  K     
Sbjct: 371  RRHKTKKTK---NRKFSTSSSLVKGRNLESTPRKR-------TSKTHSNNFSSGK----- 415

Query: 436  XXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRVSIVDLERERENDTP 495
                          KR S  LS N       + + SP P    K +S   L       +P
Sbjct: 416  --------------KRSSFILSPN-------SINSSPIPLRNSKGIS---LRNATSGGSP 451

Query: 496  PVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTYAKLSEDDDWEYIEKE 555
             VP+ +L  +   +K      ++ R S+ P+ K GS+T++L+S Y KL ++DDWE IEK+
Sbjct: 452  VVPVILLNSFKRNSKL-----SSKRSSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKD 506

Query: 556  TKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 615
            TKRTSS+FATL D+IFE E+F                                       
Sbjct: 507  TKRTSSNFATLIDEIFEPEEFELA------------------------------------ 530

Query: 616  XDLERRQLEIQRQM--DEEVANLG--KELQGGMNADQDADEGDEHGAVNGRSVSEPLQKK 671
               +R ++E+QR++   +   N+G   E   GM          E   +N + VS PL   
Sbjct: 531  ---KREKVELQRKVRGSKMSDNIGDRSEFTDGMK---------ELKRINAK-VSSPLINY 577

Query: 672  SADPMADLQANIDDLLRQR-TFSLQTRPVSRLDPGVFSSDSSEKDQYTGSEDRAKLNNDK 730
                   LQ +ID LL  R   S  TRP+S+LDPG+  +  +        E  A + + +
Sbjct: 578  EFSQQELLQ-DIDTLLTNRYQLSAYTRPISKLDPGLMPAAGTTPHDI--KEQTALIRDTE 634

Query: 731  I-ILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIISTTNDEYETQILPKN 789
            + I+ETI RSKFLGS  ++ + + +  D  A  +  S      IISTT            
Sbjct: 635  VKIIETIHRSKFLGSLLNVREGMSKDDDELAPIEESS------IISTT------------ 676

Query: 790  ATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMYSSKQSYTNLADLL 849
                 PL  ++ + E RKISD++VP FTRKSR F  ++ R SVLS+YSS+ S+ +L+ + 
Sbjct: 677  -----PLI-YDDRTEVRKISDVEVPHFTRKSRHFTAASNRRSVLSLYSSRDSFKDLSQIS 730

Query: 850  NEEASNAKGNRD----SPNDQSGHEPEF--LFENVQEDGEVTGDS--SHDGRLYEVPEDS 901
              E S++   R     S + + GH      + E++ +D     +S  + D  LY+VPE  
Sbjct: 731  KNEYSDSPSQRSVDDTSSSKKVGHTESLASVAEHIDDDSYNDHNSGMNSDNVLYDVPEGV 790

Query: 902  NMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLDGKEAKGLGIYQS--SSESLPE 959
            ++ +E +K N  ++   S           V LP+L    GK A GLGIYQ   S  SLP 
Sbjct: 791  DLPQE-VK-NSDEQSSCSLVSSSLEPTPVVELPSLSSFQGKNASGLGIYQREPSKVSLPT 848

Query: 960  PAQHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNASIPKHRTDGAQKSERMP 1019
             A  +    ++N E +  +      +K D+       +     ++ ++    A+   R+ 
Sbjct: 849  -ATIDTSDAVENRETEVKK-----ELKHDSIATNLPDD-----NVKENNNATAEAPSRI- 896

Query: 1020 SKEGSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAKXXXXXXXXXXXXWKKYGLKG 1079
                 +K  N S  +  SK          + E++A +  K            WK+YGLK 
Sbjct: 897  -----KKSSNVSILKNISKGK------ILELEIHAKIPNKRLFEGLHKLLEGWKQYGLKK 945

Query: 1080 VKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKG-SIVGFRKKSGSTKTLKRLVSEI 1138
            +     K+ + GKL +++ILSLRSTLFE++V   G   S++ F KK+GS+K L +L +EI
Sbjct: 946  LGFDAAKMIIKGKLVNDSILSLRSTLFEIIVLPNGDDRSLIKFNKKTGSSKVLTKLATEI 1005

Query: 1139 EKVLLKERVLTK 1150
            + +L KE VL K
Sbjct: 1006 QIILQKEGVLDK 1017

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (REAL)
          Length = 1032

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/1165 (42%), Positives = 667/1165 (57%), Gaps = 181/1165 (15%)

Query: 15   NKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDS 74
            N IGPWKLGETLG GSTGKVQLA  E T Q+ A+KVI K+IF  +GS        +    
Sbjct: 16   NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGS------HGNNDSV 69

Query: 75   LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEA 134
            LP+ IEREI+IMKLL+HPNVL LYDVWET++NLY++LEYA+KGELFNLLV+RGPLPE+EA
Sbjct: 70   LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREA 129

Query: 135  IRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGS 194
            I+ F+QI+I ISYCHALGIVHRDLKPENLLLD+ +NIKIADFGMAAL+T+  +LETSCGS
Sbjct: 130  IKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGS 189

Query: 195  PHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMP 254
            PHYAAPEIVSG+PY GFASDVWSCGVILFALLTGRLPFD+E+GN+R+LLL+VQ G++EMP
Sbjct: 190  PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249

Query: 255  GDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHP 314
             + EIS DAQDLI RIL VDP QRIK RDIL HPLL+KY +I DSKSI++LPRE+TYL+P
Sbjct: 250  NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309

Query: 315  LSEGE---SAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFKSDTEN 371
            L++ +   S  ID++ILQNLV+LWHGR   EI+ KL++ G N EKTLYALL RFK ++  
Sbjct: 310  LADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMK 369

Query: 372  DSVKHPQSK-------KRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSHKR 424
            ++ K  +SK       KRVS +      ++  A +    +++P++         S  H +
Sbjct: 370  ETNKRSRSKINKTKKSKRVSTL----SSSSSSAFNHQSLDSAPRKH-------ASRGHSK 418

Query: 425  PVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRVSIV 484
                ++                   KR S  LSSN       +   SP P          
Sbjct: 419  NFPSSR-------------------KRSSFILSSN-------STDCSPIPLR-------- 444

Query: 485  DLERERENDTPPVPIEMLKDYSSTAKQKRLS-RNNMRLSFKPSNKRGSITTKLISTYAKL 543
                +R + +  VP   L+   S+ K KR S R++ RLS+ P+  RGS+TT L+S Y  L
Sbjct: 445  --SSKRISISSAVPGNTLQVPDSSLKLKRNSKRSSKRLSYMPNLGRGSLTTNLLSNYTNL 502

Query: 544  SEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXXXXXXXXXXXXXXXX 603
             +DDDWEYI+K+TKRTSS+FATL D+IFE EKF                           
Sbjct: 503  IDDDDWEYIDKDTKRTSSNFATLIDEIFEPEKF--------------------------- 535

Query: 604  XXXXXXXXXXXXXDLERRQLEIQRQMDEEV-----ANLGKELQGGMNADQDADEGDEHGA 658
                         +L+++  E +RQ+ +        ++G E+  GM          E   
Sbjct: 536  -----ELAKREKAELQKKVQEAKRQVSKNAPISDEKDVGFEVSDGMR---------ELKK 581

Query: 659  VNGRSVSEPLQKKSADPMADLQANIDDLLRQR-TFSLQTRPVSRLDPGVFSSDSSEKDQY 717
            +N + VS PL          LQ +ID LL  R   S  TRP+SRLDPG+  +  +    +
Sbjct: 582  INNK-VSSPLMNYEFSQKELLQ-DIDTLLTNRYQLSSYTRPISRLDPGL--TPVTGAIPH 637

Query: 718  TGSEDRAKLNNDKI-ILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIIST 776
            +  E  A L + ++ I+ETIR+S+FLGS  ++ + +  + DN                  
Sbjct: 638  SIKEKTALLQDTEMKIIETIRKSEFLGSLLNVREGI--SQDN------------------ 677

Query: 777  TNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMY 836
             N     ++ PK +T   PL  +N Q E RKISD++VP FTRKS+ F  +N R SVLS+Y
Sbjct: 678  -NQLASIEVSPKIST--TPLM-YNDQVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLY 733

Query: 837  SSKQSYTNLADLLNEEASNAKGNRDSPNDQSGHEPEFLFENV---------QEDGEVTGD 887
            S K+S  +L  +   E  ++   + S ++ S  E   + E V         Q+D   +  
Sbjct: 734  SLKESLEDLNQISKNEEPDSPP-QGSTDNASKSELVDVIEEVTEQKNSQHDQDDSNDSNG 792

Query: 888  SSHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKN-VRLPTLPPLDGKEAKG 946
             +++  LY+VPE  +  +     +  D   T +   ++ E K  V+LP+L     K A G
Sbjct: 793  MNNNNILYDVPECVDSPQ---GYDINDAHSTQSPASKSTEPKPVVKLPSLSSFQRKNASG 849

Query: 947  LGIYQ--SSSESLPEPAQHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNASI 1004
            LGIYQ  SS ESLP     N+    +  EN+  +      IK D +          +  +
Sbjct: 850  LGIYQRESSRESLPS-VTINISESDKTTENEAQK-----EIKHDKS----------DTIL 893

Query: 1005 PKHRTDGAQKSERMPSKEGSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAKXXXXX 1064
              H  DG   S +        +  + SF +K SK          + ++ A ++ K     
Sbjct: 894  SNH--DGKADSYKGDISNIVRESSHGSFLKKLSKGK------ILELDVRAKISEKRLYEG 945

Query: 1065 XXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKG-SIVGFRK 1123
                   WK+YGLK +      + ++GKL ++ ILSLRSTLFE+V+   G G S++ F K
Sbjct: 946  LHKLLEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNK 1005

Query: 1124 KSGSTKTLKRLVSEIEKVLLKERVL 1148
            K+GSTKTL +  +EI+ +L KE VL
Sbjct: 1006 KTGSTKTLTKFATEIQIILQKEGVL 1030

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/579 (63%), Positives = 440/579 (75%), Gaps = 30/579 (5%)

Query: 1   MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG 60
           M    N +V ++KG +IGPW LGETLG+GSTGKV +A +  T Q AA+K+ISK+IFN +G
Sbjct: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG 60

Query: 61  SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120
           S   + V ++ PD LPYGIEREI IMKLLNHPNVLRLYDVWET+++LYMVLEY +KGELF
Sbjct: 61  S---TFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF 117

Query: 121 NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180
           NLL+ERGPLPE EA+RFFRQI+IGISYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAA
Sbjct: 118 NLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 177

Query: 181 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240
           LE++DKLLETSCGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFD++DGNIR
Sbjct: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237

Query: 241 NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK 300
            LLL+VQSG +EMP  DEIS +AQDLIA+ILTVDP  RIK R+ILKHPLL+KYPSI DSK
Sbjct: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSK 297

Query: 301 SIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYA 360
           SIRNLPREDTYL+PL   +   +D  IL+NLVVLWHGR++ EI+ KL E G N EKT YA
Sbjct: 298 SIRNLPREDTYLNPLDHNDGT-VDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYA 356

Query: 361 LLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTN---ASPKRRNRTSMIS 417
           LL RFK + E   +K  Q  KR+S  +   Q    K+ S+   N    +PK++ R+S I+
Sbjct: 357 LLHRFKYENEQQQLKQQQIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKK-RSSGIN 415

Query: 418 VSSSHKRPVSFNKLXXXXXXXXXXXXXXXXXXKRVSVNLSSNKRLSAVYTNSGSPTPASR 477
           VSS+HKRPVS  K                   K+ S+   SN++LSA+     +P+ +  
Sbjct: 416 VSSAHKRPVSIQKW----GEIGGGNNGLISPSKKRSL---SNRKLSAIL---NTPSSSPS 465

Query: 478 HKRVSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLI 537
            KR+SI         D PP+P  +L+DY+     KR SRN+ R SF PS KR SIT+K+I
Sbjct: 466 RKRMSIA-------QDAPPMPTSVLRDYN-----KRASRNSKRFSFLPSIKRQSITSKII 513

Query: 538 STYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKF 576
           +TYAKLSED+DWEYI+KE KRTSSDFATL D IFEHEK+
Sbjct: 514 ATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKY 552

 Score =  290 bits (742), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 221/571 (38%), Positives = 310/571 (54%), Gaps = 80/571 (14%)

Query: 621  RQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGAVNGRSVSEPLQKKSA----DPM 676
            RQ E+QR +++EVA L  EL+     +Q  +   ++  V  RSVSEP ++ S+    D +
Sbjct: 627  RQEELQRSLEDEVAKLRAELEE-TRVEQQLNSMSKN-QVARRSVSEPHKRHSSTSKRDSL 684

Query: 677  ADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQYTGSEDRAK--LNNDKIILE 734
              LQ +I+ +L +R  S+QTRP+SRLDPG+ + + + +  Y   E  ++  L  +K ILE
Sbjct: 685  LALQYSINTVLNKRAVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILE 744

Query: 735  TIRRSKFLGSSFDINKELK-----------------RAADNEAKKQRQSKATSDRIISTT 777
            TIRRS FLGS FDI+KELK                 R   +      Q   +    I++ 
Sbjct: 745  TIRRSNFLGSQFDIHKELKNAKKEKIEKAKKRKQLNRKLPDRISYHDQRFVSDGTTITSA 804

Query: 778  NDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMYS 837
            +D Y+T  L ++ T    L+D   ++EP+K+S++++P+ TR+SR    S+KR SVLSMYS
Sbjct: 805  HDGYDTTSLTRHTTVGV-LRDD--ESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYS 861

Query: 838  SKQSYTNLADLLNEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGE--VTGDSSHDGRLY 895
            +  SYTNLAD +  +    K   D+ + +   +PEF+FE+  ++ E   + D+SH   + 
Sbjct: 862  TMTSYTNLADFMKSDV-QLKPLNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSM- 919

Query: 896  EVPEDSNMTKEKLKLNFADRF----------KTSNGEDRTAED-KNVRLPTLPPLD--GK 942
            E P ++      +KLN+ADRF           T N +  T ED   V+LP LPPL+   K
Sbjct: 920  EAPNNT-----VIKLNYADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNK 974

Query: 943  EAKGLGIYQSSSESLPEPAQHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNA 1002
               GLGIYQ SS    E  +H V+S+  N+  +           ED A    QQ+APL +
Sbjct: 975  SPNGLGIYQHSSPR--EDFKHAVRSVTPNENKE----------NEDPAGTT-QQKAPLTS 1021

Query: 1003 -----SIPKHRTDGAQKSERMPSKEGSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVA 1057
                  I +  TD AQ        +G  KKR  SFFRKFSK   EK   E+D +L  +V 
Sbjct: 1022 VGKELGIREPLTDLAQ--------QGVPKKR-PSFFRKFSK---EKIKPEYDYQLDTTVN 1069

Query: 1058 AKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKGS 1117
                          W  YGLK V+S P    +TGKLSS+NILSLRST F++VV     GS
Sbjct: 1070 NTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAFQVVVAGSNHGS 1129

Query: 1118 IVGFRKKSGSTKTLKRLVSEIEKVLLKERVL 1148
             V F KKSGS KT  RLV+EIEK+L KE+VL
Sbjct: 1130 SVRFTKKSGSKKTFARLVNEIEKILEKEKVL 1160

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/534 (66%), Positives = 415/534 (77%), Gaps = 36/534 (6%)

Query: 1   MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG 60
           M  ++N+    VKGN +GPWKLGETLGLGSTGKVQLAY+ ST QQAAIKVISKA+FN   
Sbjct: 1   MVKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFN-ND 59

Query: 61  SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120
           +   S  A  TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWET+SNLYMVLEYA+KGELF
Sbjct: 60  NANASDSALLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119

Query: 121 NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180
           NLLVERGPLPE EAIRFFRQI+IGISYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAA
Sbjct: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 181 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240
           LETEDKLLETSCGSPHYAAPEI+SG+PYHG  +DVWSCG+ILFALLTGRLPFD+EDGNIR
Sbjct: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239

Query: 241 NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK 300
           NLLL+VQSG++EMPG+DEIS +AQDLI++ILTVDP++RIK R+ILKHPL+QKYPSI DSK
Sbjct: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSK 299

Query: 301 SIRNLPREDTYLHPLSE--GESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTL 358
           +IRNLPREDTYL+PLS+  G+  EID  ILQNLVVLWHGR+  EI  KL+EPGANAEKTL
Sbjct: 300 TIRNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTL 359

Query: 359 YALLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQ------TNASPKRRNR 412
           YALLDRFK+DTE +  +  Q KKR SQ+      +     +          N   KR+NR
Sbjct: 360 YALLDRFKNDTEKEIKRQSQLKKRQSQVQQTHSHSNSNTSAYSHVSRGALVNTPTKRKNR 419

Query: 413 TSMISVSSSHKRPVSFNKLXXX------------------XXXXXXXXXXXXXXXKRVSV 454
            SM+SVSS+HKRPVSFN+L                                    KR+S+
Sbjct: 420 ASMVSVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSI 479

Query: 455 NLSSNKRLSAVYTN--SGSPTPASRHKRVSIVDLERERENDTPPVPIEMLKDYS 506
           NLSSNKR+S +  N  + SPTP++  KR+SI+       N TPPVP++++K+Y+
Sbjct: 480 NLSSNKRISQLLANDLNTSPTPSNCTKRMSII-------NGTPPVPMDIMKNYN 526

 Score =  365 bits (938), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 279/800 (34%), Positives = 394/800 (49%), Gaps = 176/800 (22%)

Query: 513  RLSRNNMRLSFKPSNKRGSITTKLISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFE 572
            R SR+  R S +P+ +RGSITTKLISTYA+L+EDDDWE+IEKETKR SS+FATL D IFE
Sbjct: 606  RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665

Query: 573  HEKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLERRQLEIQRQMDEE 632
            HEK+                                        +LE+ +L++Q++M+ +
Sbjct: 666  HEKYEQIRKEKDELERKVRENKKREEEERLVREAIEKEKQI---ELEKERLQLQKEMEGD 722

Query: 633  VANLGKELQGG----------MNADQDADEGDEHGAVNGRSVSEPLQK--KSADPMADLQ 680
            + N  + +Q            +  + D +E D    +  RSVS PL+K  KS D   D  
Sbjct: 723  IDNAKETVQTTEGKREAHNDKIKTETDDEERDIIVDIQPRSVSAPLEKTEKSRDSPFDYS 782

Query: 681  ANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQYTGSEDRA---------KLNNDKI 731
                   +QR FSL+TRPVSRLDPG+  S  +    Y  S             +++  K+
Sbjct: 783  -------KQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKV 835

Query: 732  ILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSK----------------------AT 769
            ILETIRRSKFLGSSFD+ KEL+   + E+ + +Q                         +
Sbjct: 836  ILETIRRSKFLGSSFDLKKELEMVEELESNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTS 895

Query: 770  SDRIISTTNDEYETQILPK-NATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNK 828
            +DRI+STTND YET+ILPK +A  +  +  ++   +PR +S+IKVPQFTRKS+ F +SNK
Sbjct: 896  NDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSESNK 955

Query: 829  RLSVLSMYSSKQSYTNLADLLNEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDS 888
            RLSVLS+YSS++S+TNL D+L E+  N +    SP  +S  EPEFLFE+   D      S
Sbjct: 956  RLSVLSLYSSRESFTNLVDMLKEDGINVEPTERSPTTKS-QEPEFLFESPSVDTYSRDSS 1014

Query: 889  SHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKN------------------ 930
            + D  + E      +    L+L+F DRF      + T + KN                  
Sbjct: 1015 TEDKPINEKENSEPIQSNNLRLSFHDRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGV 1074

Query: 931  -------------VRLPTLPPLDGKEAKGLGIYQ------SSSESLP-EPAQHNVK---- 966
                         V+LP LPPL  K+  GLGIYQ      SS+ S P  P+  N +    
Sbjct: 1075 DLSTPKAKDESNLVKLPALPPLTTKKTDGLGIYQKSKQRTSSNASNPITPSSTNAQLTSA 1134

Query: 967  ---------SMIQ-------------NDENQ--PSETAEVLSIKEDNAQV---------- 992
                     +MI              N+ ++  P + +E++S + ++ Q+          
Sbjct: 1135 AVNVTPPTTTMINESIQKLQESREKVNNSSKLIPPKNSEIISQQNESVQIRDDYKTKPER 1194

Query: 993  ----ERQQEAP-----LNASIPKHRTDGAQKSERMPSKEGSEKKRNTSFFRKFSK----- 1038
                ++ + AP     LN  + K R     +    PS+EG  KK   SFFRKFSK     
Sbjct: 1195 SNKADQSERAPPAETTLNDVMTK-RNQSKSRDNPQPSEEG--KKGVNSFFRKFSKGSSRQ 1251

Query: 1039 ---------------------------SSNEKTNGEFDAELYASVAAKXXXXXXXXXXXX 1071
                                       +S   T+ ++D +L A+VAA             
Sbjct: 1252 SSNSSNKNKSLADDKNIPSVPKPVAHPASPVSTSNDYDFQLKANVAAPQMFKGLDTLFRG 1311

Query: 1072 WKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRG-KGSIVGFRKKSGSTKT 1130
            W KYGLK +KS P+ L  TGK+SSENILS +ST+FE+ + S   K  ++ F+K SGS+K+
Sbjct: 1312 WSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFELEIISNSVKTCLLRFKKTSGSSKS 1371

Query: 1131 LKRLVSEIEKVLLKERVLTK 1150
            ++RLV+E+E VL KE VL K
Sbjct: 1372 VRRLVNEVENVLRKEGVLLK 1391

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score =  553 bits (1425), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 261/357 (73%), Positives = 301/357 (84%), Gaps = 11/357 (3%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGS-VKDSSVAASTPDSL 75
           IGPWKLGETLG GSTGKVQLA  E T  + A+KVISK+IFN  G+   D SV       L
Sbjct: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV-------L 70

Query: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135
           PY IEREI+IMKLL+HPNVL LYDVWETN+NLY++LEYA+KGELFNLLV+ GPLPE+EAI
Sbjct: 71  PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAI 130

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
             FRQI+IGISYCHALGIVHRDLKPENLLLD  +NIKIADFGMAAL+T+  LLETSCGSP
Sbjct: 131 NCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSP 190

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
           HYAAPEIVSG+PY GFASDVWSCGVILFALLTGRLPFD+E+GN+R+LLL+VQ G++EMP 
Sbjct: 191 HYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN 250

Query: 256 DDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHPL 315
           D EIS DAQDLI +IL VDP QRIK RDIL HPLL+KY +I DSKSI++LPRE+TYL+PL
Sbjct: 251 DTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPL 310

Query: 316 SEGE---SAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFKSDT 369
           ++     SA ID++ILQNLVVLWHGR   +I++KL+E G N EK LYALL RFK D+
Sbjct: 311 ADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367

 Score =  233 bits (594), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 224/700 (32%), Positives = 335/700 (47%), Gaps = 121/700 (17%)

Query: 471  SPTPASRHKRVSIVDLERERENDTPP-VPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKR 529
            SP P    KR++ +++       TP  VP        +  K+    R++ RLS+ P+ KR
Sbjct: 439  SPIPLRSSKRITHINVASANTQATPSGVP--------NPHKRNSKKRSSKRLSYMPNTKR 490

Query: 530  GSITTKLISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFXXXXXXXXXXXXX 589
             S+T+K +S +  L +DDDWEYIEK+ KRTSS+FATL D+IFE EKF             
Sbjct: 491  SSLTSKSLSNFTNLIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKA----- 545

Query: 590  XXXXXXXXXXXXXXXXXXXXXXXXXXXDLERRQLEIQRQ-MDEEVAN---LGKELQGGMN 645
                                       +L+R+  E +RQ ++ +  N    G E+  GM 
Sbjct: 546  ---------------------------ELQRKVQEAKRQSVNAQKINEDEFGSEVSDGMK 578

Query: 646  ADQDADEGDEHGAVNGRSVSEPLQKKSADPMADLQANIDDLLRQR-TFSLQTRPVSRLDP 704
                     E   +N + VS PL          LQ +ID LL  R   S  TRP+SRLDP
Sbjct: 579  ---------ELKKINDK-VSSPLINYEFSQQELLQ-DIDTLLTNRYQLSSYTRPISRLDP 627

Query: 705  GVFSSDSSEKDQYTGSEDRAKL-NNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQ 763
            G+  +  +E       E  A L + +K I+ETIRRSKFLGS  ++   L         K 
Sbjct: 628  GL--TPVTETLPNNLKEKTALLQDTEKKIIETIRRSKFLGSLLNVRGGLSPG------KS 679

Query: 764  RQSKATSDRIISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQF 823
              +      I+STT                 PL  +N + EPR+ISD++VP FTRKS+ F
Sbjct: 680  ELAPIEESPIVSTT-----------------PLI-YNDRMEPRRISDVEVPHFTRKSKHF 721

Query: 824  GDSNKRLSVLSMYSSKQSYTNLADLLNEEASNAKGNRDSPNDQSGHEPEFL-----FENV 878
              +N R SVLS+Y +K S  +L + L +E  +      + N+    +PE         N+
Sbjct: 722  TTANNRRSVLSLY-AKDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNI 780

Query: 879  Q--EDGEVTGDS-SHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDK-NVRLP 934
            Q  ED    GD+ ++D  L + P+   +++E    +  D+    +   ++AE    V+LP
Sbjct: 781  QYDEDDSKDGDNVNNDNILSDFPQGVGISQE---YDMKDKNPNQSPISKSAEPTLVVKLP 837

Query: 935  TLPPLDGKEAKGLGIYQSSSESLPEPAQHNVKSMIQNDENQPSETAEVLSIKEDNAQVER 994
            +L    GK A GLG+YQ       EP++  + S+  N+    S   E +   ED A+   
Sbjct: 838  SLSSFQGKNASGLGLYQR------EPSKVTLPSLTSNN----SSVGENI---EDGAEKGT 884

Query: 995  QQE---APLNASIPKHRTDGAQKSERMPSKEGSEKKRNTSFFRKFSKSSNEKTNGEFDAE 1051
            + E   A L+    K   D  + ++ + +    +K  N+   +KFSK          + E
Sbjct: 885  ESEKIAASLSDDDLKEDND-KKDNDTVNAPTTVKKPPNSVLLKKFSKGK------ILELE 937

Query: 1052 LYASVAAKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVW 1111
            ++A +  K            WK+YGLK +      + +TGKL +++IL LRSTLFE++V 
Sbjct: 938  IHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVL 997

Query: 1112 SRGKG-SIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLTK 1150
              G G S++ F KK+GSTKTL +L +EI+ +L KE VL K
Sbjct: 998  PNGDGRSLIKFNKKTGSTKTLTKLATEIQIILQKEGVLDK 1037

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
           Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  466 bits (1198), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 231/373 (61%), Positives = 285/373 (76%), Gaps = 11/373 (2%)

Query: 206 IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQD 265
           +PYHGF SDVWSCG+ILFALLTGRLPFD+EDGNIRNLLL+VQSG++EMP  DEISP+AQD
Sbjct: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 266 LIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHPLSEGESAEIDE 325
           LIA+ILTVDP  RIK+R+ILKHPLLQKYPSI DSKSIRNLPREDTYL+PL +  +  IDE
Sbjct: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL-DSVNGSIDE 128

Query: 326 NILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFKSDTENDSVKHPQSKKRVSQ 385
           +I+ NLVVLWHGR++ EI  +L+EPGAN EKT YALL RFK D+  + +K  Q + + S 
Sbjct: 129 SIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQ-QRRSQASH 187

Query: 386 INPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSHKRPVSFNKLXXXXXXXXXXXXXX 445
           I+P R         +  TN +PK++N+  +IS SSSHKRPVSFN+L              
Sbjct: 188 ISPKRSNMRNSVSRRSITNVTPKKKNKAPVISASSSHKRPVSFNRL-SFNNGSNTAHTPP 246

Query: 446 XXXXKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRVSIVDLERERENDTPPVPIEMLKDY 505
               KR SVNLSSNKR+SA+   + SPTP   HKR S+ DL    +   PP+P++MLKDY
Sbjct: 247 TSASKRASVNLSSNKRISALINPNNSPTPV--HKRSSMRDL----DASAPPIPMDMLKDY 300

Query: 506 SSTAKQ--KRLSRNNMRLSFKPSNKRGSITTKLISTYAKLSEDDDWEYIEKETKRTSSDF 563
           + +A +  +R +R + RLSF P NKRGSITTKLI+TYAK+S+D+DWEYIEKET+RTS+DF
Sbjct: 301 NKSAPKVSRRSTRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADF 360

Query: 564 ATLCDQIFEHEKF 576
           ATLCD+IFEHEK+
Sbjct: 361 ATLCDEIFEHEKY 373

 Score =  331 bits (849), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 229/520 (44%), Positives = 299/520 (57%), Gaps = 47/520 (9%)

Query: 662  RSVSEP----LQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQY 717
            RSVS P    L+        +L  +I  LL +RTFSL+TRP SRLDPG+++S   E++ +
Sbjct: 457  RSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGIYTS---EEEDF 513

Query: 718  TGSEDRAKLNNDKIILETIRRSKFLGSSFDINKELKRA-------ADNEAKKQRQSKATS 770
                  A L+ +K ILETIRRSKFLGSSFDINKEL R        A    +K  +  A++
Sbjct: 514  GSKNHGADLSTEKTILETIRRSKFLGSSFDINKELARERRLKEERAALAKRKDEERVASN 573

Query: 771  DRIISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRL 830
                +   + YE+Q LPK    SA        +EPRKIS+++VPQFTR+SR F  SNKRL
Sbjct: 574  ATTANVVGNGYESQTLPKRKMGSA----MEASSEPRKISEVEVPQFTRRSRHFTASNKRL 629

Query: 831  SVLSMYSSKQSYTNLADLLNEEASNAKGNRDSPNDQS--GHEPEFLFENVQEDGEVTGDS 888
            SVLSMYS+K S+TNLAD L  +A + +  + SP   S    E EF+FE+V ++G+ T D+
Sbjct: 630  SVLSMYSTKTSFTNLADHLKGKA-DVQLIQTSPPSASKMDQEAEFMFESVDKEGKETADT 688

Query: 889  SHDGRLYEVPE--DSNMTKEKLKLNFADRFK--TSNGEDRTAEDKNVRLPTLPPLDGKE- 943
            S D RLYEV E  D+   K  +KLNFADRF   TS     T     ++LP LPPLD  + 
Sbjct: 689  SADSRLYEVAETKDAKNAKPAVKLNFADRFNRPTSPPSQDTDSSAAIKLPALPPLDKNKP 748

Query: 944  --AKGLGIYQSSSESLPEPAQHNVKSMIQND---------ENQPSETAEVLSIKEDNAQV 992
                GLG+YQ+++E   E AQ   KSM+ +D          N  +ET E     +++  V
Sbjct: 749  NMVSGLGLYQATAEPSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEA---AKNSTVV 805

Query: 993  ERQQEAPLNASIPKHRTDGAQK--SERMPSKEGSEKKRNTSFFRKFS-KSSNEKTNGEFD 1049
                 APLN ++ K  TD  +K  S+  P     EKK N SFFRKFS K S+EK +G++D
Sbjct: 806  PTAPVAPLN-NVMKKNTDADRKPLSDITP---AVEKKANKSFFRKFSSKGSDEKKSGDYD 861

Query: 1050 AELYASVAAKXXXXXXXXXXXXWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMV 1109
                  +               WK YGLK V + P    + GKLSS+NILSLRSTLF + 
Sbjct: 862  FRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIIT 921

Query: 1110 VWSRGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLT 1149
            V  RG+GS V F KKSGS KT K+LV EIEK+L  ++ L 
Sbjct: 922  VVGRGEGSYVEFTKKSGSNKTFKKLVKEIEKILESKKALV 961

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  404 bits (1037), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 216/432 (50%), Positives = 286/432 (66%), Gaps = 24/432 (5%)

Query: 1   MAAMSNRSVPTVKGNK------IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKA 54
           ++ +SN S    K  K      +GPWKLG+TLG GS+G+V+LA +  T + AAIK++ K 
Sbjct: 39  LSQISNASTTVRKTGKKKNRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKR 98

Query: 55  IFNVKGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYA 114
                 +V+ ++   +   SLPYGIEREIIIMKL++HPNV+ LY+VWE    LY+VLEY 
Sbjct: 99  ------NVRHNNTQLT---SLPYGIEREIIIMKLISHPNVMALYEVWENKPELYLVLEYV 149

Query: 115 QKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHK-FNIKI 173
           + GELF+ L+ RG LPE+EA+ +F+QIV G+SYCH   I HRDLKPENLLLD K  ++KI
Sbjct: 150 EGGELFDYLISRGKLPEQEAVHYFKQIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKI 209

Query: 174 ADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFD 233
           ADFGMAALET DKLLETSCGSPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+
Sbjct: 210 ADFGMAALETTDKLLETSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN 269

Query: 234 DEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
           D+  N++ LLL+VQSG+Y+MP +  IS +A+DLIA+IL VDP  RI   ++L+HPLL KY
Sbjct: 270 DD--NVKKLLLKVQSGKYQMPQN--ISNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKY 325

Query: 294 PSINDSKSIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGAN 353
                SKS  NL   D+  + +      +IDE+IL NL +LWHG  +  +  KL + G  
Sbjct: 326 QKTR-SKSSSNLHALDSTPNIVVLESEDKIDESILSNLQILWHGAPKEYLTGKLLQQGFT 384

Query: 354 AEKTLYALLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRT 413
            EK  Y+LL R++   E   +      K +S + P+R+  +  A +      S  R  + 
Sbjct: 385 EEKLFYSLLLRYQ---ERQKLPEASQPKPLSSLAPLRKTGSSNADTPQLGVLSAPRIVQK 441

Query: 414 SMISVSSSHKRP 425
           S  SV++  K P
Sbjct: 442 SQFSVNTLAKSP 453

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  400 bits (1027), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 200/372 (53%), Positives = 257/372 (69%), Gaps = 22/372 (5%)

Query: 2   AAMSNRSVPTVKGNK------IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAI 55
            A SN +V   K +K      +GPWKLG+TLG GS+G+V+LA +  T + +AIK++ K  
Sbjct: 49  TASSNANVNNTKTSKRRNRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKF 108

Query: 56  FNVKGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQ 115
                      V ++    LPYGIEREIIIMKL++HPNV+ LY+VWE  S LY+VLEY +
Sbjct: 109 -----------VKSNQIKQLPYGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVE 157

Query: 116 KGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLD-HKFNIKIA 174
            GELF+ LV +G LPE EAI +F+QIV  ++YCH   I HRDLKPENLLLD  K +IKIA
Sbjct: 158 GGELFDYLVSKGKLPESEAIHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIA 217

Query: 175 DFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDD 234
           DFGMAALET DKLLETSCGSPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+D
Sbjct: 218 DFGMAALETSDKLLETSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFND 277

Query: 235 EDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYP 294
           +  N++ LLL+VQSG+Y+MP    +S +A+DLI+RIL VDP +RI    IL+H LL KY 
Sbjct: 278 D--NVKKLLLKVQSGKYQMP--QWLSVEAKDLISRILVVDPNRRITIDQILQHELLTKYD 333

Query: 295 SINDSKSIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANA 354
             + SKS  +L   +   + +S     +IDE IL NL +LWHG  +  ++ +L +PG   
Sbjct: 334 QKSRSKSNSDLNLLNRTPNIVSFSSERDIDETILSNLQILWHGAARKHLVTRLMKPGFTE 393

Query: 355 EKTLYALLDRFK 366
           EK  Y+LL  ++
Sbjct: 394 EKMFYSLLWNYQ 405

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  402 bits (1034), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/375 (54%), Positives = 260/375 (69%), Gaps = 24/375 (6%)

Query: 1   MAAMSNRSVPTVKGNK------IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKA 54
           ++ +SN S    K  K      +GPWKLG+TLG GS+G+V+LA +  + + AAIK++ K 
Sbjct: 36  LSQISNSSTAHTKTGKRKNRDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKR 95

Query: 55  IFNVKGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYA 114
             NV+ + K  +       +LPYGIEREIIIMKL+ HPN++ LY+VWE  S LY+VLEY 
Sbjct: 96  --NVRHNQKQVT-------ALPYGIEREIIIMKLITHPNIMALYEVWENKSELYLVLEYV 146

Query: 115 QKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKF-NIKI 173
           + GELF+ L+ RG LPE+EAI +F+QIV G+SYCH   I HRDLKPENLLLD K   +KI
Sbjct: 147 EGGELFDYLIARGKLPEQEAIHYFKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKI 206

Query: 174 ADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFD 233
           ADFGMAALET ++LLETSCGSPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+
Sbjct: 207 ADFGMAALETTNRLLETSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN 266

Query: 234 DEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
           D+  N+R LLL+VQ GRY+MP +  +S +A+DLI++IL VDPE+RI    IL+HPLL KY
Sbjct: 267 DD--NVRKLLLKVQHGRYQMPSN--VSKEAKDLISKILVVDPEKRITVDKILEHPLLVKY 322

Query: 294 PSINDSKSIRNLPREDTYLHP--LSEGESAEIDENILQNLVVLWHGREQLEIINKLREPG 351
              N  K     P E     P  L      +IDE IL NL +LWHG  +  +++KL + G
Sbjct: 323 D--NPGKGGLACPLEKPEERPKVLDIHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSG 380

Query: 352 ANAEKTLYALLDRFK 366
              EK  YALL R++
Sbjct: 381 FTEEKLFYALLLRYQ 395

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  395 bits (1015), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/355 (56%), Positives = 247/355 (69%), Gaps = 34/355 (9%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           IGPWKLG+TLG GS+G+V+LA +  T + AA+K++ K               +S P++LP
Sbjct: 55  IGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPK-------------TKSSRPNALP 101

Query: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIR 136
           YGIEREIIIMKL++HPNV+ LY+VWE    L++VLEY   GELF+ LV RG L EKEAI 
Sbjct: 102 YGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEAIH 161

Query: 137 FFRQIVIGISYCHALGIVHRDLKPENLLLDHKFN-IKIADFGMAALETEDKLLETSCGSP 195
           +FRQI+ G +YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+T +KLLETSCGSP
Sbjct: 162 YFRQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSP 221

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
           HYA+PEIV G  Y+G  SDVWSCG+ILFALLTG LPF+D+  NI+ LLL+VQ+G+Y+MP 
Sbjct: 222 HYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFNDD--NIKRLLLKVQAGKYQMP- 278

Query: 256 DDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHPL 315
              IS +AQDLI+RIL VDP +RI   DIL HPL+ KY     SKS       ++ LH L
Sbjct: 279 -QAISLEAQDLISRILVVDPNKRITINDILSHPLITKY-DYKRSKS-------NSDLHIL 329

Query: 316 SEGESA--------EIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL 362
           S             ++D  ILQNL +LWHG  +  I+ +L EP    EKT Y+LL
Sbjct: 330 SHTSPQICTIRSERDVDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLL 384

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  397 bits (1021), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 214/428 (50%), Positives = 278/428 (64%), Gaps = 28/428 (6%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +GPWKLG+TLG GS+G+V+LA +  T + AAIK++ K +     + K S+ A     +LP
Sbjct: 58  VGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRSTNASKKSNAANG---NLP 114

Query: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIR 136
           YGIEREIIIMKL++HPN++ LY+VWE  S L++VLEY + GELF+ LV +G LPE+EA+ 
Sbjct: 115 YGIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPEQEAVH 174

Query: 137 FFRQIVIGISYCHALGIVHRDLKPENLLLDHK-FNIKIADFGMAALETEDKLLETSCGSP 195
           +FRQI+ G++YCH   I HRDLKPENLL+D K   IKIADFGMAALET +KLLETSCGSP
Sbjct: 175 YFRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAALETTNKLLETSCGSP 234

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
           HYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+D+  NI+ LLL+VQSG+Y MP 
Sbjct: 235 HYASPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFNDD--NIKKLLLKVQSGKYHMPQ 292

Query: 256 DDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY-PSINDSKSIRNLPREDTYLHP 314
           +  IS +AQDLI++IL VDP  RI   ++L+HPL+ KY  + + S S  +L      L  
Sbjct: 293 N--ISSEAQDLISKILIVDPRGRITINEVLQHPLITKYDKARSKSNSDLHLLSRTPQLVT 350

Query: 315 LSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL----DRFKSDTE 370
           L   E  +ID +IL NL +LWHG     I+ +L + G   EK  Y+LL    +R     E
Sbjct: 351 LQSKE--DIDGSILGNLQILWHGAPSEYIVARLLQHGFTEEKLFYSLLWQYQERQNPSVE 408

Query: 371 NDSVKHPQSKKRVSQINPVRQPTTKKAP-----------SKPQTNASPKRRNRTSMISVS 419
           NDS    ++   VS   P   P  + A            S P    SPK+     ++S S
Sbjct: 409 NDSFV--ETTVSVSTGTPTPTPAAEDAVGAPKLLQKSQFSIPSLKVSPKKMKDGYVVSSS 466

Query: 420 SSHKRPVS 427
              K+ VS
Sbjct: 467 RVFKKSVS 474

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  399 bits (1025), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/385 (52%), Positives = 258/385 (67%), Gaps = 45/385 (11%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDS---SVAAS--- 70
           +GPWKLG+TLG GS+G+V+LA +  T Q AAIK++ K  F+ K   +DS   S+++S   
Sbjct: 70  VGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKN-FHSKKKRQDSPAKSLSSSPDK 128

Query: 71  ---------TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFN 121
                     P +  YGIEREI+IMKL++HPNV+ LY+VWE  S LY+VLEY   GELF+
Sbjct: 129 PYTTHSNETNPSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLEYVDGGELFD 188

Query: 122 LLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFN-IKIADFGMAA 180
            LV RG LPE+EA+ +F+QI+ G++YCHA  I HRDLKPENLLLD K   IKIADFGMAA
Sbjct: 189 YLVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMAA 248

Query: 181 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240
           LE  DKLL TSCGSPHYA+PEIV G  YHG  +DVWSCG+ILFALLTG LPF+ +  NI+
Sbjct: 249 LEVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFALLTGHLPFNHD--NIK 306

Query: 241 NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI---- 296
            LLL+VQSG Y MP D  +SPDA+DLI++IL VDP++R+   +IL H L+ KY  +    
Sbjct: 307 KLLLKVQSGVYHMPSD--LSPDAKDLISKILVVDPDKRLTTTEILNHSLITKYDRMGLTN 364

Query: 297 ---NDSKS------------IRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQL 341
              N++ S            I NL   D  L         +ID +IL NL +LWHG  + 
Sbjct: 365 RNYNNNLSMARDKSNSNLNFINNLSNVDILLQ-----NPCDIDTSILSNLQILWHGESKH 419

Query: 342 EIINKLREPGANAEKTLYALLDRFK 366
            II+KL +P  N EK  Y+LL ++K
Sbjct: 420 AIIDKLLQPNMNEEKLFYSLLLKYK 444

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  392 bits (1006), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/355 (55%), Positives = 247/355 (69%), Gaps = 34/355 (9%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           IGPWKLG+TLG GS+G+V+LA +  T + AAIK++ K               +S   SLP
Sbjct: 55  IGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPK-------------TKSSRTGSLP 101

Query: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIR 136
           YGIEREIIIMKL++HPNV+ LY+VWE    L++VLEY   GELF+ LV RG LPEKEAI 
Sbjct: 102 YGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIH 161

Query: 137 FFRQIVIGISYCHALGIVHRDLKPENLLLDHKFN-IKIADFGMAALETEDKLLETSCGSP 195
           +FRQI+ G +YCH   I HRDLKPENLLLD K   IKIADFGMAAL+T +KLLETSCGSP
Sbjct: 162 YFRQIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSP 221

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
           HYA+PEIV G  Y+G  SDVWSCG+ILFALLTG LPF+D+  NI+ LLL+VQ+G+Y+MP 
Sbjct: 222 HYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFNDD--NIKRLLLKVQAGKYQMP- 278

Query: 256 DDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHPL 315
              +S  AQDLI+RIL VDP++RI   +IL HPLL KY    + +S     + ++ LH L
Sbjct: 279 -QSVSSGAQDLISRILVVDPDKRISINEILAHPLLAKY---GNKRS-----KSNSDLHIL 329

Query: 316 SEGE--------SAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL 362
           S  +         +++D  ILQNL +LWHG  +  I+  L +P    EKT Y+LL
Sbjct: 330 SHSKPQISTIKSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLL 384

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  392 bits (1008), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 214/423 (50%), Positives = 286/423 (67%), Gaps = 43/423 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKA-IFNVKG--SVKDSSVAAS--T 71
           +GPWKLG+TLG GS+G+V+LA +  T Q AAIK++ K  IF  +   S + SS +++  +
Sbjct: 89  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQNDNSFQMSSYSSNDES 148

Query: 72  PDSL----------PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFN 121
           P             PYGIEREI+IMKL++HPNV+ LY+VWE  S L++VLEY   GELF+
Sbjct: 149 PKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKSELFLVLEYVDGGELFD 208

Query: 122 LLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFN-IKIADFGMAA 180
            LV RG L E+EA+ +F+QI+ G+SYCH+  I HRDLKPENLLLD K N IKIADFGMAA
Sbjct: 209 YLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGMAA 268

Query: 181 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240
           LE  +KLL TSCGSPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+D+  +I+
Sbjct: 269 LELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFALLTGHLPFNDD--SIK 326

Query: 241 NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK 300
            LLL+VQSG+++MP +  IS +A+DLI+RIL VDPE+RI+  DIL HPL++KY    D+K
Sbjct: 327 KLLLKVQSGKFQMPQN--ISLEAEDLISRILVVDPEKRIQINDILIHPLIRKY---EDNK 381

Query: 301 SIRN-------LPREDTYLHPLSE-GESA-------EIDENILQNLVVLWHGREQLEIIN 345
           +  N         + ++ LH L++ G S        EIDE+IL+NL +LWHG  +  II+
Sbjct: 382 TDSNNVSSYKKSSKSNSNLHILNDMGPSIVTLKARNEIDESILKNLQILWHGTSRELIIS 441

Query: 346 KLREPGANAEKTLYALLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTK----KAPSKP 401
           KL +   + EK  Y+LL ++K       ++H   +   S  +PV Q  ++    K+  KP
Sbjct: 442 KLLQTPMSEEKLFYSLLLQYKKKNSIPLIQHTNHEASASN-SPVSQSNSENGDTKSIRKP 500

Query: 402 QTN 404
            TN
Sbjct: 501 TTN 503

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  390 bits (1002), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/402 (50%), Positives = 269/402 (66%), Gaps = 50/402 (12%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG---------------S 61
           +GPWKLG+TLG GS+G+V+LA +  T Q AAIK++ K   NV G               S
Sbjct: 76  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKK-NNVLGKNDACSTSSASYTSNS 134

Query: 62  VKDSSVAASTPDSL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMV 110
            + S++  +T ++            PYGIEREI+IMKL++H NVL LY+VWE  S LY+V
Sbjct: 135 SQTSTMMNTTANNYTTAGHSNVATNPYGIEREIVIMKLISHANVLGLYEVWENKSELYLV 194

Query: 111 LEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHK-F 169
           LEY   GELF+ LV RG L E+EA+ +F+QI+ G+SYCHA  I HRDLKPENLLLD K  
Sbjct: 195 LEYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLLDKKNS 254

Query: 170 NIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGR 229
            IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG 
Sbjct: 255 TIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFALLTGH 314

Query: 230 LPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPL 289
           LPF+D+  +I+ LLL+VQSG+Y+MP +  +S +AQDLIA+ILTV+P +R+   +IL+HPL
Sbjct: 315 LPFNDD--SIKKLLLKVQSGKYQMPQN--LSKEAQDLIAKILTVNPAKRLTTEEILRHPL 370

Query: 290 LQKYPSINDSKSIRNL------PREDTYLHPLSEGESA--------EIDENILQNLVVLW 335
           + KY S+  +K  + L       + +  LH L+  E+         +ID+ IL NL +LW
Sbjct: 371 IVKYDSMMKTKKYKALYKNMGQGKSNADLHLLNNYEATTINLNSRKDIDDTILNNLQILW 430

Query: 336 HGREQLEIINKLREPGANAEKTLYALLDRFKSDTENDSVKHP 377
           HG  +  I+ KL +P  + EK  Y+LL ++K   EN S  HP
Sbjct: 431 HGASRELIVAKLLQPRMSEEKVFYSLLLKYK---ENHS-SHP 468

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  392 bits (1006), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/387 (51%), Positives = 268/387 (69%), Gaps = 41/387 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVI--SKAIFNV--KGSVKDSSVAA--- 69
           +GPWKLG+TLG GS+G+V+LA +  T Q AAIK++   KA  +    G+V +S  ++   
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVT 137

Query: 70  ---STPD-----------SLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQ 115
              S+P            + PYGIEREI+IMKL++H NV+ L++VWE  S LY+VLEY  
Sbjct: 138 SNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEYVD 197

Query: 116 KGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHK-FNIKIA 174
            GELF+ LV +G LPE+EAI +F+QIV G+SYCH+  I HRDLKPENLLLD K   IKIA
Sbjct: 198 GGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIA 257

Query: 175 DFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDD 234
           DFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++LFALLTG LPF+D
Sbjct: 258 DFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFND 317

Query: 235 EDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYP 294
           +  NI+ LLL+VQSG+Y+MP +  +S +A+DLI++IL +DPE+RI  ++ILKHPL++KY 
Sbjct: 318 D--NIKKLLLKVQSGKYQMPSN--LSSEARDLISKILVIDPEKRITTQEILKHPLIKKYD 373

Query: 295 SINDSKSIRNLPREDTY-------LHPLSE--------GESAEIDENILQNLVVLWHGRE 339
            +  +K +R + +++         LH L+             EIDE+IL++L +LWHG  
Sbjct: 374 DLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQILWHGVS 433

Query: 340 QLEIINKLREPGANAEKTLYALLDRFK 366
           +  I  KL +   + EK  Y+LL ++K
Sbjct: 434 RELITAKLLQKPMSEEKLFYSLLLQYK 460

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  390 bits (1002), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/376 (54%), Positives = 260/376 (69%), Gaps = 32/376 (8%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG-----SVKDSSVAAST 71
           +GPWKLG+TLG GS+G+V+LA +    Q AAIK++ K    +KG     S  D+S   +T
Sbjct: 85  VGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKC-LKGGTDNCSSNDNSTTLTT 143

Query: 72  PDSL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120
             S+           PYGIEREI+IMKL++H NV+ L++VWE  ++L++VLEY   GELF
Sbjct: 144 NYSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDLFLVLEYVDGGELF 203

Query: 121 NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFN-IKIADFGMA 179
           + LV +G LPE EA+ +F+QI+ G+++CH+  I HRDLKPENLLLD K   IKIADFGMA
Sbjct: 204 DYLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGMA 263

Query: 180 ALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNI 239
           ALE  +KLLETSCGSPHYA+PEIV G PYHG  SDVWSCG+ILFALLTG LPF+D+  NI
Sbjct: 264 ALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDD--NI 321

Query: 240 RNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDS 299
           R LLL+VQSGR+ +P +  IS +AQDLIA+IL V+P QRIK  DILKHPL+ KY      
Sbjct: 322 RKLLLKVQSGRFRLPRN--ISLEAQDLIAKILVVNPRQRIKISDILKHPLITKYRQFFKV 379

Query: 300 K-------SIRNLPREDTYLHP--LSEGESAEIDENILQNLVVLWHGREQLEIINKLREP 350
           K       S  NL  E   L P  L     A+IDE+IL+NL +LWHG  +  II KL + 
Sbjct: 380 KFNQVPNPSATNLNSEH-MLTPNNLKLASRADIDESILRNLQILWHGTSREIIIAKLLQY 438

Query: 351 GANAEKTLYALLDRFK 366
             +AEK  Y+LL ++K
Sbjct: 439 PMSAEKIFYSLLWQYK 454

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  389 bits (1000), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/387 (51%), Positives = 268/387 (69%), Gaps = 41/387 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNV----KGSVKDSSVAA--- 69
           +GPWKLG+TLG GS+G+V+LA +  T Q AAIK++ K    V     G+V +S  ++   
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSMVT 137

Query: 70  ---STPDSL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQ 115
              S+P  +           PYGIEREI+IMKL++H NV+ L++VWE  S LY+VLEY  
Sbjct: 138 SNVSSPSIVSKEHSNHSQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEYVD 197

Query: 116 KGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKF-NIKIA 174
            GELF+ LV RG LPE+EAI +F+QIV G+SYCH+  I HRDLKPENLLLD K   IKIA
Sbjct: 198 GGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNKKIKIA 257

Query: 175 DFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDD 234
           DFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++LFALLTG LPF+D
Sbjct: 258 DFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFND 317

Query: 235 EDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYP 294
           +  NI+ LLL+VQSG+Y+MP +  +S +A++LI++IL +DPE+RI  ++IL+HPL++KY 
Sbjct: 318 D--NIKKLLLKVQSGKYQMPMN--LSLEARNLISKILVIDPEKRITTQEILEHPLIKKYD 373

Query: 295 SINDSKSIRNLP-------REDTYLHPLSEGESA--------EIDENILQNLVVLWHGRE 339
           ++  +K +R +        + ++ LH L     +        EIDE+IL++L +LWHG  
Sbjct: 374 NLPVNKMLRKMKGDSMTRGKSNSDLHLLDNVSPSIVTLNTKNEIDESILRSLQILWHGVS 433

Query: 340 QLEIINKLREPGANAEKTLYALLDRFK 366
           +  I  KL +   + EK  Y+LL R+K
Sbjct: 434 RELITAKLLQKPMSEEKLFYSLLLRYK 460

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  388 bits (996), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/387 (50%), Positives = 267/387 (68%), Gaps = 41/387 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNV----KGSVKDSSVAA--- 69
           +GPWKLG+TLG GS+G+V+LA +  T Q AAIK++ K    V     G+V +S  ++   
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSMIT 137

Query: 70  ---STPD-----------SLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQ 115
              S+P            + PYGIEREI+IMKL++H NV+ L++VWE  S LY+VLEY  
Sbjct: 138 SNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEYVD 197

Query: 116 KGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHK-FNIKIA 174
            GELF+ LV +G LPE+EAI +F+QIV G+S+CH+  I HRDLKPENLLLD K   IKIA
Sbjct: 198 GGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDLKPENLLLDKKNRKIKIA 257

Query: 175 DFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDD 234
           DFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++LFALLTG LPF+D
Sbjct: 258 DFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFND 317

Query: 235 EDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYP 294
           +  NI+ LLL+VQSG+Y+MP +  +S +A+DLI++IL ++PE+RI  ++IL HPL++KY 
Sbjct: 318 D--NIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVINPEKRITTQEILNHPLIKKYD 373

Query: 295 SINDSKSIRNLPREDTY-------LHPLSE--------GESAEIDENILQNLVVLWHGRE 339
           ++  +K IR + R++         LH L+             EIDE+IL++L +LWHG  
Sbjct: 374 NLPINKMIRKMKRDNMARGKSNSDLHLLNNVSPSVVTLHSRGEIDESILRSLQILWHGVS 433

Query: 340 QLEIINKLREPGANAEKTLYALLDRFK 366
           +  I  KL +   + EK  Y+LL ++K
Sbjct: 434 RELITAKLLQKPMSEEKLFYSLLLQYK 460

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  387 bits (994), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/387 (50%), Positives = 267/387 (68%), Gaps = 41/387 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNV----KGSVKDSSVAA--- 69
           +GPWKLG+TLG GS+G+V+LA +  T Q AAIK++ K    V     G++ +S  ++   
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSTNGTMPNSYSSSMVT 137

Query: 70  ---STPDSL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQ 115
              S+P  +           PYGIEREI+IMKL++H NV+ L++VWE  S LY+VLEY  
Sbjct: 138 SNVSSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEYVD 197

Query: 116 KGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHK-FNIKIA 174
            GELF+ LV +G LPE+EAI +F+QIV G+SYCH+  I HRDLKPENLLLD K   IKIA
Sbjct: 198 GGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIA 257

Query: 175 DFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDD 234
           DFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++LFALLTG LPF+D
Sbjct: 258 DFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFND 317

Query: 235 EDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYP 294
           +  NI+ LLL+VQSG+Y+MP +  +S +A+DLI++IL +DP +RI  ++ILKHPL++KY 
Sbjct: 318 D--NIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVIDPAKRITTQEILKHPLIKKYD 373

Query: 295 SINDSKSIRNLPREDTY-------LHPLSEGES--------AEIDENILQNLVVLWHGRE 339
            +  +K +R + R++         LH L+            ++IDE+IL++L +LWHG  
Sbjct: 374 DLPVNKILRKMKRDNMARGKSNSDLHLLNNVSPSIVTLYSRSDIDESILRSLQILWHGVS 433

Query: 340 QLEIINKLREPGANAEKTLYALLDRFK 366
           +  I  KL +   + EK  Y+LL ++K
Sbjct: 434 RELITAKLLQKPMSEEKLFYSLLLQYK 460

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  383 bits (984), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/379 (51%), Positives = 256/379 (67%), Gaps = 33/379 (8%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISK-------------AIFNVKGSVK 63
           +GPWKLG+TLG GS+G+V+LA +  T Q AAIK++ K             + F+   +  
Sbjct: 98  VGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASNSN 157

Query: 64  D--SSVAASTP--------DSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEY 113
              S++A S P           PYGIEREI+IMKL++HPNV+ LY+VWE  S LY+VLEY
Sbjct: 158 SNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEVWENKSELYLVLEY 217

Query: 114 AQKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKF-NIK 172
              GELF+ LV +G L EKEA+ +F+QI+ G+SYCH+  I HRDLKPENLLLD K  +IK
Sbjct: 218 VDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKSIK 277

Query: 173 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPF 232
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF
Sbjct: 278 IADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPF 337

Query: 233 DDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
           +D+  NI+ LLL+VQ+G++ MP    +SP+AQDLI+RIL +DP +RI    IL HPL+ K
Sbjct: 338 NDD--NIKKLLLKVQAGKFRMPS--TLSPEAQDLISRILVIDPSKRITTDRILNHPLILK 393

Query: 293 Y----PSINDSKSIRNLP-REDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKL 347
           Y     ++   KS  +L   E     P+S     +ID +IL+NL +LWHG  +  II KL
Sbjct: 394 YEPAGKNMVSGKSNSDLHVLEHISPQPISLTSRNDIDASILKNLQILWHGTSRELIIAKL 453

Query: 348 REPGANAEKTLYALLDRFK 366
            +   + EK  Y+LL ++K
Sbjct: 454 LQTPMSEEKLFYSLLWQYK 472

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  379 bits (972), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/385 (50%), Positives = 256/385 (66%), Gaps = 41/385 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFN---------VKGSV----- 62
           +GPWKLG+TLG GS+G+V+LA +      AAIK++ K  +N           G V     
Sbjct: 90  VGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTD 149

Query: 63  -KDSS-----VAASTPDSL-PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQ 115
            KDSS     +   T  +L PYGIEREI+IMKL++HPNV+ L +VWE  S LY+VLEY  
Sbjct: 150 SKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEYVD 209

Query: 116 KGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFN-IKIA 174
            GELF+ LV +G L E EA+ +F QI+ G+SYCH+  I HRDLKPENLLLD K   IKIA
Sbjct: 210 GGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIA 269

Query: 175 DFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDD 234
           DFGMAALE  +KLLETSCGSPHYA+PEIV G PYHG  SDVWSCG+ILFALLTG LPF+D
Sbjct: 270 DFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFND 329

Query: 235 EDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYP 294
           +  NI+ LLL+VQ+GR+++P    ++ DA+DLI RIL  +PE+R+   +IL HPL++KY 
Sbjct: 330 D--NIKKLLLKVQAGRFQLPP--YLTNDAKDLITRILVTNPEKRLTINEILNHPLIKKYR 385

Query: 295 SINDSKSIRNL-----PREDTYLHPLSEGESA--------EIDENILQNLVVLWHGREQL 341
             N    IR L      + ++ LH L     A        +ID++IL++L +LWHG  + 
Sbjct: 386 --NPPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQSILKSLQILWHGTPRQ 443

Query: 342 EIINKLREPGANAEKTLYALLDRFK 366
            ++ +L   GA  EK  Y+LL ++K
Sbjct: 444 RLVERLLVEGATEEKLFYSLLFQYK 468

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  374 bits (961), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/466 (44%), Positives = 282/466 (60%), Gaps = 66/466 (14%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISK----------------------- 53
           +GPWKLG+TLG GS+G+V+LA +  T + AAIK++ K                       
Sbjct: 91  VGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRSKNTNSNNGDLFLS 150

Query: 54  --AIFNVKGSVK----DSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNL 107
             +I N   +      D++   ++    PYGIEREI+IMKLL+HPNV+ LY+VWE N+ L
Sbjct: 151 YSSIHNTTNTHNARNTDNTAIENSGGGNPYGIEREIVIMKLLSHPNVMALYEVWENNNEL 210

Query: 108 YMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDH 167
           Y+VLEY   GELF+ LV +G L E EA+ +F+QI+ GISYCH+  I HRDLKPENLLLD 
Sbjct: 211 YLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNICHRDLKPENLLLDK 270

Query: 168 KFN-IKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALL 226
           K   IKIADFGMAAL+  ++LL+TSCGSPHYA+PEIV G  Y+G  SD+WSCG+ILFALL
Sbjct: 271 KRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPSDIWSCGIILFALL 330

Query: 227 TGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           TG LPF+D+  NI+ LL++VQ+GRY+MP    IS +A++LI+RIL VDP +RI    IL 
Sbjct: 331 TGHLPFNDD--NIKKLLIKVQNGRYQMPS--YISQEAKNLISRILVVDPSKRISTEQILS 386

Query: 287 HPLLQKY---------------------PSINDSKSIRNLPREDTYLHPLSEGESAEIDE 325
           HPLL KY                      S +D   + N+P ++T +  L     ++IDE
Sbjct: 387 HPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIP-QNTEIVKLR--ARSDIDE 443

Query: 326 NILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFKSDTENDSVKHPQSKKRVSQ 385
           +IL+NL +LWHG  +  II KL +   + EK +Y+LL ++K      S K P        
Sbjct: 444 SILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYK-QINFKSSKAPSISSASVN 502

Query: 386 INPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSHKRPVSFNKL 431
           I+   Q T     ++  +N++         IS+   +  P+ FNK+
Sbjct: 503 ISVSAQDTETSTNTRTNSNSATD-------ISIPFVNTEPLQFNKI 541

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  374 bits (959), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/397 (48%), Positives = 253/397 (63%), Gaps = 52/397 (13%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISK----------------------- 53
           +GPWKLG+TLG GS+G+V+LA +  T Q AAIK++ K                       
Sbjct: 98  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFSAT 157

Query: 54  -------AIFNVKGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSN 106
                        G    ++  +  P + PYGIEREI+IMKL++H N+L LY+VWE  S 
Sbjct: 158 MNTTTNTNRATTNGGTNANAGPSEVPAN-PYGIEREIVIMKLISHSNILGLYEVWENKSE 216

Query: 107 LYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLD 166
           LY+VLEY   GELF+ LV RG L E+EA+ +F+QIV G+SYCH+  I HRDLKPENLLLD
Sbjct: 217 LYLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKPENLLLD 276

Query: 167 HKF-NIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFAL 225
            K  +IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG+ILFAL
Sbjct: 277 KKNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIILFAL 336

Query: 226 LTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDIL 285
           LTG LPF+D+  NI+ LLL+VQSG++ MP +  +S +A+DL+++IL V+P +RI   +IL
Sbjct: 337 LTGHLPFNDD--NIKKLLLKVQSGKFHMPQN--LSAEAKDLMSKILVVNPFKRIATEEIL 392

Query: 286 KHPLLQKYPSINDSKSIR--------NLPREDTYLHPLSEGES--------AEIDENILQ 329
            HPLL KY  +      R        +  + ++ LH L    S         +ID++I+ 
Sbjct: 393 NHPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSNIVDLRSREDIDDSIVS 452

Query: 330 NLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFK 366
           NL +LWHG  +  I+ KL +P  + EK  Y+LL  +K
Sbjct: 453 NLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  337 bits (865), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 184/429 (42%), Positives = 254/429 (59%), Gaps = 86/429 (20%)

Query: 17  IGPWKLGETLGLGSTGKV---------QLA--------------------------YDE- 40
           IGPWKLG+TLG GS+G+V         QLA                          YD  
Sbjct: 93  IGPWKLGKTLGKGSSGRVRLAKNKETGQLAAIKIVPKSKSTKFNNAKKNGNGKDNTYDNK 152

Query: 41  ------STNQQAAIKVISKAIFNVKGSVKDSSVAASTPD----------SLPYGIEREII 84
                 S + ++   V+    F +  S+  + + +   D          S  YGIEREI+
Sbjct: 153 PHLSYSSLHNRSNHSVLHNPSFLMDNSIIKNELGSDLDDDGNDSRNKDNSNRYGIEREIV 212

Query: 85  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIG 144
           IMKL++HPNV+ LY+VWE  + LY+VLEY   GELF+ LV +G L E EA+R+F+QI+ G
Sbjct: 213 IMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLTELEAVRYFKQIIRG 272

Query: 145 ISYCHALGIVHRDLKPENLLLDHKFN-IKIADFGMAALETEDKLLETSCGSPHYAAPEIV 203
           + YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+  + LL+TSCGSPHYA+PEIV
Sbjct: 273 VQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQVSNTLLKTSCGSPHYASPEIV 332

Query: 204 SGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDA 263
            G  Y+G  SDVWSCG+ILFALLTG LPF+D+  +I+ LL++VQ+GRY+MP  + +S DA
Sbjct: 333 MGKTYNGGPSDVWSCGIILFALLTGHLPFNDD--SIKKLLIKVQNGRYQMP--NYLSKDA 388

Query: 264 QDLIARILTVDPEQRIKARDILKHPLLQKY--------------------------PSIN 297
           +DLI+RIL V+P+ R+    IL+HPL+ KY                           S  
Sbjct: 389 KDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNNLMRGKSNT 448

Query: 298 DSKSIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKT 357
           D   ++N+P +   +   S     +ID++IL+NL +LW+G  +  +I+KL +   + EK 
Sbjct: 449 DLAILQNIPDKTDIIQLRSRN---DIDDSILRNLQILWNGVPRETLISKLIQDPVSEEKL 505

Query: 358 LYALLDRFK 366
           +Y+LL ++K
Sbjct: 506 IYSLLWQYK 514

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  330 bits (847), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 164/298 (55%), Positives = 213/298 (71%), Gaps = 12/298 (4%)

Query: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIR 136
           YGIEREI+IMKL++HPNV+ LY+VWE  S LY++LEY   GELF+ LV RG LPE EAI 
Sbjct: 197 YGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIH 256

Query: 137 FFRQIVIGISYCHALGIVHRDLKPENLL-LDHKFNIKIADFGMAALETEDKLLETSCGSP 195
           +F+QI+ G+SYCH+  I HRDLKPENLL    K +IKIADFGMAALE   KLL+TSCGSP
Sbjct: 257 YFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSP 316

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
           HYA+PEIV G  YHG  SDVWSCG+ILFALLTG LPF+D+  NI+ LLL+VQ+G+Y+MP 
Sbjct: 317 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFNDD--NIKKLLLKVQAGKYQMPK 374

Query: 256 DDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKS-IRNLPREDTYL-- 312
           +  +S +A+DLI+RIL V P +R+   +IL HPL+ KY   +  K  ++     D +L  
Sbjct: 375 N--LSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLD 432

Query: 313 ----HPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFK 366
                 ++     +IDE+IL+NL +LWHG  +  II KL +   + EK  Y+LL ++K
Sbjct: 433 SISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYK 490

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISK 53
           +GPWKLG+TLG GS+G+V+LA +  T Q AAIK++ K
Sbjct: 90  VGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIVPK 126

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  245 bits (626), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 111/120 (92%), Positives = 117/120 (97%)

Query: 86  MKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIGI 145
           MKLL+H NVLRLYDVWETNSNLYMVLEY +KGELFNLLVERGPLPE EA+RFFRQI+IGI
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 146 SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSG 205
           SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE++DKLLETSCGSPHYAAPEIVSG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  254 bits (650), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 156/415 (37%), Positives = 246/415 (59%), Gaps = 36/415 (8%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPD 73
           G++IG +++ +TLG GS GKV+LAY  +TNQ+ A+K+I+K I   K  ++          
Sbjct: 36  GSRIGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKIL-AKSDMQGR-------- 86

Query: 74  SLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKE 133
                IEREI  ++LL HP++++LYDV ++  ++ MV+EYA   ELF+ +V+R  + E E
Sbjct: 87  -----IEREISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENE 140

Query: 134 AIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 193
           A +FF+QI+  + YCH   IVHRDLKPENLLLD + N+KIADFG++ + T+   L+TSCG
Sbjct: 141 ARKFFQQIISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCG 200

Query: 194 SPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM 253
           SP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFDD+  +I  L   + +G Y +
Sbjct: 201 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDD--SIPVLFKNISNGIYTL 258

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQ-KYPSINDSKSIRNLPREDTYL 312
           P    +SP A +LI R+L V+P  RI   +I++    +  +P   + + ++    +D   
Sbjct: 259 P--KFLSPGAANLIKRMLIVNPLNRISMNEIMEDEWFRVDFPEYLEPQDMKLKSSKDN-- 314

Query: 313 HPLSEGESAEIDENILQNLVVLWHGREQLEIINKLR----EPGANAEKTLYALLDRFKSD 368
           +  ++G S EI+E+++ +++    G E+ EI   L+     P +N  +  Y L+   K  
Sbjct: 315 NNSNDGSSEEINEDLV-DILSRTMGYEKHEIYECLQSTEDNPVSNEIRDAYMLIKESKY- 372

Query: 369 TENDSVKHPQSKKRVSQINPVRQPTTKKAPS--------KPQTNASPKRRNRTSM 415
             ND     ++K  +  +     P+  + P+        +P  +AS ++R RT M
Sbjct: 373 LMNDINSKVKTKDDLDTLLTQSLPSLNRKPNLHTYGHHQRPIISASTQQRTRTFM 427

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  254 bits (650), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 128/285 (44%), Positives = 185/285 (64%), Gaps = 19/285 (6%)

Query: 2   AAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGS 61
           + +SN+      G+++G +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K +      
Sbjct: 21  SYVSNKVSSLADGSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVL----- 75

Query: 62  VKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFN 121
                        +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+
Sbjct: 76  ---------AKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFD 125

Query: 122 LLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 181
            +V+R  + E+EA RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ +
Sbjct: 126 YIVQRNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNI 185

Query: 182 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRN 241
            T+   L+TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFDDE  +I  
Sbjct: 186 MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPV 243

Query: 242 LLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           L   + +G Y +P    +SP A DLI R+L V+P  RI   +I++
Sbjct: 244 LFKNISNGVYTLP--KFLSPGASDLIKRMLIVNPLNRISIHEIMQ 286

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  251 bits (641), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 150/383 (39%), Positives = 224/383 (58%), Gaps = 45/383 (11%)

Query: 2   AAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGS 61
           +A++N       G  IG +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K +   K  
Sbjct: 37  SALNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVL-AKSD 95

Query: 62  VKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFN 121
           ++               IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+
Sbjct: 96  MQGR-------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFD 141

Query: 122 LLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 181
            +V+R  + E+EA RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ +
Sbjct: 142 YIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNI 201

Query: 182 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRN 241
            T+   L+TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFDDE  +I  
Sbjct: 202 MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPV 259

Query: 242 LLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH-------------P 288
           L   + +G Y +P    +SP A  LI R+L V+P  RI   +I++              P
Sbjct: 260 LFKNISNGVYTLP--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPEYLLPP 317

Query: 289 LLQKYPSINDSKSIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLR 348
            L+ +P   + ++  N+ ++D      S  ++ EID++++ N++    G E+ EI   L 
Sbjct: 318 DLKPHP---EEENENNVSKKDG-----SGPDNDEIDDDLV-NILSSTMGYEKAEIYESLE 368

Query: 349 E----PGANAEKTLYALLDRFKS 367
                P  N  +  Y L+   KS
Sbjct: 369 SSEDTPAFNEIRDAYMLIKENKS 391

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  251 bits (640), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 152/378 (40%), Positives = 216/378 (57%), Gaps = 59/378 (15%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIF---NVKGSVKDSSVAAS 70
           G  IG +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K +    +++G          
Sbjct: 49  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR--------- 99

Query: 71  TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLP 130
                   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + 
Sbjct: 100 --------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMS 150

Query: 131 EKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLET 190
           E+EA RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+T
Sbjct: 151 EQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKT 210

Query: 191 SCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGR 250
           SCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFDDE  +I  L   + +G 
Sbjct: 211 SCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGV 268

Query: 251 YEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH-------------PLLQKYP--- 294
           Y +P    +SP A  LI R+L V+P  RI   +I++              P L+ +P   
Sbjct: 269 YTLP--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPEYLLPPDLKPHPEEE 326

Query: 295 -SINDSKSIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLRE---- 349
              NDSK   + P  D            EID+N++ N++    G E+ EI   L      
Sbjct: 327 NENNDSKKDGSSPDND------------EIDDNLV-NILSSTMGYEKDEIYESLESSEDT 373

Query: 350 PGANAEKTLYALLDRFKS 367
           P  N  +  Y L+   KS
Sbjct: 374 PAFNEIRDAYMLIKENKS 391

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  250 bits (638), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/288 (44%), Positives = 185/288 (64%), Gaps = 25/288 (8%)

Query: 2   AAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIF---NV 58
           +A++N       G  IG +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K +    ++
Sbjct: 38  SALNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDM 97

Query: 59  KGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGE 118
           +G                  IEREI  ++LL HP++++LYDV ++   + MV+EYA   E
Sbjct: 98  QGR-----------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNE 139

Query: 119 LFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM 178
           LF+ +V+R  + E+EA RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG+
Sbjct: 140 LFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 199

Query: 179 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN 238
           + + T+   L+TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFDDE  +
Sbjct: 200 SNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--S 257

Query: 239 IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           I  L   + +G Y +P    +SP A  LI R+L V+P  RI   +I++
Sbjct: 258 IPVLFKNISNGVYTLP--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 303

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  250 bits (638), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/288 (44%), Positives = 184/288 (63%), Gaps = 25/288 (8%)

Query: 2   AAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIF---NV 58
           +A++N       G  IG +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K +    ++
Sbjct: 36  SALNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDM 95

Query: 59  KGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGE 118
           +G                  IEREI  ++LL HP++++LYDV ++   + MV+EYA   E
Sbjct: 96  QGR-----------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNE 137

Query: 119 LFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM 178
           LF+ +V+R  + E EA RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG+
Sbjct: 138 LFDYIVQRDKMSEDEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL 197

Query: 179 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN 238
           + + T+   L+TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFDDE  +
Sbjct: 198 SNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--S 255

Query: 239 IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           I  L   + +G Y +P    +SP A  LI R+L V+P  RI   +I++
Sbjct: 256 IPVLFKNISNGVYSLP--KFLSPGAASLIKRMLIVNPLNRISIHEIMQ 301

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  247 bits (631), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 178/273 (65%), Gaps = 19/273 (6%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPD 73
           G++IG +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K +                  
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVL--------------AKS 81

Query: 74  SLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKE 133
            +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + EKE
Sbjct: 82  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKE 140

Query: 134 AIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 193
           A RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 141 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 200

Query: 194 SPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM 253
           SP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFDDE  +I  L   + +G Y +
Sbjct: 201 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTL 258

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           P    +SP A  LI R+L V+P  RI   +I++
Sbjct: 259 P--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 289

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  247 bits (631), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 166/436 (38%), Positives = 246/436 (56%), Gaps = 51/436 (11%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPD 73
           G+KIG +++ +TLG GS GKV+LA+  +T Q+ A+K+I+K +               +  
Sbjct: 24  GSKIGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVL--------------SKS 69

Query: 74  SLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKE 133
            +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + E E
Sbjct: 70  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENE 128

Query: 134 AIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 193
             RFF+QI+  + YCH   IVHRDLKPENLLLD  +N+KI DFG++ + T+   L+TSCG
Sbjct: 129 GRRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCG 188

Query: 194 SPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM 253
           SP+YAAPE++SG  Y G   DVWSCGVIL+ LL  RLPFDDE  +I  L   + +G Y +
Sbjct: 189 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTI 246

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPL----LQKY--PSINDSKSIRNLPR 307
           P  + +S  A  LI ++L V+P  RI   DI++ P     L +Y  PS  D+  I     
Sbjct: 247 P--NFLSEGAASLIKKMLIVNPMNRITIGDIIQDPWFKVDLPEYLVPSEKDAIKINGTNN 304

Query: 308 EDTYLHPLSEGESAEIDENILQNLV-VLWHGREQLEIINKLR------EPGANAEKTLYA 360
               L  L+   +A+IDE  +  L   + + +E  EI   L+       P  +  K  Y 
Sbjct: 305 NAENLQNLT---AADIDEEAIDILTKTMNYSKE--EIYESLQSGDVDTNPSHHEIKEAYL 359

Query: 361 LL----DRFKSDTENDSVKHPQSKKRVSQINPVRQP------TTKKAPSKPQTNASPKRR 410
           L+    +   +  + D++K  Q    +SQ  P  Q       TT  + SKP T++   RR
Sbjct: 360 LIKENQNLINTLKKGDNIK--QLDTFLSQSPPSFQKYNEQNGTTGMSISKP-THSGKDRR 416

Query: 411 NRTSMISVSSSHKRPV 426
           N  ++  +S + +RPV
Sbjct: 417 NLNNIPGISDA-QRPV 431

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  247 bits (631), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 180/273 (65%), Gaps = 19/273 (6%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPD 73
           G+KIG +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K I   K  ++          
Sbjct: 43  GSKIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKIL-AKSDMQGR-------- 93

Query: 74  SLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKE 133
                IEREI  ++LL HP++++LYDV ++   + +V+E+A   ELF+ +++R  + E E
Sbjct: 94  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFAS-NELFDYIIQRDKMSENE 147

Query: 134 AIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 193
           A RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 148 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCG 207

Query: 194 SPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM 253
           SP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFDDE  +I  L   + +G Y +
Sbjct: 208 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYIL 265

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           P    +SP A  LI R+L V+P  RI   +I++
Sbjct: 266 P--KFLSPGASSLIKRMLIVNPLNRISIHEIMQ 296

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  245 bits (625), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 166/442 (37%), Positives = 242/442 (54%), Gaps = 73/442 (16%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIF---NVKGSVKDSSVAAS 70
           G +IG +++ +TLG GS GKV+LAY  ST+Q+ A+K+I+K +    +++G          
Sbjct: 37  GQRIGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKVLAKSDMQGR--------- 87

Query: 71  TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLP 130
                   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + 
Sbjct: 88  --------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMS 138

Query: 131 EKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLET 190
           E EA RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+T
Sbjct: 139 ENEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKT 198

Query: 191 SCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGR 250
           SCGSP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFDDE  +I  L   + +G 
Sbjct: 199 SCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGV 256

Query: 251 YEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDT 310
           Y +P    +SP A +LI ++L V+P  RI   +I++           D     +LP    
Sbjct: 257 YSIP--KFLSPGAANLIKKMLIVNPLNRITIHEIME-----------DQWFKVDLP---D 300

Query: 311 YLHPLS---------EGESAEIDENILQNLV-VLWHGR----EQLEIINKLREPGANAEK 356
           YL P+          +GE  EIDE+++  L   + + R    E LE  N   +P     +
Sbjct: 301 YLIPVDLKTDGSGKRDGEDEEIDESLVAILAKTMSYDRDEIYEALENAND-SDPSIAEIR 359

Query: 357 TLYALLDRFKS---DTENDSVKHPQSKKRVSQ-------------INPVRQPTTKKAPSK 400
             Y L+   KS   D +++  K  Q    +SQ             IN  + PT+   P  
Sbjct: 360 DAYMLIKENKSLIDDLKSNKQKSDQLGTFLSQSPPTFEPQGSQLGINTSQTPTSGIGPRG 419

Query: 401 PQTNASPKR---RNRTSMISVS 419
            QTN   K+   + RT  ++ S
Sbjct: 420 MQTNQHIKKIAAQQRTYQLAYS 441

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  244 bits (622), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 180/274 (65%), Gaps = 19/274 (6%)

Query: 13  KGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTP 72
           +G  IG +++ +TLG GS GKV+LAY  ST Q+ A+K+I+K +   K  ++         
Sbjct: 28  QGQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVL-AKSDMQGR------- 79

Query: 73  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEK 132
                 IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  +PE+
Sbjct: 80  ------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQ 132

Query: 133 EAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSC 192
           EA RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSC
Sbjct: 133 EARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSC 192

Query: 193 GSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYE 252
           GSP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFDDE  +I  L   + +G Y 
Sbjct: 193 GSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYT 250

Query: 253 MPGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           +P  + +S  A  LI ++L V+P  RI   +I++
Sbjct: 251 IP--NFLSQGAASLIKKMLIVNPVNRITVHEIMQ 282

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  243 bits (620), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 137/323 (42%), Positives = 201/323 (62%), Gaps = 30/323 (9%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIF---NVKGSVKDSSVAASTP 72
           +IG +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K +    +++G            
Sbjct: 26  RIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR----------- 74

Query: 73  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEK 132
                 IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + E+
Sbjct: 75  ------IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSER 127

Query: 133 EAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSC 192
           EA RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSC
Sbjct: 128 EARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSC 187

Query: 193 GSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYE 252
           GSP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFDDE  +I  L   + +G Y 
Sbjct: 188 GSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPILFKNISNGIYT 245

Query: 253 MPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPL----LQKYPSINDSKSIRNLPRE 308
           +P    +SP A +LI R+L V+P  RI   +I++       +Q Y    D KS  +  R+
Sbjct: 246 LP--KFLSPGAANLIKRMLIVNPLNRITIHEIMEDEWFKVDIQPYLIPPDLKSETDEHRQ 303

Query: 309 DTYLHPLSEGESAEIDENILQNL 331
           +   HP    E  E+D++++  L
Sbjct: 304 EGE-HPDGGEEGEEVDDSLVTML 325

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  243 bits (621), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 179/273 (65%), Gaps = 19/273 (6%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPD 73
           G+ IG +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K +   K  ++          
Sbjct: 40  GSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVL-AKSDMQGR-------- 90

Query: 74  SLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKE 133
                IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + E E
Sbjct: 91  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDE 144

Query: 134 AIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 193
           A RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 145 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 204

Query: 194 SPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM 253
           SP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFDDE  +I  L   + +G Y +
Sbjct: 205 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTI 262

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           P    +S  A  LI ++L V+P  RI  ++I++
Sbjct: 263 P--KFLSQGASTLIKKMLIVNPLNRISIQEIMQ 293

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  244 bits (622), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 182/278 (65%), Gaps = 19/278 (6%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPD 73
           G++IG +++ +TLG GS GKV+LAY  +TNQ+ A+K+I+K +   K  ++          
Sbjct: 39  GSRIGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVL-AKSDMQGR-------- 89

Query: 74  SLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKE 133
                IEREI  ++LL HP++++LYDV ++   + +V+E+A   ELF+ +++R  + E+E
Sbjct: 90  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFAS-NELFDYIIQRDKMSEQE 143

Query: 134 AIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 193
           A RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 144 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCG 203

Query: 194 SPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM 253
           SP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFDDE  +I  L   + +G Y +
Sbjct: 204 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYIL 261

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
           P    +S  A +LI ++L V+P  RI   +I K    Q
Sbjct: 262 P--KFLSLGAANLIKKMLIVNPLNRISISEIFKDEWFQ 297

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  244 bits (622), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 180/273 (65%), Gaps = 19/273 (6%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPD 73
           G+KIG +++ +TLG GS GKV+LAY  +T Q+ A+K+I++ +   K  ++          
Sbjct: 38  GSKIGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVL-AKSDMQGR-------- 88

Query: 74  SLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKE 133
                IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + E+E
Sbjct: 89  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAD-NELFDYIVQRDKMSEQE 142

Query: 134 AIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 193
           A RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 143 ARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 202

Query: 194 SPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM 253
           SP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFDDE  +I  L   + +G Y +
Sbjct: 203 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGIYTL 260

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           P    +S  A  LI ++L V+P  RI   +I++
Sbjct: 261 P--RFLSEGASSLIKKMLIVNPLNRISIHEIMQ 291

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  243 bits (620), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 124/275 (45%), Positives = 179/275 (65%), Gaps = 25/275 (9%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIF---NVKGSVKDSSVAAS 70
           G +IG +++ +TLG GS GKV+LAY  +TNQ+ A+K+I+K +    +++G V        
Sbjct: 62  GARIGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVLAKSDMQGRV-------- 113

Query: 71  TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLP 130
                    EREI  ++LL HP++++LYDV ++   + MV+EYA   ELF  +V+R  + 
Sbjct: 114 ---------EREISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYAN-NELFEYIVQRDKMT 163

Query: 131 EKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLET 190
           E EA +FF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+T
Sbjct: 164 ENEARKFFQQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKT 223

Query: 191 SCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGR 250
           SCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFDD+  +I  L   + +G 
Sbjct: 224 SCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDD--SIPALFKNISNGI 281

Query: 251 YEMPGDDEISPDAQDLIARILTVDPEQRIKARDIL 285
           Y +P    +S  A +LI ++L V+P  RI   +I+
Sbjct: 282 YTLP--KFLSEGAANLIKKMLIVNPLNRISMTEII 314

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  242 bits (617), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 120/273 (43%), Positives = 179/273 (65%), Gaps = 19/273 (6%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPD 73
           G++IG +++ +TLG GS GKV+LA+  +T Q+ A+K+I++ +               +  
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKVL--------------SKS 81

Query: 74  SLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKE 133
            +   IEREI  ++LL HP+++RLYDV ++   + M++EYA   ELF+ +V+R  + E E
Sbjct: 82  DMQGRIEREIAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKMSENE 140

Query: 134 AIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 193
           A +FF+QI+  + YCH   IVHRDLKPENLLLD  +N+KI DFG++ + T+   L+TSCG
Sbjct: 141 ARKFFQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLKTSCG 200

Query: 194 SPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM 253
           SP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFDDE  +I  L   + +G Y +
Sbjct: 201 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTL 258

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           P  + +S  A  LI ++L V+P  RI   +I++
Sbjct: 259 P--NFLSDGAASLIKKMLIVNPINRISISEIMQ 289

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  241 bits (614), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/274 (45%), Positives = 179/274 (65%), Gaps = 25/274 (9%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIF---NVKGSVKDSSVAASTP 72
           +IG +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K +    +++G            
Sbjct: 28  RIGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR----------- 76

Query: 73  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEK 132
                 IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + E 
Sbjct: 77  ------IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNED 129

Query: 133 EAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSC 192
           EA RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSC
Sbjct: 130 EARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSC 189

Query: 193 GSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYE 252
           GSP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFDDE  +I  L   + +G Y 
Sbjct: 190 GSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYT 247

Query: 253 MPGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           +P    +SP A +LI R+L V+P  RI   +I++
Sbjct: 248 LP--KFLSPGASNLIKRMLIVNPLNRITIHEIMQ 279

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  241 bits (614), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/274 (45%), Positives = 178/274 (64%), Gaps = 25/274 (9%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIF---NVKGSVKDSSVAASTP 72
           +IG +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K +    +++G            
Sbjct: 27  RIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR----------- 75

Query: 73  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEK 132
                 IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + E 
Sbjct: 76  ------IEREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSEN 128

Query: 133 EAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSC 192
           EA RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L TSC
Sbjct: 129 EARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSC 188

Query: 193 GSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYE 252
           GSP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFDDE  +I  L   + +G Y 
Sbjct: 189 GSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGIYT 246

Query: 253 MPGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           +P    +SP A +LI R+L V+P  RI   +I++
Sbjct: 247 LP--KFLSPGAANLIKRMLIVNPLNRITIHEIMQ 278

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  238 bits (608), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 127/282 (45%), Positives = 182/282 (64%), Gaps = 27/282 (9%)

Query: 8   SVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIF---NVKGSVKD 64
           S+P   G +IG +++ +TLG GS GKV+LA+  ST Q+ A+K+I+K +    +++G    
Sbjct: 29  SIPI--GQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGR--- 83

Query: 65  SSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
                         IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V
Sbjct: 84  --------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 128

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           +R  + E EA RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+
Sbjct: 129 QRDKMSENEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 188

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
              L+TSCGSP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFDDE  +I  L  
Sbjct: 189 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFK 246

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
            + +G Y +P    +S  A +LI R+L V+P  RI   +I++
Sbjct: 247 NISNGVYSIP--KFLSQGAANLIKRMLIVNPLNRITIHEIME 286

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  240 bits (612), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 177/276 (64%), Gaps = 25/276 (9%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIF---NVKGSVKDSSVAAS 70
           G  IG +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K +    +++G          
Sbjct: 55  GAHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR--------- 105

Query: 71  TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLP 130
                   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + 
Sbjct: 106 --------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMS 156

Query: 131 EKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLET 190
           E EA RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+T
Sbjct: 157 ENEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKT 216

Query: 191 SCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGR 250
           SCGSP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFDDE  +I  L   + +G 
Sbjct: 217 SCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNINNGV 274

Query: 251 YEMPGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           Y +P    +S  A  LI R+L V+P  RI   +I++
Sbjct: 275 YTIP--KFLSQGASSLIKRMLIVNPLNRISISEIMQ 308

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  237 bits (605), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 178/273 (65%), Gaps = 19/273 (6%)

Query: 14  GNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPD 73
           G+ IG +++ +TLG GS GKV+LAY  +T Q+ A+K+I+K +   K  ++          
Sbjct: 45  GSHIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVL-AKSDMQGR-------- 95

Query: 74  SLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKE 133
                IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + E+E
Sbjct: 96  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEEE 149

Query: 134 AIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCG 193
           A RFF+QI+  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCG
Sbjct: 150 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 209

Query: 194 SPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM 253
           SP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFDDE  +I  L   + +G Y +
Sbjct: 210 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTL 267

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           P    +S  A  LI R+L V+P  RI   +I++
Sbjct: 268 P--KFLSEGAAGLIKRMLIVNPLNRISILEIMQ 298

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  209 bits (532), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 119/296 (40%), Positives = 170/296 (57%), Gaps = 40/296 (13%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTN------QQAAIKVISKAIFNVKGSVKDSSVAAS 70
            GP+ +G TLG G  GKV+L + +++N      +Q AIK+I +                 
Sbjct: 37  FGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRR----------------- 79

Query: 71  TPDSLPYGIEREIII------MKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
             D++P   E+EI I      +K LNHPN++RL +V + +  + +VLEYA  GE +  + 
Sbjct: 80  --DTIPKNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQ 137

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALET 183
           ++  L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       
Sbjct: 138 KKRRLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLP 197

Query: 184 EDKLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE----DG- 237
           E++L++TSCGSP YAAPE +V+  PY    +DVWSCGVIL+A+L G LP+DD+    DG 
Sbjct: 198 ENELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGD 257

Query: 238 NIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
           +I  L   +     + P  D I+P  +DL+  IL  DP++RI     LKH  LQ +
Sbjct: 258 DIGKLYRYITRTPLKFP--DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  208 bits (529), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 117/287 (40%), Positives = 171/287 (59%), Gaps = 29/287 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQ-----QAAIKVISK-AIFNVKGSVKDSSVAAS 70
            GP+ +G TLG G  GKV+L + ++T++     Q AIK+I + AI N   S K++     
Sbjct: 37  FGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRRDAILNY--SEKETK---- 90

Query: 71  TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLP 130
                   I REI  +K L HPN+++L +V + +  + +VLE+A  GE +  + ++  L 
Sbjct: 91  --------IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRLK 142

Query: 131 EKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLE 189
           E  A R F Q+V G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L++
Sbjct: 143 ETPACRLFAQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELMK 202

Query: 190 TSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE----DG-NIRNLL 243
           TSCGSP YAAPE +V+  PY    +DVWSCG+IL+A+L G LP+DD+    DG +I  L 
Sbjct: 203 TSCGSPCYAAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLY 262

Query: 244 LQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
           L +     + P  + I+P  +DL+ +IL  DP +R+  R+I KH  L
Sbjct: 263 LYITKTALKFP--EYINPIQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  208 bits (529), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 120/296 (40%), Positives = 171/296 (57%), Gaps = 40/296 (13%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTN------QQAAIKVISKAIFNVKGSVKDSSVAAS 70
            GP+ +G TLG G  GKV+L + ++ +      +Q AIK+I +                 
Sbjct: 36  FGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRR----------------- 78

Query: 71  TPDSLP------YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
             DS+P        I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + 
Sbjct: 79  --DSIPKNSEKEVKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQ 136

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALET 183
            +  L E  A R F Q+V G++Y H+ G+VHRDLK ENLLLD   N+ I DFG      +
Sbjct: 137 RKRRLKEAIACRLFAQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFVS 196

Query: 184 EDKLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE----DGN 238
            ++L++TSCGSP YAAPE +VS  PY    SDVWSCGVIL+A+L G LP+DD+    DGN
Sbjct: 197 HNELMKTSCGSPCYAAPELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGN 256

Query: 239 -IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
            I  L   +     + P  + I+P ++DL+ RIL  DP++RI  R I KH  L+ +
Sbjct: 257 DIVRLYYYITRTPLKFP--EYITPLSRDLLRRILVSDPKKRITLRSIHKHEWLKPH 310

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  207 bits (526), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 120/323 (37%), Positives = 177/323 (54%), Gaps = 25/323 (7%)

Query: 7   RSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSS 66
           R     K    GP+ +G TLG G  GKV++ +      +    V  +    +   +K  S
Sbjct: 29  RKTGNAKCPSFGPYLIGSTLGQGGFGKVKMGWTTPMGNKGIYDVPKQVAIKL---IKRDS 85

Query: 67  VAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVER 126
           +  S   S    I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +R
Sbjct: 86  I--SNDKSKEVKIYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKR 143

Query: 127 GPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETED 185
             L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      +++
Sbjct: 144 RVLKEHVACRLFAQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEYFSQN 203

Query: 186 KLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN-----I 239
           +L+ TSCGSP YAAPE+V S  PY G  +D+WSCG+ILFA+L G LP+DD+  N     I
Sbjct: 204 ELMTTSCGSPCYAAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDGEDI 263

Query: 240 RNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPS---- 295
             L   +     + P  + I+P  +DL+ RIL  DP +R+  R+I  H  L+K+      
Sbjct: 264 AKLYYYITHTALKFP--EYITPIPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQFLSI 321

Query: 296 -------INDSKSIRNLPREDTY 311
                  I+ SK+I  LP+ + +
Sbjct: 322 QPEEWDRISQSKNITRLPKHNKH 344

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  207 bits (526), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 121/318 (38%), Positives = 178/318 (55%), Gaps = 38/318 (11%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDES----------TNQQAAIKVISKAIFNVKGSVKDSS 66
            GP+ +G T+G G  GKV+L + ++           ++Q AIK+I +   +     KDSS
Sbjct: 66  FGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRDAIS-----KDSS 120

Query: 67  VAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVER 126
                       I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  +  +
Sbjct: 121 KELK--------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEFYRYIQRK 172

Query: 127 GPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETED 185
             L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + +
Sbjct: 173 KRLKETAACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFYSHN 232

Query: 186 KLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN-----I 239
           +L++TSCGSP YAAPE+V S  PY    +D+WSCG+IL+A+L G LP+DD+ GN     I
Sbjct: 233 ELMKTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDDI 292

Query: 240 RNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDS 299
             L   +     + P  D I+P  +DL+ +IL  DP +RI  + I KH  L+ + +    
Sbjct: 293 SRLYYYITKTPLKFP--DYINPIPRDLLRKILVSDPRRRITMKQIEKHEWLKPHTAF--- 347

Query: 300 KSIRNLPRE-DTYLHPLS 316
             +   P E DT +HP S
Sbjct: 348 --LSITPEEWDTIMHPKS 363

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  206 bits (524), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 168/292 (57%), Gaps = 32/292 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTN------QQAAIKVISKAIF--NVKGSVKDSSVA 68
            GP+ +G TLG G  GKV++ + ++++      +Q AIK+I +     N +  VK     
Sbjct: 37  FGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRDTIPKNSEKEVK----- 91

Query: 69  ASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGP 128
                     I REI  +K LNHPN++RL +V + +  + +VLEYA  GE +  + ++  
Sbjct: 92  ----------IYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRR 141

Query: 129 LPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKL 187
           L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       E++L
Sbjct: 142 LKESAACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENEL 201

Query: 188 LETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE----DG-NIRN 241
           ++TSCGSP YAAPE +V+  PY    +D+WSCGVI++A+L G LP+DD+    DG +I  
Sbjct: 202 MKTSCGSPCYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGK 261

Query: 242 LLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
           L   +     + P  D I+P  +DL+  IL  DP++RI     L H  LQ +
Sbjct: 262 LYRYITRTPLKFP--DYIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  204 bits (518), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 118/304 (38%), Positives = 172/304 (56%), Gaps = 42/304 (13%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQA--------------------AIKVISKAIF 56
            GP+ +G TLG G  GKV+LA+ +S  QQ                     AIK+I K  F
Sbjct: 45  FGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLI-KRDF 103

Query: 57  NVKGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQK 116
             K   K++             I REI  +K L+HPN+++L +V + +  + +VLEYA  
Sbjct: 104 ITKDPSKETK------------IYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAG 151

Query: 117 GELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADF 176
           GE +  +  +  L E  A R F Q++  + Y H+ G+VHRDLK ENLLLD++ N+ I DF
Sbjct: 152 GEFYKFIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDF 211

Query: 177 GMA-ALETEDKLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDD 234
           G       ++ +++TSCGSP YAAPE +VS  PY    +D WSCG+ILFA+L G LP+DD
Sbjct: 212 GFVNEFLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDD 271

Query: 235 E----DGN-IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPL 289
           +    DG+ I  L   + +   + P  + I+P  +DL+ +IL +DP++RI  R I KHP 
Sbjct: 272 DPKNPDGHDISRLYNYILNTPLKFP--EYINPVPRDLLRKILVIDPKKRINIRSIEKHPW 329

Query: 290 LQKY 293
           L+ +
Sbjct: 330 LESH 333

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  204 bits (519), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 117/282 (41%), Positives = 166/282 (58%), Gaps = 25/282 (8%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTN-----QQAAIKVISKAIFNVKGSVKDSSVAAST 71
            GP+ LG TLG G  G+V+L + ++T+     +Q AIK+I +     K S K+       
Sbjct: 41  FGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRDTIP-KNSDKE------- 92

Query: 72  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPE 131
                  I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + ++  L E
Sbjct: 93  -----IKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKE 147

Query: 132 KEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLET 190
             A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG         +L++T
Sbjct: 148 AVACRLFAQLISGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFAHSELMKT 207

Query: 191 SCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE----DGNIRNLLLQ 245
           SCGSP YAAPE +VS  PY    +D+WSCGVIL+A+L G LP+DD+    DGN    L Q
Sbjct: 208 SCGSPCYAAPELVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKLYQ 267

Query: 246 VQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
             + R  +   + I+P  +DL+ RIL  DP++RI  R I KH
Sbjct: 268 YIT-RTPLKFPEYITPLPRDLLRRILYPDPKRRISMRSIQKH 308

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  204 bits (518), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 119/299 (39%), Positives = 170/299 (56%), Gaps = 36/299 (12%)

Query: 17  IGPWKLGETLGLGSTGKVQLAY-----DESTN-----QQAAIKVISKAIF--NVKGSVKD 64
            GP+ LG TLG G  GKV+L +     + ST+     +Q A+K+I +     + K  VK 
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTISNDYKKEVK- 96

Query: 65  SSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
                         I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + 
Sbjct: 97  --------------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQ 142

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALET 183
           ++  L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      +
Sbjct: 143 KKRRLKETNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCS 202

Query: 184 EDKLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN---- 238
            ++L++TSCGSP YAAPE +VS  PY    +D+WSCGVIL+A+L G LP+DD+  N    
Sbjct: 203 RNELMKTSCGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGS 262

Query: 239 -IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
            I  L   + S   + P  D I P  +DL+ RIL  DP++RI  + I KH  L+ + S 
Sbjct: 263 DIGRLYNYICSTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  202 bits (514), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 118/296 (39%), Positives = 167/296 (56%), Gaps = 30/296 (10%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYD--------ESTNQQAAIKVISKAIFNVKGSVKDSSV 67
           + G + LG TLG G  GKV+L +         +S ++Q AIK+I +  +  KGS K+   
Sbjct: 42  RFGNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRD-YVKKGSDKE--- 97

Query: 68  AASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERG 127
                      I REI  +KLL HPN++RL +V + +  + +VLE+A  GE +  L  + 
Sbjct: 98  ---------IKIYREINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKR 148

Query: 128 PLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDK 186
            L E  A + F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++
Sbjct: 149 RLKEPHACQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNE 208

Query: 187 LLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN-----IR 240
           L++ SCGSP YAAPE+V S  PY     D+WSCG+IL+A+L G LP+DD+  N     I 
Sbjct: 209 LMKRSCGSPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIG 268

Query: 241 NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
            L   +     + P    ISP A+DLI +ILT +P +RI    I KH  L+ + S 
Sbjct: 269 KLYQYITKTALKFPA--YISPLARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  203 bits (517), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 118/299 (39%), Positives = 168/299 (56%), Gaps = 36/299 (12%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTN----------QQAAIKVISKAIF--NVKGSVKD 64
            GP+ LG TLG G  GKV+L + ++ +          +Q A+K+I +     N K  VK 
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKRDTISNNYKKEVK- 96

Query: 65  SSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
                         I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + 
Sbjct: 97  --------------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQ 142

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALET 183
           ++  L E  A R F Q+V G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      +
Sbjct: 143 KKRRLKETNACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCS 202

Query: 184 EDKLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN---- 238
            ++L++TSCGSP YAAPE+V S  PY    +D+WSCGVIL+A+L G LP+DD+  N    
Sbjct: 203 RNELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGS 262

Query: 239 -IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
            I  L   + S   + P  D I P  +DL+ RIL  DP++R+  + I KH  L  + S 
Sbjct: 263 DIGRLYNYINSTPLKFP--DYILPIPRDLLRRILVPDPKKRMNLKQIKKHEWLNSHFSF 319

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  206 bits (523), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 123/301 (40%), Positives = 168/301 (55%), Gaps = 34/301 (11%)

Query: 9   VPTVKGN------KIGPWKLGETLGLGSTGKVQLAY------DESTNQQAAIKVISKAIF 56
           +P  KGN        GP+ +G TLG G  GKV+L +      D    +Q AIK+I +   
Sbjct: 55  IPENKGNGRRKHITFGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKLIRRDAI 114

Query: 57  NVKGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQK 116
            VKGS K+              I REI  +K L HPN++RL +V + +  + +VLEYA  
Sbjct: 115 -VKGSEKE------------IKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASG 161

Query: 117 GELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADF 176
           GE +  + ++  L E  A   F Q+V G+ Y H  G+VHRDLK ENLLLD   N+ I DF
Sbjct: 162 GEFYKYIQKKRRLKESVASNLFSQLVSGVYYMHCKGLVHRDLKLENLLLDKYGNLIITDF 221

Query: 177 GMA-ALETEDKLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDD 234
           G         +L++TSCGSP YAAPE ++S  PY    +D+WSCG+ILFA+L G LP+DD
Sbjct: 222 GFVNEFSKFSELMKTSCGSPCYAAPELVISTRPYEARKADIWSCGIILFAMLAGYLPWDD 281

Query: 235 E----DGN-IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPL 289
           +    DGN I  L   + +   + P  + ISP A+DL+  IL   P++R   + ILKH  
Sbjct: 282 DPKNPDGNDIAKLYKYITTTPLKFP--EYISPMARDLLRNILIPYPQKRATLKQILKHQW 339

Query: 290 L 290
           L
Sbjct: 340 L 340

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  203 bits (516), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 173/306 (56%), Gaps = 34/306 (11%)

Query: 7   RSVPTVKGNKI--GPWKLGETLGLGSTGKVQLAYDEST----------NQQAAIKVISKA 54
           R++P  K   +  GP+ +G TLG G  GKV+L + +++           +Q AIK+I + 
Sbjct: 33  RNIPLEKRKHVTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRD 92

Query: 55  IFNVKGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYA 114
             +     KDSS            I REI  +K L HPN+++L +V + +  + +VLEYA
Sbjct: 93  TIS-----KDSSKEIK--------IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYA 139

Query: 115 QKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIA 174
             GE +  +  +  L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I 
Sbjct: 140 SGGEFYKYIQRKKRLKEGPACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIIT 199

Query: 175 DFGMAA-LETEDKLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPF 232
           DFG  +   +  +L++TSCGSP YAAPE +VS  PY    +D+WSCGVIL+A+L G LP+
Sbjct: 200 DFGFVSEFYSHGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPW 259

Query: 233 DDEDGN-----IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
           DD+ GN     I  L   +     + P  D I+P  +DL+ RIL  DP +RI  + I KH
Sbjct: 260 DDDAGNPDGDDISRLYHYITQTPLKFP--DYINPIPRDLLRRILISDPRRRITIKYIEKH 317

Query: 288 PLLQKY 293
             L+ +
Sbjct: 318 EWLKPH 323

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  203 bits (516), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 112/290 (38%), Positives = 165/290 (56%), Gaps = 28/290 (9%)

Query: 17  IGPWKLGETLGLGSTGKVQLAY------DESTNQQAAIKVISKAIFNVKGSVKDSSVAAS 70
            GP+ +G TLG G  GKV+L +      ++  ++Q AIK+I +    VK S K+      
Sbjct: 41  FGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRDKI-VKNSEKE------ 93

Query: 71  TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLP 130
                   I REI  +K L HPN+++L +V + +  + +VLEYA  GE +  +  +  L 
Sbjct: 94  ------IKIFREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYRYIQRKRRLK 147

Query: 131 EKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLE 189
           E    R F Q+V G++Y H+ G+VHRDLK ENLLLD   N+ I DFG       ++ L++
Sbjct: 148 ETAGCRLFTQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFLKDNDLMK 207

Query: 190 TSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN-----IRNLL 243
           TSCGSP YAAPE ++S  PY    +D+WSCG+IL+A+L G LP+DD+  N     I  L 
Sbjct: 208 TSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLY 267

Query: 244 LQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
             +     + P  + ISP  +DL+ R+L  DP +R+  R I +H  L+ +
Sbjct: 268 YFITRTSLKFP--EYISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLRPH 315

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  202 bits (515), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 119/299 (39%), Positives = 171/299 (57%), Gaps = 36/299 (12%)

Query: 17  IGPWKLGETLGLGSTGKVQLA----YDESTN------QQAAIKVISK-AIFN-VKGSVKD 64
            GP+ LG TLG G  GKV+L     +  S+N      +Q AIK+I + +I N  +  VK 
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEVK- 96

Query: 65  SSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
                         I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + 
Sbjct: 97  --------------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQ 142

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALET 183
           ++  L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      +
Sbjct: 143 KKRRLKEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCS 202

Query: 184 EDKLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN---- 238
            ++L++TSCGSP YAAPE ++S  PY    +D+WSCGVIL+A+L G LP+DD+  N    
Sbjct: 203 RNELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGS 262

Query: 239 -IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
            I  L   + S   + P  D I P  +DL+ R+L  DP++RI  + I KH  L+ + S 
Sbjct: 263 DIGRLYNYINSTPLKFP--DYILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  200 bits (509), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 117/302 (38%), Positives = 170/302 (56%), Gaps = 36/302 (11%)

Query: 10  PTVKGNK-----IGPWKLGETLGLGSTGKVQLAYDEST---------NQQAAIKVISKAI 55
           PT+  NK      GP+ +G TLG G  GKV++ +  ++         ++Q AIK+I +  
Sbjct: 23  PTISRNKKSHMKFGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRD- 81

Query: 56  FNVKGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQ 115
           F  KGS K+              I REI  +K L HPN++RL +V + +  + +VLEYA 
Sbjct: 82  FIKKGSEKE------------MKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYAS 129

Query: 116 KGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIAD 175
            GE +  +  +  L E  A R F Q++ G+SY H+ GIVHRDLK ENLLLD   N+ I D
Sbjct: 130 GGEFYKYVQRKRRLKEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITD 189

Query: 176 FGMA-ALETEDKLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFD 233
           FG       +++L++TSCGSP YAAPE+V +  PY    +D+WSCG+IL+ +L G LP+D
Sbjct: 190 FGFVNEFYADNELMKTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWD 249

Query: 234 DEDGN-----IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHP 288
           D+  N     I  L   +     + P  + I+P  +DL+  IL  +P +R+ +R I KH 
Sbjct: 250 DDKQNPNGEDIVRLYHYITKTPLKFP--EYITPLPRDLLRHILVSNPVRRMSSRHIKKHE 307

Query: 289 LL 290
            L
Sbjct: 308 WL 309

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  202 bits (514), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 111/295 (37%), Positives = 167/295 (56%), Gaps = 39/295 (13%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTN-----QQAAIKVISKAIFNVKGSVKDSSVAAST 71
            GP+ +G TLG G  GKV+L + ++T      +Q AIK+I +                  
Sbjct: 41  FGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRR------------------ 82

Query: 72  PDSLP------YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVE 125
            D++P        I REI  +K L HPN++RL +V + +  + +VLEYA  GE +  + +
Sbjct: 83  -DTVPKNSDKEVKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYRYIQK 141

Query: 126 RGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETE 184
           +  L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       +
Sbjct: 142 KRRLKEHAACRLFAQLISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFNHK 201

Query: 185 DKLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN----- 238
           ++L++TSCGSP YAAPE +V+  PY    +D+WSCGVI++A+L G LP+DD+  N     
Sbjct: 202 NELMKTSCGSPCYAAPELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDD 261

Query: 239 IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
           I  L   +     + P  + I+P  +DL+ RIL  +P++R+  R + +H  LQ +
Sbjct: 262 IAKLYHYITKTPLKFP--EYINPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  201 bits (511), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 168/296 (56%), Gaps = 36/296 (12%)

Query: 17  IGPWKLGETLGLGSTGKVQL----AYDESTN------QQAAIKVISKAIF--NVKGSVKD 64
            GP+ LG TLG G  GKV+L    ++  S+N      +Q A+K+I +     + K  VK 
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTISNDYKKEVK- 96

Query: 65  SSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
                         I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + 
Sbjct: 97  --------------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRYIQ 142

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALET 183
           +R  L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      +
Sbjct: 143 KRRRLKEINACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCS 202

Query: 184 EDKLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN---- 238
            ++L++TSCGSP YAAPE ++S  PY    +D+WSCGVIL+A+L G LP+DD+  N    
Sbjct: 203 RNELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGS 262

Query: 239 -IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
            I  L   +     + P  D I P  +DL+ RIL  DP++RI  + I KH  L+ +
Sbjct: 263 DIGRLYNYISLTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPH 316

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  195 bits (496), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 168/297 (56%), Gaps = 40/297 (13%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTN------------------QQAAIKVISKAIFN 57
           + G + LG+TLG G  GKV+L Y  + N                  +Q AIK+I +   +
Sbjct: 55  RFGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKLIRRDTLS 114

Query: 58  VKGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKG 117
                K+S +           + REI  +K+L HPN+++L +V + +  + +VLEYA  G
Sbjct: 115 AS---KESEIK----------LYREINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASGG 161

Query: 118 ELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFG 177
           E +  +  +  L E +A   F Q++ G+SY H+ G+VHRDLK ENLLLD   N+ I DFG
Sbjct: 162 EFYKYIKFKKRLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLITDFG 221

Query: 178 MAALETE-DKLLETSCGSPHYAAPEIVSGI-PYHGFASDVWSCGVILFALLTGRLPFDDE 235
                T+ +KL+ T CGSP YAAPE+V+ + PY+   +D+WSCGVIL+A+L G LP+DD+
Sbjct: 222 FVNEVTKTNKLMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPWDDD 281

Query: 236 DGNIRN-----LLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
             NI       L   +++   + P    + P  +DL+ R+L +DP +R+  + IL+H
Sbjct: 282 PKNINGTDIVKLYKYIENQPLKFPEYINMVP--RDLLRRMLEIDPAKRMSMKHILQH 336

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  194 bits (494), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 164/292 (56%), Gaps = 30/292 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDE--------STNQQAAIKVISKAIFNVKGSVKDSSVA 68
            GP+ LG T+G G  GKV+  +          +  +Q AIK+I +     K   KD  + 
Sbjct: 52  FGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRDTLAEK---KDQELK 108

Query: 69  ASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGP 128
                     + REI  +KLL+HPN+++L DV + +  + +VLEYA  GE +  L  +  
Sbjct: 109 ----------VYREINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQRKKR 158

Query: 129 LPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKL 187
           L E  A   F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ I DFG    + T +KL
Sbjct: 159 LKEPLACSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEISTNNKL 218

Query: 188 LETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDDE----DG-NIRN 241
           ++T CGSP YAAPE+V S  PY    +D+WS GVIL+A+L G LP+DD+    DG NI  
Sbjct: 219 MKTPCGSPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGSNIMR 278

Query: 242 LLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
           L   +     + P  D I P A+DLI +IL + P+ R+    + +H  L+ +
Sbjct: 279 LYEYITKNNLKFP--DYIEPLARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  199 bits (505), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 121/323 (37%), Positives = 176/323 (54%), Gaps = 47/323 (14%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDEST----NQQAAIKVISKAIFNVKGSVKDSSVAASTP 72
            GP+ +G TLG G  GKV+L + ++     ++  AIK+I +                   
Sbjct: 42  FGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRR------------------- 82

Query: 73  DSLPYGIEREIII------MKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVER 126
           D++P   E+EI I      +KLL+HPN++RL +V + +  + +VL+YA  GE +  + ++
Sbjct: 83  DTVPKNSEKEIKIYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKK 142

Query: 127 GPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDK 186
             L E  A R F Q++ G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      ++ 
Sbjct: 143 RRLKEPPACRLFAQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKND 202

Query: 187 LLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN-----IR 240
           L+ TSCGSP YAAPE +VS  PY    +DVWSCGVIL+A+L G LP+DD+  N     I 
Sbjct: 203 LMRTSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIA 262

Query: 241 NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY------- 293
            L   +     + P  + I P  +DL+ RIL  +PE R+   DI +H  LQ +       
Sbjct: 263 KLYQYITHTSLKFP--EYIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPHAQFLMWS 320

Query: 294 PSINDSKS---IRNLPREDTYLH 313
           PS  D+K+     NL R+ + +H
Sbjct: 321 PSDWDAKAKAETNNLFRQPSAVH 343

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  197 bits (500), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 116/292 (39%), Positives = 167/292 (57%), Gaps = 27/292 (9%)

Query: 17  IGPWKLGETLGLGSTGKVQLAY---DESTN--QQAAIKVISKAIFNVKGSVKDSSVAAST 71
            GP+ +G TLG G  GKV+L +   +EST+  +Q AIK+I +          DS +    
Sbjct: 31  FGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRR----------DSILQDRE 80

Query: 72  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPE 131
            +     I REI  +K L HPN++RL +V + +  + +VLEYA  GE +  + ++  L E
Sbjct: 81  KE---IKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKE 137

Query: 132 KEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLET 190
             A + F Q+V G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L++T
Sbjct: 138 PIACKLFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFLQNNELMKT 197

Query: 191 SCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN-----IRNLLL 244
           SCGSP YAAPE +V+  PY    +DVWSCG+ILFA+L G LP+DD+  N     I  L  
Sbjct: 198 SCGSPCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLYN 257

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
            + +   + P    IS   +DL+ +IL  +P QR+  R+I  H  L+ + S 
Sbjct: 258 YITTSPLKFPS--YISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF 307

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  195 bits (495), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 164/294 (55%), Gaps = 32/294 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDES----------TNQQAAIKVISKAIFNVKGSVKDSS 66
            GP+ +G TLG G  GKV+L +  +           ++Q AIK+I +    VK S K+  
Sbjct: 41  FGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTI-VKNSEKE-- 97

Query: 67  VAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVER 126
                       I REI  +K L HPNV+RL +V + +  + +VLEYA  GE +  +  +
Sbjct: 98  ----------IKIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRK 147

Query: 127 GPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETED 185
             L E  A R F Q++ G++Y H+  +VHRDLK ENLLLD   N+ I DFG       ++
Sbjct: 148 RRLKESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDN 207

Query: 186 KLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN-----I 239
           + ++TSCGSP YAAPE+V S  PY    +DVWSCG+IL+A+L G LP+DD+  N     I
Sbjct: 208 EYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDI 267

Query: 240 RNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
             L   +     + P  + I+P  +DL+ +IL  DP +R+  + I +H  L+ +
Sbjct: 268 GKLYQYITRTPLKFP--EYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPH 319

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  199 bits (506), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 119/334 (35%), Positives = 189/334 (56%), Gaps = 25/334 (7%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKA--IFNVKGSVKDSS----VAAS 70
           +G W   ET+G GS GKV+LA +  T +  AIK++++A  IF  K S   S     +  +
Sbjct: 94  LGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIFLTKESKLMSHPTNHIIMN 153

Query: 71  TPDSLPYG--IEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGE 118
             D L     +E+EI           + ++L HP++ RL++++  +++ YM+ EY   G+
Sbjct: 154 EKDILDRQKRLEKEISRDRRTIREASLGQILYHPHICRLFEMYTLSNHFYMLFEYVSGGQ 213

Query: 119 LFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM 178
           L + +++ G L E  A  F RQI+  + Y HA  IVHRDLK EN+++    NIKI DFG+
Sbjct: 214 LLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKIIDFGL 273

Query: 179 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN 238
           + L  + K L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFDDE+ N
Sbjct: 274 SNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSN 333

Query: 239 IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK-YPSIN 297
           +  L  +++ GR   P    +S +   L++ +L VDP +R     ++KH  + K Y SI 
Sbjct: 334 V--LHEKIKQGRVFYP--QFLSIEVISLLSTMLVVDPFKRATLDQVMKHHWMVKDYDSIP 389

Query: 298 DSKSIRNLP--REDTYLHPLSEGESAEIDENILQ 329
           D+   + +P   E   +  + E +  E  E+I Q
Sbjct: 390 DAHLPKRVPLTSESIDMKVIKEMKHLEFIEDIEQ 423

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  196 bits (498), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 175/322 (54%), Gaps = 32/322 (9%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDES-TNQQA--------AIKVISKAIFNVKGSVKDSSV 67
            GP+ +G T+G G  GKV+L + +S +N+Q+         +         V   V    +
Sbjct: 58  FGPYIIGSTIGQGEFGKVKLGWSKSISNKQSHSPSANGLGLYATPALPIEVPKQVAIKLI 117

Query: 68  AASTPDSLP---YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
              T    P     I REI  +K L HPN+++L +V + +  + +VLEYA  GE +  + 
Sbjct: 118 RRDTISKDPRREIKIYREINALKQLTHPNIVKLDEVLQNSKYIGIVLEYASGGEFYKYIQ 177

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALET 183
            +  L E  A + F Q++ G++Y H+ G++HRDLK EN+LLD   N+ I DFG      T
Sbjct: 178 RKKRLKETIACKLFAQLISGVNYIHSKGLIHRDLKLENILLDKNENLIITDFGFVNEFVT 237

Query: 184 EDKLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDDE-----DG 237
            ++L++TSCGSP YAAPE+V S  PY     D+WSCG+ILFA+L G LP+DD+       
Sbjct: 238 SNELMKTSCGSPCYAAPELVISSQPYEARKVDIWSCGIILFAMLAGYLPWDDDPENPSGE 297

Query: 238 NIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH-------PLL 290
           NI  L   + +   + P  + I+   +DL+ RIL  DP++R+  R ILKH       P L
Sbjct: 298 NIAKLYFYITTTPLKFP--EYITAIPRDLLRRILIADPKKRVDLRYILKHQWLKPHTPFL 355

Query: 291 QKYP----SINDSKSIRNLPRE 308
              P    +I+ S+SI  LP+ 
Sbjct: 356 SISPEEWDNISRSQSILRLPKH 377

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  195 bits (496), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 162/289 (56%), Gaps = 27/289 (9%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTN-----QQAAIKVISKAIFNVKGSVKDSSVAAST 71
            GP+ +G TLG G  GKV+L + ++++     +Q AIK+I +         KD+      
Sbjct: 43  FGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRDTIK-----KDADKEVK- 96

Query: 72  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPE 131
                  I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +  L E
Sbjct: 97  -------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKE 149

Query: 132 KEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLET 190
             A R F Q++ G++Y H  G+VHRDLK ENLLLD   N+ I DFG       +++L+ T
Sbjct: 150 SSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDNELMNT 209

Query: 191 SCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN-----IRNLLL 244
           SCGSP YAAPE +VS  PY    +DVWSCGVIL+A+L G LP+DD+  N     I  L  
Sbjct: 210 SCGSPCYAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQ 269

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
            +     + P  + I+P  +DL+ RIL  +P +R+  R I +H  L+ +
Sbjct: 270 YITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSLRSIERHEWLKPH 316

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  191 bits (485), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 113/292 (38%), Positives = 159/292 (54%), Gaps = 33/292 (11%)

Query: 17  IGPWKLGETLGLGSTGKVQLAY-----------DESTNQQAAIKVISKAIFNVKGSVKDS 65
            GP+ +G TLG G  GKV++ +            + T +Q AIK+I +    V+ S K++
Sbjct: 47  FGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIRRDTI-VRNSDKET 105

Query: 66  SVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVE 125
                        I REI  +K L HPN++ L ++ + +  + +VLEYA  GE +  +  
Sbjct: 106 K------------IYREINALKHLTHPNIIVLEEILQNSKYIGIVLEYASGGEFYKYIQR 153

Query: 126 RGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETE 184
           +  L E  A R F Q+V G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       E
Sbjct: 154 KRRLKEVNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMITDFGFVNEFSNE 213

Query: 185 DKLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN----- 238
           + L++TSCGSP YAAPE +VS   Y G   D+WSCGVIL+A+L G LP+DD+  N     
Sbjct: 214 NVLMKTSCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDD 273

Query: 239 IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
           I  L   + +   + P  D ++P  +DL+ RIL  DP +R     I  H  L
Sbjct: 274 ISKLYSYITATPLKFP--DYVNPLPRDLLRRILVADPRRRYTLGHIENHEWL 323

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  194 bits (494), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 158/289 (54%), Gaps = 29/289 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
            GP+ +G TLG G  GKV+L +  S  ++ +  V  K +                 D++P
Sbjct: 62  FGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRR---------------DTIP 106

Query: 77  ------YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLP 130
                   I REI  +K LNHPN++RL +V + +  + +VL+YA  GE +  + ++  L 
Sbjct: 107 KHSEKEVKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLK 166

Query: 131 EKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLET 190
           E  A R F Q++ G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      ++ L++T
Sbjct: 167 EPPACRLFAQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMKT 226

Query: 191 SCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN-----IRNLLL 244
           SCGSP YAAPE +V+  PY    +DVWSCGVIL+A+L G LP+DD+  N     I  L  
Sbjct: 227 SCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYH 286

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
            +     + P  + I P  +DL+ RIL  +P+ R+   +I  H  L+ +
Sbjct: 287 YITKSALKFP--EYIKPLPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  195 bits (495), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 165/291 (56%), Gaps = 28/291 (9%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQ-------QAAIKVISKAIFNVKGSVKDSSVAA 69
            GP+ L  TLG G  GKV+L + +++ Q       Q AIK+I ++    KGS K+  V  
Sbjct: 81  FGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQVAIKLIKRSSILPKGSNKEIKVY- 139

Query: 70  STPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPL 129
                      REI  +K L HPN+++L DV + +  + +VLEYA  GE +  +  +  L
Sbjct: 140 -----------REINALKQLCHPNIVKLDDVLQNSKYIGIVLEYASGGEFYKYIQRKKRL 188

Query: 130 PEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLL 188
            E  A + F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L+
Sbjct: 189 KEINASKLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFFQTNELM 248

Query: 189 ETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE----DGN-IRNL 242
            T CGSP YAAPE ++S  PY    +D+WSCG+IL+A+L G LP+DD+    DGN I  L
Sbjct: 249 LTPCGSPCYAAPELVISKHPYEARKADLWSCGIILYAMLAGYLPWDDDIKNPDGNDIARL 308

Query: 243 LLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
              + +   + P  + I P  +DL+ +IL  + ++RI  R I+ H  L+ +
Sbjct: 309 YYYITTTPLKFP--EYIQPLPRDLLRKILVPNYKKRINMRRIINHEWLKPH 357

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  192 bits (487), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 161/289 (55%), Gaps = 27/289 (9%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTN-----QQAAIKVISKAIFNVKGSVKDSSVAAST 71
            GP+ +G TLG G  GKV+L + ++++     +Q AIK+I +         KD+      
Sbjct: 43  FGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRRDTIK-----KDADKEVK- 96

Query: 72  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPE 131
                  I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +  L E
Sbjct: 97  -------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKE 149

Query: 132 KEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED-KLLET 190
             A R F Q++ G++Y H  G+VHRDLK ENLL+D   N+ I DFG      ED +L+ T
Sbjct: 150 SSACRLFAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDNELMRT 209

Query: 191 SCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN-----IRNLLL 244
           SCGSP YAAPE +VS   Y    +DVWSCGVIL+A+L G LP+DD+  N     I  L  
Sbjct: 210 SCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQ 269

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
            +     + P  + I+P  +DL+ RIL  +P +R+  R I +H  L+ +
Sbjct: 270 YITQTPLKFP--EYITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPH 316

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  194 bits (493), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/292 (33%), Positives = 163/292 (55%), Gaps = 24/292 (8%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +G W   ET+G GS GKV+LA    TN+  AIK++++A      S      +   P S  
Sbjct: 151 LGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIVNRAT----KSFLQKEASLPPPKSEE 206

Query: 77  YGIER----------------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120
             +ER                E  + ++L HP++ RL+++   +++ YM+ EY   G+L 
Sbjct: 207 EALERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYMLFEYVSGGQLL 266

Query: 121 NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180
           + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++    +IKI DFG++ 
Sbjct: 267 DYIIQHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSGDIKIIDFGLSN 326

Query: 181 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240
           L    K L T CGS ++AAPE++   PY G   D+WS GV+L+ L  G++PFDDE+ ++ 
Sbjct: 327 LYDSKKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGKVPFDDENSSV- 385

Query: 241 NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
            L  +++ G+ + P    +S +   L++++L VDP++R   + I+ HP + +
Sbjct: 386 -LHEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRASLQQIVNHPWMTR 434

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  192 bits (488), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 148/283 (52%), Gaps = 28/283 (9%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSL 75
           ++G +K+ + +G GS GKV LA    T Q+  +K   K+  NV                 
Sbjct: 38  EVGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVV---------------- 81

Query: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135
                RE+   +  ++P + +LY+V  T + ++M LEY    EL++ L+ +  LP  E  
Sbjct: 82  -----REVFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECA 136

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
             F QI   + Y H L  VHRDLK EN+LLD   N K+ DFG         +LET CG+ 
Sbjct: 137 ELFAQITGAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTT 196

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
            Y APE++   PY GF  D+WS GVIL+ LL G LPFD++D      LL  Q    + P 
Sbjct: 197 VYMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD-----LLTKQKIINDTPV 251

Query: 256 DDE--ISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
            DE    P+AQ+LI ++L+ DP +R     IL HP LQ Y ++
Sbjct: 252 IDERITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  191 bits (485), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 160/289 (55%), Gaps = 27/289 (9%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTN-----QQAAIKVISKAIFNVKGSVKDSSVAAST 71
            GP+ +G TLG G  GKV+L + ++ +     +Q AIK+I +         KD+      
Sbjct: 43  FGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRRDSIK-----KDADKEVK- 96

Query: 72  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPE 131
                  I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +  L E
Sbjct: 97  -------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKE 149

Query: 132 KEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED-KLLET 190
             A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      ED +L+ T
Sbjct: 150 SSACRLFAQLISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMRT 209

Query: 191 SCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN-----IRNLLL 244
           SCGSP YAAPE +VS   Y    +DVWSCGVIL+A+L G LP+DD+  N     I  L  
Sbjct: 210 SCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQ 269

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
            +     + P  + I+P  +DL+ RIL  +P +R+  R I +H  L+ +
Sbjct: 270 YITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPH 316

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  193 bits (491), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 114/346 (32%), Positives = 190/346 (54%), Gaps = 35/346 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVI---SKAIFNVKGSV---KDSSVAAS 70
           +G W   ET+G GS GKV+LA    T +  AIK++   +KA  + + S+   K+    A 
Sbjct: 161 LGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRATKAFLHKEQSMPPPKNEQEIAE 220

Query: 71  TPDSLPYGIER------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               L   I R      E  + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 221 RQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 280

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G L E  A +F R I   + Y H   IVHRDLK EN+++ +   IKI DFG++ +   
Sbjct: 281 QHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIMISNSGEIKIIDFGLSNVFDN 340

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            K L T CGS ++AAPE++   PY G   DVWS G++L+ L+ G++PFDDE+ ++  L  
Sbjct: 341 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYVLVCGKVPFDDENSSV--LHE 398

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK-YPSINDSKSIR 303
           +++ G+ E P  + +S +   L+++++ VDP +R   R +++HP + + Y    D   + 
Sbjct: 399 KIRQGKVEYP--NHLSIEVISLLSKMIVVDPAKRASLRQVVEHPWMTRGY----DFPPLS 452

Query: 304 NLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLRE 349
            LPR      PL+      ID N+L+ +        +LE I+ + E
Sbjct: 453 YLPRRI----PLT---PEAIDNNVLREMF-------RLEFIDDVEE 484

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  192 bits (489), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 163/293 (55%), Gaps = 24/293 (8%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDS-- 74
           +G W   ET+G GS GKV+LA    TN+  AIK++++A    K  +         P S  
Sbjct: 112 LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRA---TKSFIHKQQQQQLPPPSNE 168

Query: 75  ---------LPYGIE------REIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGEL 119
                    L   I       RE  + ++L HP++ RL+++   +++ YM+ EY   G+L
Sbjct: 169 EELMERRKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQL 228

Query: 120 FNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA 179
            + +++ G L E+ A +F R I   + Y H   IVHRDLK EN+++     I+I DFG++
Sbjct: 229 LDYIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRIIDFGLS 288

Query: 180 ALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNI 239
            L    K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFDDE+ ++
Sbjct: 289 NLYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV 348

Query: 240 RNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
             L  +++ G+ E P    +S D   L++++L VDP +R   + ++ H  +QK
Sbjct: 349 --LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  192 bits (488), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 165/283 (58%), Gaps = 16/283 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAI--FNVKGSV----KDSSVAAS 70
           +G W+  ET+G GS GKV+LA    TN+  A+K++++A   F  K  +    K+      
Sbjct: 115 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 174

Query: 71  TPDSLPYGIER------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               L   I R      E  + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 175 RQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 234

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G + E +A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L   
Sbjct: 235 QHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 294

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFDDE+ ++  L  
Sbjct: 295 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 352

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
           +++ G+ E P    +S +   L++++L VDP++R   + +++H
Sbjct: 353 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  190 bits (483), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 162/289 (56%), Gaps = 27/289 (9%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTN-----QQAAIKVISKAIFNVKGSVKDSSVAAST 71
            GP+ +G TLG G  GKV+L + ++++     +Q AIK+I +         KD+      
Sbjct: 43  FGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIK-----KDADKEIK- 96

Query: 72  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPE 131
                  I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +  L E
Sbjct: 97  -------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKE 149

Query: 132 KEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED-KLLET 190
             A R F Q++ G++Y H  G+VHRDLK ENLLLD   N+ I DFG      ED +L++T
Sbjct: 150 SSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMKT 209

Query: 191 SCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN-----IRNLLL 244
           SCGSP YAAPE +VS   Y    +DVWSCGVIL+A+L G LP+DD+  N     I  L  
Sbjct: 210 SCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYK 269

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
            +     + P  + I+P  +DL+ RIL  +P +RI  + I +H  L+ +
Sbjct: 270 YITQTPLKFP--EYITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPH 316

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  192 bits (488), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 168/290 (57%), Gaps = 18/290 (6%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAI--FNVKGSVKDSSVAASTPDS 74
           +G W   ET+G GS GKV+LA    TN+  AIK++++A   F  K  ++     A+  + 
Sbjct: 51  LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLPPPATEEEL 110

Query: 75  LPY--GIEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNL 122
           L     +E+E+           + ++L HP++ RL+++   +++ YM+ EY   G+L + 
Sbjct: 111 LERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDY 170

Query: 123 LVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 182
           +++ G L E+ A +F R I   + Y H   IVHRDLK EN+++     I+I DFG++ + 
Sbjct: 171 IIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLSNMY 230

Query: 183 TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNL 242
              K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFDDE+ ++  L
Sbjct: 231 DPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV--L 288

Query: 243 LLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
             +++ G+ E P    +S D   L++++L VDP +R   + ++ H  +QK
Sbjct: 289 HEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQK 336

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  192 bits (487), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 103/289 (35%), Positives = 164/289 (56%), Gaps = 23/289 (7%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKA--IFNVKGSVKDSSVAASTPDS 74
           +G W   ET+G GS GKV+LA +  TN+  AIK++++A  IF  K      +   + P S
Sbjct: 68  LGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHN-GYTIPLS 126

Query: 75  LPYGIE----------------REIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGE 118
               IE                RE  + ++L HP++ RLY++   +++ YM+ EY   G+
Sbjct: 127 EKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQ 186

Query: 119 LFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM 178
           L + +++ G L E  A  F RQI   + Y H+  IVHRDLK EN+++    NIK+ DFG+
Sbjct: 187 LLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGL 246

Query: 179 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGN 238
           + L  +   L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFDDE+ N
Sbjct: 247 SNLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSN 306

Query: 239 IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
           +  L  +++ G+   P    +S +   L++++L VDP +R     ++ H
Sbjct: 307 V--LHEKIKQGKVFYP--QFLSIEVISLLSKMLVVDPFKRATLDQVMNH 351

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  191 bits (486), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 165/283 (58%), Gaps = 16/283 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAI--FNVKGSV----KDSSVAAS 70
           +G W+  ET+G GS GKV+LA    TN+  A+K++++A   F  K  +    K+      
Sbjct: 128 LGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 187

Query: 71  TPDSLPYGIER------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               L   I R      E  + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 188 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 247

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G + E +A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L   
Sbjct: 248 QHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 307

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFDDE+ ++  L  
Sbjct: 308 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 365

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
           +++ G+ E P    +S +   L++++L VDP++R   + +++H
Sbjct: 366 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 406

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  191 bits (484), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 166/288 (57%), Gaps = 16/288 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +G W   ET+G GS GKV+LA    T +  AIK++++A        ++S    +  + + 
Sbjct: 105 LGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIME 164

Query: 77  Y--GIEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               +E+EI           + ++  HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 165 RQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYII 224

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G L E  A +F R +   + Y HA  IVHRDLK EN+++ +   IKI DFG++ +   
Sbjct: 225 QHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNVYDT 284

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFDDE+ ++  L  
Sbjct: 285 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 342

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
           +++ G+ E P    +S +   L++++L VDP +R   + +++HP + K
Sbjct: 343 KIKRGKVEYP--QHLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  190 bits (482), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 165/283 (58%), Gaps = 16/283 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAI--FNVKGSV----KDSSVAAS 70
           +G W+  ET+G GS GKV+LA    TN+  A+K++++A   F  K  +    K+      
Sbjct: 115 LGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 174

Query: 71  TPDSLPYGIER------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               L   I R      E  + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 175 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 234

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G + E +A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L   
Sbjct: 235 QHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 294

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFDDE+ ++  L  
Sbjct: 295 RKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 352

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
           +++ G+ E P    +S +   L++++L VDP++R   + +++H
Sbjct: 353 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  190 bits (482), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 165/283 (58%), Gaps = 16/283 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAI--FNVKGSV----KDSSVAAS 70
           +G W+  ET+G GS GKV+LA    TN+  A+K++++A   F  K  +    K+      
Sbjct: 117 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 176

Query: 71  TPDSLPYGIER------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               L   I R      E  + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 177 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 236

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G + E +A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +   
Sbjct: 237 QHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDS 296

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFDDE+ ++  L  
Sbjct: 297 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 354

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
           +++ G+ E P    +S +   L++++L VDP++R   + +++H
Sbjct: 355 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 395

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  190 bits (482), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 172/303 (56%), Gaps = 17/303 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +G W   ET+G GS GKV+LA    TN+  AIK++++A        ++     S  + L 
Sbjct: 106 LGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIVNRATKAFLHKEQNLPPPKSEQEILQ 165

Query: 77  YG--IEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 166 RQKRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 225

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G L E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +   
Sbjct: 226 QHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVYDP 285

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFDDE  ++  L  
Sbjct: 286 RKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDEVSSV--LHE 343

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK-YPSINDSKSIR 303
           +++ G  E P  + +S +   L++++L VDPE+R   + +++HP + + Y  I  S   +
Sbjct: 344 KIKQGNVEYP--NHLSIEVLSLLSKMLVVDPERRASLKQVIEHPWMNRGYDYITPSYLPK 401

Query: 304 NLP 306
            +P
Sbjct: 402 RIP 404

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 167/288 (57%), Gaps = 16/288 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSL- 75
           +G W   ET+G GS GKV+LA    T++  AIK++++A  +     +  +   S  ++L 
Sbjct: 76  LGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAAKSFVHKQQQMTPPKSEQEALE 135

Query: 76  -PYGIEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               +E+EI           + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 136 RKRKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 195

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G L E+ A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ +   
Sbjct: 196 QHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGLSNMYDP 255

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFDDE+ ++  L  
Sbjct: 256 KKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENASV--LHE 313

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
           +++ G+ E P    +S +   L++++L VDP +R   + ++ H  +Q+
Sbjct: 314 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  190 bits (482), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 165/286 (57%), Gaps = 22/286 (7%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSV-KDSSVAASTPD-- 73
           +G W   ET+G GS GKV+LA    TN+  AIK++++A    K  + K+ S+ A   D  
Sbjct: 142 LGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIVNRA---TKAFLHKEQSLPAPANDQE 198

Query: 74  ------SLPYGIER------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFN 121
                 +L   I R      E  + ++L HP++ RL+++   +++ YM+ EY   G+L +
Sbjct: 199 IMERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 258

Query: 122 LLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 181
            +++ G L E  A RF R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ L
Sbjct: 259 YIIQHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLIDFGLSNL 318

Query: 182 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRN 241
               K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFDDE+ ++  
Sbjct: 319 YDNRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV-- 376

Query: 242 LLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
           L  +++ G+ E      +S +   L++++L VDP++R   + ++ H
Sbjct: 377 LHEKIKQGKVEY--SQHLSIEVISLLSKMLVVDPKRRASLKQVVDH 420

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  188 bits (477), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 150/279 (53%), Gaps = 24/279 (8%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           IG +K+ + +G GS GKV LA    T+Q+  +K          G+  D +V         
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQKVVLKT---------GNKNDPNVV-------- 76

Query: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIR 136
               RE+   +  + P++ +LY+V  T S ++M LEY    EL+  L+ +  +  +E+ +
Sbjct: 77  ----REVFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGK 132

Query: 137 FFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 196
            F QIV  + Y H+L  VHRDLK EN+LLD K   KI DFG         +LET CG+  
Sbjct: 133 LFAQIVSAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTV 192

Query: 197 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGD 256
           Y APE++    Y GF  D+WS GVIL+ ++ G +PFD+ED       +  +   Y    D
Sbjct: 193 YMAPELIERKSYDGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFY---ND 249

Query: 257 DEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPS 295
           D +S DA+DLI+++L  DP QR +   +L HP LQ Y S
Sbjct: 250 DVVSKDAKDLISQLLCKDPSQRPQLSQVLAHPFLQPYGS 288

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  189 bits (481), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 99/292 (33%), Positives = 163/292 (55%), Gaps = 34/292 (11%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +G W   ET+G GS GKV+LA    TN+  AIKV+++A    KG +             P
Sbjct: 180 LGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVVNRA---TKGFLHKEQTLP------P 230

Query: 77  YGIEREII---------------------IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQ 115
              E+EI+                     + ++L HP++ RL+++   +++ YM+ EY  
Sbjct: 231 PQTEQEILERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVS 290

Query: 116 KGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIAD 175
            G+L + +++ G L E  A +F R I   + Y H+  IVHRDLK EN+++     IKI D
Sbjct: 291 GGQLLDYIIQHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIID 350

Query: 176 FGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE 235
           FG++ L    + L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFDDE
Sbjct: 351 FGLSNLYDTTRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDE 410

Query: 236 DGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
           + ++  L  +++ G+ + P    +S +   L++++L VDP++R   R +++H
Sbjct: 411 NSSV--LHEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRATLRQVVEH 458

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  189 bits (480), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 165/288 (57%), Gaps = 16/288 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVI---SKAIFNVKGSV---KDSSVAAS 70
           +G W+  ET+G GS GKV+L     T +   IK++   SKA  + + S+   K+ +    
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIVNRASKAFLHKQHSLPPPKNENELLE 163

Query: 71  TPDSLPYGIER------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               L   I R      E  + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 164 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 223

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G L E  A +F R I   + Y HA  IVHRDLK EN+++ +   IKI DFG++ +   
Sbjct: 224 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNIFDS 283

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFDDE+ +I  L  
Sbjct: 284 KKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 341

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
           +++ G+ + P    +S DA  L+ R++ VDP +R   +++  HP + +
Sbjct: 342 KIKKGKVDYPS--HLSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNR 387

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  187 bits (476), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 168/291 (57%), Gaps = 26/291 (8%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSV-KDSSVAASTPDSL 75
           +G W   ET+G GS GKV+LA    TN+  AIK++++A    K  + K+ S+A   P + 
Sbjct: 98  LGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRA---TKAYLHKEQSLAP--PKNE 152

Query: 76  PYGIER----------------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGEL 119
              +ER                E  + ++L HP++ RL+++   +++ YM+ EY   G+L
Sbjct: 153 NEMLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQL 212

Query: 120 FNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA 179
            + +++ G L E  A +F R +   + Y HA  IVHRDLK EN+++     IKI DFG++
Sbjct: 213 LDYIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLS 272

Query: 180 ALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNI 239
            +    K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFDDE+ ++
Sbjct: 273 NVFDTRKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVCGKVPFDDENSSV 332

Query: 240 RNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             L  +++ G+ E P  + +S +   L++++L VDP +R     +++HP +
Sbjct: 333 --LHEKIKQGKVEYP--NHLSIEVISLLSKMLVVDPLKRANLTKVIEHPWM 379

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  187 bits (476), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/312 (33%), Positives = 174/312 (55%), Gaps = 28/312 (8%)

Query: 3   AMSNRSVPTVKGNK-IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGS 61
           A SN++ P     K +G W   ET+G GS GKV+LA    T +  AIK++++A+     +
Sbjct: 144 ATSNQNEPKQFHRKSLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAM----KA 199

Query: 62  VKDSSVAASTPDSLPYGIER----------------EIIIMKLLNHPNVLRLYDVWETNS 105
                 +   P +    +ER                E  + ++L HP++ RL+++   ++
Sbjct: 200 FLHKEQSMPPPRTEQEVLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSN 259

Query: 106 NLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLL 165
           + YM+ EY   G+L + +++ G L E  A +F R I   + Y HA  IVHRDLK EN+++
Sbjct: 260 HFYMLFEYVSGGQLLDYIIQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMI 319

Query: 166 DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFAL 225
                IKI DFG++ +    K L T CGS ++AAPE++   PY G   DVWS GV+L+ L
Sbjct: 320 STSGEIKIIDFGLSNVFDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVL 379

Query: 226 LTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDIL 285
           + G++PFDDE+ ++  L  +++ G+ + P  + +S +   L++++L VDP +R   + ++
Sbjct: 380 VCGKVPFDDENSSV--LHEKIKQGKVDYP--NHLSIEVISLLSKMLVVDPLRRASLKQVV 435

Query: 286 KHPLLQK---YP 294
           +HP + +   YP
Sbjct: 436 EHPWMTRGYDYP 447

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  187 bits (475), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 165/288 (57%), Gaps = 16/288 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVI---SKAIFNVKGSV---KDSSVAAS 70
           +G W+  ET+G GS GKV+L     T +   IK++   SKA  + + S+   K+ S    
Sbjct: 96  LGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLPSPKNESEILE 155

Query: 71  TPDSLPYGIER------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               L   I R      E  + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 156 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 215

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G L E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +   
Sbjct: 216 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 275

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFDDE+ +I  L  
Sbjct: 276 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 333

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
           +++ G+ + P    +S +   L+ R++ VDP +R   +++++HP + +
Sbjct: 334 KIKKGKVDYP--SHLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNR 379

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  186 bits (472), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 165/288 (57%), Gaps = 16/288 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVI---SKAIFNVKGSV---KDSSVAAS 70
           +G W+  ET+G GS GKV+L     T +   IK++   SKA  + + ++   K+ +    
Sbjct: 103 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHTLPSPKNENEILE 162

Query: 71  TPDSLPYGIER------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               L   I R      E  + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 163 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 222

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G L E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +   
Sbjct: 223 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 282

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFDDE+ +I  L  
Sbjct: 283 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 340

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
           +++ G+ + P    +S +A  L+ R++ +DP +R   ++++ HP + +
Sbjct: 341 KIKKGKVDYPS--HLSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  186 bits (471), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 163/293 (55%), Gaps = 36/293 (12%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +G W   ET+G GS GKV+LA    T +  AIK++++A          ++       SLP
Sbjct: 75  LGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRA----------TNAFLHKEQSLP 124

Query: 77  ------------YGIEREII----------IMKLLNHPNVLRLYDVWETNSNLYMVLEYA 114
                         +E+EI           + ++L HP++ RL+++   +++ YM+ EY 
Sbjct: 125 PPKKEEEILERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYV 184

Query: 115 QKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIA 174
             G+L + +++ G L E  A +F R I   + Y HA  IVHRDLK EN+++     IKI 
Sbjct: 185 SGGQLLDYIIQHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENIMISTSGEIKII 244

Query: 175 DFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDD 234
           DFG++ L  + K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFDD
Sbjct: 245 DFGLSNLFDKSKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLYVLVCGKVPFDD 304

Query: 235 EDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
           E+ ++  L  +++ G+ E P    +S +   L++++L VDP +R   + +++H
Sbjct: 305 ENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPHRRASLKQVVEH 353

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  185 bits (469), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 161/292 (55%), Gaps = 24/292 (8%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +G W   ET+G GS GKV+LA    TN+  AIK++++A      S          P +  
Sbjct: 95  LGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRA----AKSYMHKQNQLPPPKTEE 150

Query: 77  YGIE----------------REIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120
             +E                RE  + ++L HP++ RL+++   +++ YM+ EY   G+L 
Sbjct: 151 ELMERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 210

Query: 121 NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180
           + +++ G L E+ A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ 
Sbjct: 211 DYIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSN 270

Query: 181 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240
           L    K L T CGS ++AAPE++   PY G   D+WS GV+++ L+ G++PFDDE+ ++ 
Sbjct: 271 LYDNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASV- 329

Query: 241 NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
            L  +++ G+ E P    +S +   L++++L VDP +R   + +  H  +Q+
Sbjct: 330 -LHEKIKKGKVEYP--QHLSIECISLLSKMLVVDPLKRASLKQVCNHQWMQR 378

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  184 bits (468), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/292 (33%), Positives = 164/292 (56%), Gaps = 24/292 (8%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +G W   ET+G GS GKV+LA    T++  AIK++++A    K  +   S     P +  
Sbjct: 181 LGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRA---TKALIHKES-QQPPPRTQE 236

Query: 77  YGIEREIIIMK----------------LLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120
             +ERE  + K                +L HP++ RL+++   +++ YM+ EY   G+L 
Sbjct: 237 EVLERERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 296

Query: 121 NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180
           + +++ G L E+ A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ 
Sbjct: 297 DYIIQHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSN 356

Query: 181 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240
           +    K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFDDE+ ++ 
Sbjct: 357 MFNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV- 415

Query: 241 NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
            L  +++ G+ E P    +S +   L++++L VDP +R   + ++ H  +Q+
Sbjct: 416 -LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQR 464

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  184 bits (466), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 164/288 (56%), Gaps = 16/288 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVI---SKAIFNVKGSV---KDSSVAAS 70
           +G W+  ET+G GS GKV+L     T +   IK++   SKA  + + S+   K+ +    
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHSLPSPKNENEVLE 163

Query: 71  TPDSLPYGIER------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               L   I R      E  + ++L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 164 RQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 223

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G L E  A +F R I   + Y H+  IVHRDLK EN+++     IKI DFG++ +   
Sbjct: 224 QHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 283

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
            K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFDDE+ +I  L  
Sbjct: 284 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 341

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
           +++ G+ + P    +S +A  L+ +++ VDP +R   + ++ HP + +
Sbjct: 342 KIKKGKVDYPS--HLSIEAISLLTKMIVVDPLRRATLKTVVDHPWMNR 387

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  182 bits (462), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 160/285 (56%), Gaps = 16/285 (5%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVK------DSSVAASTPD 73
           W   ET+G GS GKV+LA ++++N+  AIK++ +A        +      D + A     
Sbjct: 67  WDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAKERQK 126

Query: 74  SLPYGIER------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERG 127
            L   I R      E  + ++L HPNV +LY++   +++ YM  E+   G+L + +++ G
Sbjct: 127 RLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLLDYIIQHG 186

Query: 128 PLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKL 187
            L E  A +  R I+  + Y HA  IVHRDLK EN++L     IK+ DFG++ +    K 
Sbjct: 187 SLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSNMYDPRKS 246

Query: 188 LETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQ 247
           L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFDDE  N   L  +++
Sbjct: 247 LQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDE--NSSALHEKIK 304

Query: 248 SGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
            G+   P    +S D   L+++IL VDP++R   + ++ H  + K
Sbjct: 305 KGKVTYP--QFLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLK 347

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  182 bits (462), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 161/283 (56%), Gaps = 16/283 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVI---SKAIFNVKGSV---KDSSVAAS 70
           +G W   ET+G GS GKV++A    TN+  AIK+I   +KA  + +  +   ++   A  
Sbjct: 137 LGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRATKAFLHKEQQLPPPQNEQEALE 196

Query: 71  TPDSLPYGIER------EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
               L   I R      E  + + L HP++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 197 RQKKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 256

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G L E  A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +   
Sbjct: 257 QHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNMFDP 316

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
              L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFDDE+ ++  L  
Sbjct: 317 RTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 374

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
           +++ G+ + P    +S +   L++++L VDP +R   + +++H
Sbjct: 375 KIKQGKVDYP--QHLSIEVISLLSKMLVVDPRKRASLKQVVEH 415

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  181 bits (458), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 109/289 (37%), Positives = 158/289 (54%), Gaps = 29/289 (10%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQA---AIKVISKAIF--NVKGSVKDSSVAAST 71
            GP+ +G TLG G  GKV+L + +S + ++   AIK+I +     N +  VK        
Sbjct: 53  FGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVK-------- 104

Query: 72  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPE 131
                  I REI  +K L HPN++ L +V + +  + +VL YA  GE +  + ++  L E
Sbjct: 105 -------IYREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKE 157

Query: 132 KEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLET 190
             A R F Q++ G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      + + L++T
Sbjct: 158 PAACRLFAQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKT 217

Query: 191 SCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILFALLTGRL-----PFDDEDGNIRNLLL 244
           SCGSP YAAPE +V+   Y    +DVWSCGVIL+A+L G L     P + +  +I  L  
Sbjct: 218 SCGSPCYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYN 277

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
            +     + P  + I+P  +D++ RIL  DP +RI    ILKH  LQ +
Sbjct: 278 YITKTSLKFP--EYINPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  180 bits (456), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 151/283 (53%), Gaps = 28/283 (9%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSL 75
           ++G +++   +G GS GKV LA+   T+++  +K                S A S P+  
Sbjct: 33  EVGNYRILRQIGEGSFGKVYLAHHLPTHRKVVLK----------------SSAKSDPN-- 74

Query: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135
              + RE+   +    P + +LY++  T + ++M LEY    EL+  L+    +P  E  
Sbjct: 75  ---VVREVFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECS 131

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
           R F QI   + Y H+L  VHRDLK EN+LLD   N K+ DFG         +LET CG+ 
Sbjct: 132 RLFAQISGAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTT 191

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
            Y APE++    Y GF  DVWS GVIL+ LL G +PFD+E    +N   ++ +   EMP 
Sbjct: 192 VYMAPELIKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPS 246

Query: 256 DDE--ISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
            D   + PDA DL++++L  DP  R   +++L+HP LQ Y ++
Sbjct: 247 FDSTLLGPDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  178 bits (452), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 146/279 (52%), Gaps = 24/279 (8%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +G +K+ + +G GS GKV LA    T+ +  +K                     + D   
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLK---------------------SSDKND 73

Query: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIR 136
             I RE+   +  ++P + +LY+V  T + ++M LEY    EL++ ++    +P  E ++
Sbjct: 74  PNIVREVFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQ 133

Query: 137 FFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 196
            F QIV G+ Y H+L  VHRDLK EN+LLD   + K+ DFG          LET CG+  
Sbjct: 134 LFAQIVGGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETICGTTV 193

Query: 197 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGD 256
           Y APE++    Y GF  D+WS GVIL+ ++ G +PFD++D       +  Q+ +     +
Sbjct: 194 YMAPELIERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NE 250

Query: 257 DEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPS 295
           + ++ DA+DLI R+L  +P  R     ILKHP LQ + S
Sbjct: 251 NIVTADAKDLILRLLAKNPNDRPTVEQILKHPFLQPFGS 289

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  178 bits (452), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 149/283 (52%), Gaps = 28/283 (9%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSL 75
           ++G +K+ + +G GS GKV LA    T+ +  +K  +K                S P+  
Sbjct: 34  EVGNYKILDQIGEGSFGKVYLASHRLTHCKVVLKTSNK----------------SDPN-- 75

Query: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135
              I RE+   +  ++P + +LY+V  T S ++M  EY    +L++ ++    +P    I
Sbjct: 76  ---IVREVFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRVPSSACI 132

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
             F QIV  + Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+ 
Sbjct: 133 ELFTQIVGAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLETICGTT 192

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMP- 254
            Y APE++    Y GF  D+WS GVIL+ +L G +PFD++D       +       EMP 
Sbjct: 193 VYMAPELIKRESYDGFKIDIWSLGVILYTMLNGSMPFDEDDETKTEWKIM-----NEMPV 247

Query: 255 -GDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
             D  +S DA+DL+ ++L+ DP +R   ++IL HP LQ Y S+
Sbjct: 248 FNDTILSEDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSL 290

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  177 bits (450), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 156/283 (55%), Gaps = 16/283 (5%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNV------------KGSVKD 64
           +G W    T+G GS GKV+LA     +   A+K++++A                K  +K+
Sbjct: 115 LGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIVNRATKTFLYRQQSAPAPQSKADIKE 174

Query: 65  SSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124
                +   +      RE  + ++L+H N+ +LY +   +++ YM+ EY   G+L + ++
Sbjct: 175 RERLLAKEIARDTRTVREASLGQVLSHQNICQLYQMCTMSNHFYMMFEYVSGGQLLDYII 234

Query: 125 ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184
           + G L E  A  F R I  G++Y HA  +VHRDLK EN++L     IKI DFG++ L   
Sbjct: 235 QHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGEIKIIDFGLSNLFDP 294

Query: 185 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244
              L T CGS ++AAPE++   PY G   D+WS GVIL+ L+ G++PFDDE+ N   L  
Sbjct: 295 RAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKVPFDDENSNA--LHE 352

Query: 245 QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
           +++ G+   P    +S +   L+ ++LTV+P++R   ++I+ H
Sbjct: 353 KIKRGKVSYPA--TLSIECISLLTKMLTVNPKRRATLKEIVTH 393

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  177 bits (448), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 100/282 (35%), Positives = 147/282 (52%), Gaps = 30/282 (10%)

Query: 15  NKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDS 74
           +++G +K+ + +G GS GKV LA  + T+++  +K   K   NV                
Sbjct: 32  SEVGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLKTSDKNDPNVV--------------- 76

Query: 75  LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEA 134
                 RE+   +  ++  + RLY+V  T + ++M LEY    EL+  L+    +   E 
Sbjct: 77  ------REVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDEC 130

Query: 135 IRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGS 194
            R F QIV  I Y H+L  VHRDLK EN+LLD K N K+ DFG          L+T CG+
Sbjct: 131 SRLFAQIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGT 190

Query: 195 PHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFD-DEDGNIRNLLLQVQSGRYEM 253
             Y APE+     Y GF  D+W+ GVIL+ ++ G +PFD D++   +  ++       EM
Sbjct: 191 TVYMAPELTERKSYDGFKIDIWALGVILYTMINGSMPFDEDDEAKTKWKIVN------EM 244

Query: 254 P--GDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
           P   +D +SPDA+DLI ++L  DP +R     IL HP LQ Y
Sbjct: 245 PEINEDLVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPY 286

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  176 bits (446), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 149/283 (52%), Gaps = 28/283 (9%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSL 75
           ++G +++ + +G GS GKV LA  + T+Q+  +K  +K+  NV                 
Sbjct: 33  EVGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPNVV---------------- 76

Query: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135
                RE+   +   +P + +LY+V  T + ++M LEY    EL++ L+ +  +P  E  
Sbjct: 77  -----REVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETR 131

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
           R F QIV  + Y H+L  VHRDLK EN+LLD      + DFG          LET CG+ 
Sbjct: 132 RLFAQIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTT 191

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
            Y APE++    Y G+  D WS G+IL+ +L G +PF DED  +R  L  +    +E P 
Sbjct: 192 VYMAPELIKREAYDGYKVDTWSLGIILYTMLHGYMPF-DEDDTVRTGLKIM----HEEPA 246

Query: 256 --DDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
             D+  SP A+DLI R+L  +  QR    ++L+HP LQ Y ++
Sbjct: 247 VLDEYTSPQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPYGAL 289

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  175 bits (443), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 93/278 (33%), Positives = 149/278 (53%), Gaps = 24/278 (8%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSL 75
           ++G +K+ + +G GS GKV LA    T+Q+  +K+         GS  D +V        
Sbjct: 33  EVGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKM---------GSKNDPNVV------- 76

Query: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135
                RE+   +  ++ ++ +LY+V  T + ++M LEY    EL+  L+ +  +P +E  
Sbjct: 77  -----REVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECS 131

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
             F QIV  + Y H++  VHRDLK EN+LLD K + K+ DFG         +LET CG+ 
Sbjct: 132 ELFSQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTT 191

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
            Y APE++   PY G+  D WS G+IL+ ++ G +PFD+ D       +   +  Y+   
Sbjct: 192 VYMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYD--- 248

Query: 256 DDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
           +D I  + ++LI+++L  DP QR     +L+HP LQ Y
Sbjct: 249 NDYIDSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  174 bits (442), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 144/281 (51%), Gaps = 26/281 (9%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +G +K+ + +G GS GKV LA    T+++  +K                     T D   
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK---------------------TSDKND 76

Query: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIR 136
             I RE+   +  + P + +LY+V  T S ++M LEY    EL++ L+    +   E   
Sbjct: 77  PNIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGE 136

Query: 137 FFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 196
            F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 197 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGD 256
           Y APE++    Y GF  D WS GVIL+ L+TG LPFDD+D       +  +  +Y    D
Sbjct: 197 YMAPELIGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKY----D 252

Query: 257 DEISP-DAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
            ++ P DA+DLI+R+L  +P +R     +L+HP LQ Y S+
Sbjct: 253 PKLIPDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  174 bits (442), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 152/294 (51%), Gaps = 24/294 (8%)

Query: 15  NKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDS 74
           +++G +K+ + +G GS GKV LA  + T+++  +K   K                S P+ 
Sbjct: 32  SEVGNYKILKQIGEGSFGKVYLASHKPTHRKVVLKTSDK----------------SDPN- 74

Query: 75  LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEA 134
               + RE+   +  + P + +LY+V  T + ++M LEY    EL+  L+    +P  E 
Sbjct: 75  ----LVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRIPLDEC 130

Query: 135 IRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGS 194
            + F QIV  + Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+
Sbjct: 131 AKLFAQIVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETICGT 190

Query: 195 PHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMP 254
             Y APE++    Y GF  D+WS GVIL+ ++ G +PFD++D       +      +   
Sbjct: 191 TVYMAPELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETKTKWKIVNDFPNF--- 247

Query: 255 GDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPRE 308
            D+ +S +A+DLI R+L   P +R     IL HP LQ Y  I  S++ + + R+
Sbjct: 248 NDNFVSHEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQ 301

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  174 bits (440), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 151/287 (52%), Gaps = 26/287 (9%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSL 75
           +IG +K+ + +G GS GKV LA    T+Q+  +K          G+ +D +V        
Sbjct: 33  EIGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKT---------GNKRDPNVV------- 76

Query: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135
                RE+   +  + P + +LY+V  T S ++MVLEY    EL+  L++   L  +E+ 
Sbjct: 77  -----REVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESK 131

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
           + F QI   + Y H L  VHRDLK EN+LLD   + K+ DFG          LET CG+ 
Sbjct: 132 KLFSQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETICGTT 191

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
            Y APE++    Y GF  D+WS G+IL+ ++ G +PF DED +I+  L  V     E+  
Sbjct: 192 VYMAPELIERKCYDGFKVDIWSLGIILYTMINGYMPF-DEDDDIKTKLKIVND---ELDF 247

Query: 256 DDE-ISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKS 301
           + E IS DA DLI  +L  +P +RI    +L HP LQ +  +   K+
Sbjct: 248 NQEWISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKT 294

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  174 bits (440), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 148/279 (53%), Gaps = 24/279 (8%)

Query: 15  NKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDS 74
           N++G +K+ + +G GS GKV LA  + T+++  +K   K   NV                
Sbjct: 34  NEVGNYKILKQIGEGSFGKVYLALHKPTHKKVVLKSSDKTDPNVV--------------- 78

Query: 75  LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEA 134
                 REI   +  + P + +LY+V  T + ++MV+EY    EL++ L+ +  +   E+
Sbjct: 79  ------REIFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDES 132

Query: 135 IRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGS 194
            R F QIV  + Y H+L  VHRDLK EN+LLD   N K+ DFG     +++  LET CG+
Sbjct: 133 ARIFAQIVGAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLETICGT 192

Query: 195 PHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMP 254
             Y APE++    Y G+  D+W+ G++L+ ++ G +PFD++D     L +   S  Y+  
Sbjct: 193 TVYMAPELLRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYD-- 250

Query: 255 GDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
            +   + D+ DL+ R+L+ DP  R     IL HP L  Y
Sbjct: 251 -NKYFNDDSIDLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  174 bits (442), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 147/277 (53%), Gaps = 24/277 (8%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +G +K+ E +G GS GKV LA    T+++  IK           SVK+       P+   
Sbjct: 43  VGNYKILEQIGEGSFGKVYLAMHRPTHRKVVIK----------SSVKND------PN--- 83

Query: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIR 136
             I RE+   +   +  + +LY++  T S ++M LEY    EL++ +++   +P +E I+
Sbjct: 84  --IVREVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQ 141

Query: 137 FFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 196
            F QIV  + Y H+L  VHRDLK EN+LLD   N K+ DFG      E   LET CG+  
Sbjct: 142 LFSQIVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTRECMEKVNLETICGTTV 201

Query: 197 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGD 256
           Y APE+    PY GF  D+WS GVIL+ +L+G +PFD++D       +  +   Y     
Sbjct: 202 YMAPELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY---NS 258

Query: 257 DEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
             ++ + +DL+ ++L  D   R   R+IL+H  LQ Y
Sbjct: 259 KFMTAEGEDLVRKLLQKDSNLRPSVREILQHEFLQPY 295

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  173 bits (439), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 146/282 (51%), Gaps = 26/282 (9%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSL 75
           ++G +K+ + +G GS GKV LA    T+++  +K                     T D  
Sbjct: 37  EVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK---------------------TSDKN 75

Query: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135
              I RE+   +  + P + +LY+V  T S ++M LEY    EL++ L+    +   E  
Sbjct: 76  DPNIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECG 135

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
             F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+ 
Sbjct: 136 ELFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTT 195

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
            Y APE++    Y GF  D+WS GVIL+ L+TG LPFDD+D       +  +  +Y    
Sbjct: 196 VYMAPELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKY---- 251

Query: 256 DDEISP-DAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
           D ++ P DA+DLI+R+L  +P +R     +L+HP LQ Y S+
Sbjct: 252 DAKVIPDDARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSV 293

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  172 bits (437), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 148/283 (52%), Gaps = 28/283 (9%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSL 75
           ++G +K+ + +G GS GKV LA  + T+Q+  +K          G  KD +V        
Sbjct: 33  EVGNYKILKQVGEGSFGKVYLANHKLTHQKVVLKT---------GEKKDPNVV------- 76

Query: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135
                RE+   +  + P + +LY+V  T S ++M LEY    EL++ L+++  +P  E  
Sbjct: 77  -----REVFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETS 131

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
           + F QIV  + Y H+L  VHRDLK EN+LLD +    + DFG          LET CG+ 
Sbjct: 132 KLFAQIVGAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTT 191

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
            Y APE++    Y G+  D WS G+IL+ +L G +PFD+ED  +  L +       EMP 
Sbjct: 192 VYMAPELIKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTGLKIM-----NEMPP 246

Query: 256 --DDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
             D   +  A+DLI ++L   P +R     +L+HP LQ Y +I
Sbjct: 247 IVDAYTNVHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  165 bits (418), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 154/279 (55%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G TLG GS G V+ A   ST +  A+K++      +K ++K   V           +
Sbjct: 46  YIFGRTLGAGSFGVVRQARKLSTGENVAVKIL------LKKALKGKDVQLQM-------L 92

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   EK+A+R   
Sbjct: 93  YDELSILQKLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVY 152

Query: 140 QIVIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMAA-LETEDKLLETSCGSP 195
           QI+  + Y H+  IVHRDLKPENLL L  K +  + + DFG+A  L  ED+L+  + GS 
Sbjct: 153 QILKAVEYLHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSM 212

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM-- 253
            Y APE+++    HG   D+WS GV+ + LL G  PF  E  ++   L +  SGRY +  
Sbjct: 213 GYVAPEVLT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTF 269

Query: 254 --PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             P    IS DA+D I + LTV P  R  A ++L H  +
Sbjct: 270 HKPYWSSISDDAKDFILQALTVTPRYRPSATELLNHKWI 308

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  172 bits (435), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 149/294 (50%), Gaps = 28/294 (9%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +G +K+ + +G GS GKV LA    T+++  +K                     T D   
Sbjct: 38  VGNYKILKQVGEGSFGKVYLALHRPTHRKVCLK---------------------TSDKND 76

Query: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIR 136
             I RE+   +  + P + +LY+V  T + ++M LEY    EL++ L+    +   E   
Sbjct: 77  PNIVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAE 136

Query: 137 FFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 196
            F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 197 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGD 256
           Y APE++    Y GF  D+WS GVIL+ L+TG LPFDD+D  ++     V     E P  
Sbjct: 197 YMAPELIERRTYDGFKIDIWSLGVILYTLITGSLPFDDDD-EVKTKWKIVN----EEPNY 251

Query: 257 DE--ISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPRE 308
           D   I  DA+DLI+R+L  +P++R     +L H  LQ Y S+   ++ + L R+
Sbjct: 252 DSTLIPDDAKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQ 305

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  171 bits (434), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 100/282 (35%), Positives = 145/282 (51%), Gaps = 26/282 (9%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSL 75
           ++G +K+ + +G GS GKV LA    T+++  +K                     T D  
Sbjct: 37  EVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK---------------------TSDKN 75

Query: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135
              I RE+   +  + P + +LY+V  T S ++M LEY    EL++ L+    L   E  
Sbjct: 76  DPNIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECG 135

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
             F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+ 
Sbjct: 136 ELFAQISGAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTT 195

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
            Y APE++    Y GF  D+WS GVIL+ L+TG LPFDD+D       +  +  +Y    
Sbjct: 196 VYMAPELIERKTYDGFKIDIWSLGVILYTLITGYLPFDDDDEVKTKWKIVNEEPKY---- 251

Query: 256 DDEISP-DAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
           D +  P DA+DLI+R+L  +P +R     +L+HP LQ Y S+
Sbjct: 252 DSKFIPDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  171 bits (433), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 96/278 (34%), Positives = 145/278 (52%), Gaps = 24/278 (8%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSL 75
           ++G +K+ + +G GS GKV LA    T+++  +K  SK   NV                 
Sbjct: 33  EVGNYKILKQVGEGSFGKVYLAIHRPTHRKVVLKSSSKTDPNVV---------------- 76

Query: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135
                RE+   +  +HP + +LY++  T + ++M LEY    EL++ L+    +P  E  
Sbjct: 77  -----REVFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECS 131

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
           R F QIV  + Y H+L  VHRDLK EN+LLD + N K+ADFG          LET CG+ 
Sbjct: 132 RLFAQIVGAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTT 191

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
            Y APE++    Y GF  D+WS GVIL+ L+ G +PFD+ED       +  +   Y    
Sbjct: 192 VYMAPELLRRDTYDGFKIDIWSLGVILYTLINGSMPFDEEDETRTEWKIINEEPDY---N 248

Query: 256 DDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY 293
           +   + ++ +LI  +L  DP++R    +ILKH  L+ Y
Sbjct: 249 EKIFNANSIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  170 bits (430), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/274 (33%), Positives = 146/274 (53%), Gaps = 24/274 (8%)

Query: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLP 76
           +G +++ + +G GS GKV LA    T+Q+  +K+         GS  D +V         
Sbjct: 34  VGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKM---------GSKNDPNVV-------- 76

Query: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIR 136
               RE+   +  ++  + +LY+V  T ++++M LEY    EL+  L+ +  +P  E   
Sbjct: 77  ----REVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIPLDECSH 132

Query: 137 FFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPH 196
            F QIV  + Y H++  VHRDLK EN+LLD K   K+ DFG         +LET CG+  
Sbjct: 133 LFSQIVGAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCGTTV 192

Query: 197 YAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGD 256
           Y APE++   PY G+  D WS G+IL+ ++ G +PFD+ED +I+     V +  +    D
Sbjct: 193 YMAPELIERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKTKYRIVNNEPFY--DD 249

Query: 257 DEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
           + I  + +DLI ++L  DP QR     +L+HP +
Sbjct: 250 NFIDANGKDLIMQLLQKDPSQRPSLTQVLQHPFM 283

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  160 bits (405), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 155/274 (56%), Gaps = 24/274 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG GS G V+ A   ST    A+K++      +K ++K + V           +
Sbjct: 46  YIFGKTLGAGSFGVVRQARKISTGDNVAVKIL------LKKALKGNDVQLQM-------L 92

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E++I++ LNHPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A++   
Sbjct: 93  YDELMILQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVDAVKIVV 152

Query: 140 QIVIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMAA-LETEDKLLETSCGSP 195
           QI+  + Y H+  IVHRDLKPENLL LD   N  + + DFG+A  L+ +  L+  + GS 
Sbjct: 153 QILKAVEYLHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHKAAGSM 212

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM-- 253
            Y APE+++    HG   D+WS GVI + LL G  PF  E  ++   L +  SG+Y +  
Sbjct: 213 GYVAPEVLTS-NGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSGQYPVTF 269

Query: 254 --PGDDEISPDAQDLIARILTVDPEQRIKARDIL 285
             P  + IS +A+  I R+LT+ P++R  A D+L
Sbjct: 270 HKPYWNNISKEAKLFILRVLTISPKKRPTATDLL 303

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  160 bits (405), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 152/279 (54%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           ++ G+T+G G+ G V+ A   ST ++ A+K+I K              A    D     +
Sbjct: 41  YEFGKTMGAGTFGVVRKATKISTGEEVAVKIILKK-------------ALEGNDIQLQML 87

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L HPN++     +E+   +Y+V + A  GELF+ +++RG   E +A+    
Sbjct: 88  YDELAILQQLKHPNIVEFKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVV 147

Query: 140 QIVIGISYCHALGIVHRDLKPENLLL---DHKFNIKIADFGMAA-LETEDKLLETSCGSP 195
           QI+  + Y H+  +VHRDLKPEN+L      K  I IADFG+A  LE E  L+  + GS 
Sbjct: 148 QILKAVEYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSL 207

Query: 196 HYAAPEIV--SGIPYHGFASDVWSCGVILFALLTGRLPF--DDEDGNIRNLLLQVQSGRY 251
            Y APE++  SG   HG   D+WS G+I + LL G  PF  +D DG +  ++   +   +
Sbjct: 208 GYVAPEVLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAF 264

Query: 252 EMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             P  DEIS +A+  I R +T+DP QR  A ++LK P +
Sbjct: 265 HSPYWDEISNEAKQFILRAVTIDPFQRPTATELLKDPWI 303

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  158 bits (400), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 162/279 (58%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           ++ G+TLG GS G V+ A  +S N++ AIK++      +K +++ + V           +
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKIL------LKKALEGNQVQLQM-------L 73

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I+K L+HPN++   + +ET+  +Y+V + A  GELF+ ++++G   E +A++   
Sbjct: 74  YDELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILI 133

Query: 140 QIVIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMAA-LETEDKLLETSCGSP 195
           QI+  + Y H+  IVHRDLKPENLL L  K +  + IADFG+A  L+  ++L+  + GS 
Sbjct: 134 QILSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSL 193

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM-- 253
            Y APE+++ +  HG   D+WS GVI + LL+G   F  E   +   L +  SG Y +  
Sbjct: 194 GYVAPEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAFVAE--TVEGFLDECTSGDYPVKF 250

Query: 254 --PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             P  D IS DA++ I + L ++P++R  A ++L  P +
Sbjct: 251 HKPYWDNISDDAKNFILKALDLNPQKRPTATELLDDPWI 289

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  164 bits (415), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 93/285 (32%), Positives = 151/285 (52%), Gaps = 35/285 (12%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A + +T +  A+K+I+K    V G++               G+ RE+
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINKR--KVMGNLD--------------GVTREL 249

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            +++ L+HP+++ L   +E   N YMV+E+   G+L + +   GP+ E       RQI+ 
Sbjct: 250 TVLQKLDHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILE 309

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     + T CG+  Y APE
Sbjct: 310 AVKYIHSVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPE 369

Query: 202 IVSG--------IP-----YHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQS 248
           +V+G        +P     ++    D+WS G +++ +LTG LPF       + L  Q+  
Sbjct: 370 VVNGRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPFSGS--TPQQLYEQIGK 427

Query: 249 GRY-EMP-GDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
             Y E+P  D  IS  A+D I  +L VDP  R+ A   L+HP +Q
Sbjct: 428 ASYHEVPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  157 bits (398), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 156/279 (55%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG G+ G V+ A   S+ +  A+K++      +K ++K + V           +
Sbjct: 38  YIFGKTLGAGTFGVVRQARQLSSQEDVAVKIL------LKNALKGNDVQLQM-------L 84

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++++G   E +A+    
Sbjct: 85  YDELSILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMV 144

Query: 140 QIVIGISYCHALGIVHRDLKPENLL-LD--HKFNIKIADFGMAA-LETEDKLLETSCGSP 195
           Q++  + Y H+  IVHRDLKPEN+L LD   +  + IADFG+A  L++ D L+    GS 
Sbjct: 145 QLLDAVKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSL 204

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM-- 253
            Y APE+++    HG   D+WS GVI + LL+G  PF  E  ++   L +    RY +  
Sbjct: 205 GYVAPEVLTK-EGHGKPCDIWSLGVITYTLLSGYSPFIAE--SVEGFLEECTRSRYPVQF 261

Query: 254 --PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             P  D IS +A+D I + LT+DPE+R  A +++  P +
Sbjct: 262 HKPYWDSISDEAKDFILKALTIDPEERPSAEELMNDPWI 300

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  158 bits (399), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 155/277 (55%), Gaps = 20/277 (7%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG G+ G V+ A   +T +  A+K++      +K ++K ++V           +
Sbjct: 52  YIFGKTLGAGTFGVVRQARKLTTGEDVAVKIL------LKKALKGNNVQLQM-------L 98

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++++G   E +A+    
Sbjct: 99  YDELAILQKLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIKKGKFSEVDAVSIMV 158

Query: 140 QIVIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMAA-LETEDKLLETSCGSP 195
           Q++  +SY H+  IVHRDLKPEN+L LD+  N  + IADFG+A  L++ D L+    GS 
Sbjct: 159 QLISAVSYIHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKELKSNDDLIFKGAGSL 218

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE--DGNIRNLLLQVQSGRYEM 253
            Y APE+++    HG   D+WS GVI + LL+G   F  E  +G +          ++  
Sbjct: 219 GYVAPEVLTR-EGHGKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHS 277

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
           P  D IS +A+D I R LT+DP  R  A ++L+ P +
Sbjct: 278 PYWDNISQEAKDFILRALTIDPNDRPTAEELLQDPWI 314

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  163 bits (413), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 149/278 (53%), Gaps = 30/278 (10%)

Query: 26  LGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREIII 85
           +G G+   V+ A + ST +  A+K+I K                   D    G++RE+ +
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKR---------------KVMDKFD-GVKRELDV 241

Query: 86  MKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIGI 145
           ++ LNHP +++L D +E N N YM++E+   G+L + +   G + E       RQ++  +
Sbjct: 242 LQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAV 301

Query: 146 SYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 203
            Y H  GI HRDLKP+N+++  D    IKI DFG+A ++ ++  L T CG+  Y APE++
Sbjct: 302 KYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVI 361

Query: 204 SGI--------PYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY-EMP 254
            G           +    D+WS G +++ +LTG LPF  +  N   L  Q++ G Y E P
Sbjct: 362 DGKNAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGP 419

Query: 255 -GDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
             D  IS +A++ I  +L VDP++R+ A   L+HP ++
Sbjct: 420 LKDYRISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 140/229 (61%), Gaps = 7/229 (3%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + H N+++  D +E ++N+Y++LE    G L +LL  R  L E E +RFF  Q
Sbjct: 126 EIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE-VRFFTTQ 184

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 199
           IV  + Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+   D+  + T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 200 PEIVSGIPY-HGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE+++G    H +  D+WSCGV+++ALL G+ PF  ++ NI  +  +++ G +  P D  
Sbjct: 245 PEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDKF 302

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKHPLLQK-YPSINDSKSIRNLP 306
           ISP+A  LI  IL++DP +R    +I+ +   +  +PS  D+  + + P
Sbjct: 303 ISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  157 bits (396), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 156/279 (55%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG GS G V+ A   ST +  A+K++      +K ++K + V           +
Sbjct: 38  YVFGKTLGAGSFGVVRQARRISTGENVAVKIL------LKKALKGNCVQIEM-------L 84

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN++     +E+    Y+  + A  GELF+ ++ RG   E +A+R   
Sbjct: 85  YDELSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGELFDRILARGKFTEVDAVRIIV 144

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMA-ALETEDKLLETSCGSP 195
           Q++ GI Y H+  IVHRDLKPEN+L   K +   + IADFG+A  L++ D L+  + GS 
Sbjct: 145 QLLQGIKYIHSKDIVHRDLKPENVLYIDKSDDSPLVIADFGIAKQLKSGDDLIFKAAGSL 204

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM-- 253
            Y APE+++ +  HG   D+WS GVI + LL G  PF  E  ++   L +  SG+Y +  
Sbjct: 205 GYVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECTSGKYPVKF 261

Query: 254 --PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             P  D IS +A++ I R L ++P +R  A ++L+ P +
Sbjct: 262 HRPYWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and uniprot|P27466
           Saccharomyces cerevisiae YFR014C CMK1
          Length = 427

 Score =  157 bits (396), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 94/272 (34%), Positives = 153/272 (56%), Gaps = 24/272 (8%)

Query: 22  LGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIER 81
            G+TLG G+ G V+ A   S+ +  A+K++      +K ++K  SV           +  
Sbjct: 48  FGKTLGAGTFGVVRQARCISSGENVAVKIL------LKKALKGQSVQLQM-------LYD 94

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQI 141
           E+ I++ LNHPN++R  D +E+    Y+V + A  GELF+ ++E+G   E +A+   +QI
Sbjct: 95  ELSILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQI 154

Query: 142 VIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSPHY 197
           + G+ Y H   IVHRDLKPEN+L  +K +   + I DFG+A  L+ +++L+  + GS  Y
Sbjct: 155 LQGVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGY 214

Query: 198 AAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM---- 253
            APE+++    HG   D+WS GVI + LL G  PF  E  +    + +  SG+Y +    
Sbjct: 215 VAPEVLTS-SGHGKPCDIWSIGVITYTLLCGYSPFLAESAD--GFIEECTSGQYPVVFHK 271

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDIL 285
           P  + +S  A++ I   LTV P++R  A D++
Sbjct: 272 PYWNNVSKTAKEFILWALTVSPKRRPTATDLI 303

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  163 bits (412), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 98/312 (31%), Positives = 159/312 (50%), Gaps = 38/312 (12%)

Query: 3   AMSNRSVPTVKGNKIGPWK----LGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNV 58
            +++ +  ++  NK G +K    + E +G G+   V+ A + +T +  A+K+ISK    V
Sbjct: 177 GLTSSTASSMVANKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR--KV 234

Query: 59  KGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGE 118
            G++               G+ RE+ +++ LNHP ++RL   +E   + YMV+E+   G+
Sbjct: 235 IGNMD--------------GVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGD 280

Query: 119 LFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLL--DHKFNIKIADF 176
           L + +   G + E       RQI+  I Y H++GI HRDLKP+N+L+  D    +KI DF
Sbjct: 281 LMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDF 340

Query: 177 GMAALETEDKLLETSCGSPHYAAPEIVSGIPY------------HGFASDVWSCGVILFA 224
           G+A ++     ++T CG+  Y APE++ G               +    D+WS G +++ 
Sbjct: 341 GLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYV 400

Query: 225 LLTGRLPFDDEDGNIRNLLLQVQSGRY-EMPGDD-EISPDAQDLIARILTVDPEQRIKAR 282
           +LTG LPF     +   L  Q+  G Y E P  D  IS +A+D I  +L VDP  R  A 
Sbjct: 401 ILTGHLPFSGSTQD--QLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAA 458

Query: 283 DILKHPLLQKYP 294
             L HP ++  P
Sbjct: 459 KALNHPWIKMSP 470

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  156 bits (395), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 152/275 (55%), Gaps = 24/275 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG GS G V+ A   S+ +  AIK++      +K ++K   V           +
Sbjct: 46  YIFGKTLGAGSFGVVRQARQVSSGENVAIKIL------LKKALKGKDVELQM-------L 92

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E++A+R   
Sbjct: 93  YDELSILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVY 152

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKF---NIKIADFGMAA-LETEDKLLETSCGSP 195
           QI+  + Y H+  IVHRDLKPENLL   +     + + DFG+A  L+ +D+L+  + GS 
Sbjct: 153 QILKAVEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSM 212

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGR----Y 251
            Y APE+V+    HG   D+WS GV+ + LL G  PF  E  ++   L +   GR    +
Sbjct: 213 GYVAPEVVT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTIGRTPVTF 269

Query: 252 EMPGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
             P    IS +A+D I R LTV+P  R  A ++L+
Sbjct: 270 HKPYWSNISNEAKDFILRALTVNPHDRPTATELLQ 304

>KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.374
           YFR014C
          Length = 435

 Score =  156 bits (395), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 157/285 (55%), Gaps = 20/285 (7%)

Query: 12  VKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAAST 71
           V  N    +  G+TLG G+ G V+ A   STN+  A+K++      +K +++ +SV    
Sbjct: 24  VASNAKTDYIFGKTLGAGTFGVVRQARKLSTNEDVAVKIL------LKKALEGNSVQLQM 77

Query: 72  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPE 131
                  +  E+ I++ LNHPN++   D +ET    ++V + A  GELF+ +V++G   E
Sbjct: 78  -------LYDELSILQRLNHPNIVEFKDWFETKEKFFIVTQLATGGELFDRIVKKGKFTE 130

Query: 132 KEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKL 187
           ++AI+   QI+  + Y H+  IVHRDLKPENLL   + +   + +ADFG+A  L++ D+L
Sbjct: 131 EDAIKILVQILGAVEYIHSRNIVHRDLKPENLLYIDEADTSPLVLADFGIAKELKSGDEL 190

Query: 188 LETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE--DGNIRNLLLQ 245
           +  + GS  Y APE+++    HG   D+WS GVI + LL G   F  E  +G +      
Sbjct: 191 IFKAAGSLGYVAPEVLTS-DGHGKPCDIWSIGVITYTLLCGYSAFAAESVEGFLDECTQN 249

Query: 246 VQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
            +   +  P  D +S DA+  I R LT+DP +R  A  +L+ P +
Sbjct: 250 DKPVVFHKPYWDNVSEDARKFILRALTLDPTKRPTATALLEDPWI 294

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  161 bits (408), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 130/207 (62%), Gaps = 6/207 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + HPN++   D +E ++N+Y++LE    G L +L+ +R  L E E +RFF  Q
Sbjct: 139 EIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPE-VRFFTTQ 197

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 199
           I   + Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+   ++  + T CG+P+Y A
Sbjct: 198 ICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIA 257

Query: 200 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE++ G    H F  D+WS GV+++ALL G+ PF  +D N+  +  ++++ +Y  P D  
Sbjct: 258 PEVLMGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDKY 315

Query: 259 ISPDAQDLIARILTVDPEQRIKARDIL 285
           +S +A+ LIA IL VDP +R   R+I+
Sbjct: 316 VSSEAKTLIADILCVDPVERPSIREII 342

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  161 bits (408), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 92/280 (32%), Positives = 147/280 (52%), Gaps = 31/280 (11%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A +  T +  A+K+I+K    V G++               G+ RE+
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINKR--KVMGNMD--------------GVTREL 235

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            +++ LNHP ++ L   +E   + Y+V+E+   G+L + +   G + E       RQ++ 
Sbjct: 236 EVLRRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLE 295

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            + Y HA+GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 296 AVKYIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPE 355

Query: 202 IVSGI--------PYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY-E 252
           ++SG          Y     D+WS G +++ +LTG LPF       + L  Q+ +G Y E
Sbjct: 356 VISGKNSEEKEGNKYSSLV-DMWSIGCLVYVILTGHLPF--SGSTQQELYKQISAGSYHE 412

Query: 253 MPGDD-EISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
            P  D  IS DA+D I   L V+P  R+ A   LKHP ++
Sbjct: 413 GPLKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIR 452

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  162 bits (410), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 149/288 (51%), Gaps = 38/288 (13%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A + ST +  A+K+ISK    V GS  D             G+ RE+
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKR--KVMGSNMD-------------GVSREL 250

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            +++ L+HP ++RL   +E + N YM++E+   G+L + +   G + E       RQI+ 
Sbjct: 251 EVLQRLDHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILE 310

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            I Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 311 AIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPE 370

Query: 202 IVSGI----------------PYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQ 245
           I+SG                  Y     D+WS G +++ +LTG LPF       + L  Q
Sbjct: 371 IISGKNDGELRENADANSERNEYSSLV-DMWSMGCLVYVILTGHLPF--SGSTQKQLYKQ 427

Query: 246 VQSGRY-EMPGDD-EISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
           +  G Y E P  D  IS +A+D I  +L V P  R+ A   L+HP ++
Sbjct: 428 ISRGSYHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIK 475

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  155 bits (393), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 158/303 (52%), Gaps = 28/303 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG G+ G V+ A    TN+  A+K++      +K ++K + V           +
Sbjct: 45  YVFGKTLGAGTFGVVRQARYSPTNEDVAVKIL------LKKALKGNDVQLQM-------L 91

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I+++L HPN++   D +E+    Y+V + A  GELF+ ++ +G   E++A+    
Sbjct: 92  YDELSILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITM 151

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMA-ALETEDKLLETSCGSP 195
           QI+  + Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+  D L+  + GS 
Sbjct: 152 QILSAVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSL 211

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE--DGNIRNLLLQVQSGRYEM 253
            Y APE+++    HG   D+WS GVI++ LL G   F  E  DG +           +  
Sbjct: 212 GYVAPEVLTN-NGHGKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHK 270

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK--------YPSINDSKSIRNL 305
           P  D IS +A++ I R LT+DP +R  A +++K P +          YP I     +R  
Sbjct: 271 PYWDNISDEAKNFILRALTLDPAERPTAAELMKDPWITNTRPETANIYPEIRKGFDLRKK 330

Query: 306 PRE 308
            R+
Sbjct: 331 LRD 333

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  161 bits (407), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 147/280 (52%), Gaps = 31/280 (11%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A +  T +  A+K+ISK    V G +               G+ RE+
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKR--KVVGVMD--------------GVAREL 235

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            +++ L+HP ++ L   +E   + Y+V+E+   G+L + +   G + E       RQI+ 
Sbjct: 236 EVLQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 295

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 296 AVKYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPE 355

Query: 202 IVSGI--------PYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY-E 252
           ++SG          Y     D+WS G +++ +LTG LPF     N  +L  Q+ +G Y E
Sbjct: 356 VISGKNSGEKEGNTYSSLV-DMWSIGCLVYVILTGHLPFSGSTQN--DLYKQITAGSYHE 412

Query: 253 MPGDD-EISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
            P  D  IS DA+D I   L VDP  R+ A   L+HP ++
Sbjct: 413 GPLKDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  161 bits (408), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 97/313 (30%), Positives = 158/313 (50%), Gaps = 40/313 (12%)

Query: 3   AMSNRSVPTVKGNKIGPWK----LGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNV 58
            +++ +   +   K G +K    + E +G G+   V+ A + +T +  A+K+ISK    V
Sbjct: 177 GLTSSTTSAIMARKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR--KV 234

Query: 59  KGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGE 118
            G++               G+ RE+ +++ LNHP ++RL   +E   + YMV+E+   G+
Sbjct: 235 IGNMD--------------GVTRELEVLQKLNHPRIVRLKGFYEDAESYYMVMEFVSGGD 280

Query: 119 LFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLL--DHKFNIKIADF 176
           L + +   G + E       RQI+  + Y H++GI HRDLKP+N+L+  D    +KI DF
Sbjct: 281 LMDFVAAHGAVGEDAGREISRQILAAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDF 340

Query: 177 GMAALETEDKLLETSCGSPHYAAPEIVSGI-------------PYHGFASDVWSCGVILF 223
           G+A ++     ++T CG+  Y APE++ G               Y     D+WS G +++
Sbjct: 341 GLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDSSVSPDECEERNEYSSLV-DMWSMGCLVY 399

Query: 224 ALLTGRLPFDDEDGNIRNLLLQVQSGRY-EMPGDD-EISPDAQDLIARILTVDPEQRIKA 281
            +LTG LPF     +   L  Q+  G Y E P  D  IS +A+D I  +L VDP  R+ A
Sbjct: 400 VILTGHLPFSGSTQD--QLYKQIGRGSYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTA 457

Query: 282 RDILKHPLLQKYP 294
              L HP ++  P
Sbjct: 458 AKALDHPWIKMNP 470

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  153 bits (387), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 89/279 (31%), Positives = 142/279 (50%), Gaps = 29/279 (10%)

Query: 22  LGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIER 81
           +G  LG G  GKV     + +    A+KV+ K                   D L Y +ER
Sbjct: 115 IGLKLGKGKFGKVFCVRHKESGFICALKVMQKT------------------DILQYKLER 156

Query: 82  EII----IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRF 137
           + I    I   LNHPN+ +LY  +     +Y+++EY   GEL+  L   GP     A  +
Sbjct: 157 QFIREVEIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELYKTLEIHGPFENAVATNY 216

Query: 138 FRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHY 197
             QI   I Y H   I+HRD+KPEN+L+     +K+ DFG + +  +     T CG+  Y
Sbjct: 217 VYQIASAILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSIINPKGLRRRTFCGTIDY 276

Query: 198 AAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQ-VQSGRYEMPGD 256
            +PEIV    Y     D+W+ G++ + LL G  PF++   N ++L  + ++ G    P  
Sbjct: 277 LSPEIVDYKEY-DHNVDIWALGIVAYELLVGSPPFEE---NTKDLTYERIRRGDIVFP-- 330

Query: 257 DEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPS 295
            +++P+A+D I RIL ++P++R+  ++I+ HP + KY S
Sbjct: 331 KQVTPEARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  155 bits (391), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 154/279 (55%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG GS G V+ A   ST +  A+K++      +K +++ + V           +
Sbjct: 38  YIFGKTLGAGSFGVVRQARRISTGEDVAVKIL------LKKALQGNEVHLQM-------L 84

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HP+++   D +E+    Y+V + A  GELF+ ++ RG   E +A++   
Sbjct: 85  YDELSILQRLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIY 144

Query: 140 QIVIGISYCHALGIVHRDLKPENLLL---DHKFNIKIADFGMA-ALETEDKLLETSCGSP 195
           Q++  + Y H+  +VHRDLKPEN+L        ++ IADFG+A  L+  D ++  + GS 
Sbjct: 145 QLLDAVKYIHSQNVVHRDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIFKAAGSL 204

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM-- 253
            Y APE+++ +  HG A D+WS GVI + LL+G   F  E  ++   L +  S  Y +  
Sbjct: 205 GYVAPEVLT-VNGHGKACDIWSLGVITYTLLSGYSAFIAE--SVEGFLEECTSSTYPVTF 261

Query: 254 --PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             P  D+IS +A+  I   LT++PE+R  A  +L HP +
Sbjct: 262 HRPYWDKISDEAKKFILSALTIEPEERPTAEQLLSHPWI 300

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  161 bits (407), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 96/313 (30%), Positives = 159/313 (50%), Gaps = 40/313 (12%)

Query: 3   AMSNRSVPTVKGNKIGPWK----LGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNV 58
            +++ +   +  +K G ++    + E +G G+   V+ A + +T +  A+K+ISK    V
Sbjct: 177 GLASSTASAIMTHKTGIFRDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR--KV 234

Query: 59  KGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGE 118
            G++               G+ RE+ +++ LNHP ++RL   +E   + YMV+E+   G+
Sbjct: 235 IGNMD--------------GVTRELEVLQKLNHPRIVRLKGFYEDADSYYMVMEFVSGGD 280

Query: 119 LFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLL--DHKFNIKIADF 176
           L + +   G + E       RQI+  + Y H++GI HRDLKP+N+L+  D    +KI DF
Sbjct: 281 LMDFVAAHGAVGEDAGREISRQILTAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDF 340

Query: 177 GMAALETEDKLLETSCGSPHYAAPEIVSGI-------------PYHGFASDVWSCGVILF 223
           G+A ++     ++T CG+  Y APE++ G               Y     D+WS G +++
Sbjct: 341 GLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDSSASPDEYEERNEYSSLV-DMWSMGCLVY 399

Query: 224 ALLTGRLPFDDEDGNIRNLLLQVQSGRY-EMPGDD-EISPDAQDLIARILTVDPEQRIKA 281
            +LTG LPF     +   L  Q+  G Y E P  D  IS +A+D I  +L VDP  R+ A
Sbjct: 400 VILTGHLPFSGSTQD--QLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPSNRLTA 457

Query: 282 RDILKHPLLQKYP 294
              L HP ++  P
Sbjct: 458 AKALDHPWIKMGP 470

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  160 bits (405), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 157/297 (52%), Gaps = 37/297 (12%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A + +T +  A+K+I+K    V G++               G+ RE+
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINKR--KVVGNMD--------------GVSREL 235

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            +++ LNHP ++ L   +E  +N YMV+E+   G+L + +   G + E+      RQI+ 
Sbjct: 236 EVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILE 295

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            I Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++    +++T CG+  Y APE
Sbjct: 296 AIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPE 355

Query: 202 IVSGIP-------------YHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL-QVQ 247
           ++ G                +    D+WS G ++F +LTG LPF    G+ +  L  Q++
Sbjct: 356 VIGGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF---SGSTQEQLYEQIR 412

Query: 248 SGRY-EMPGDD-EISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSI 302
            G Y E P  D  IS +A+D I  +L VD  +R+   D L HP +++  S  D+ S+
Sbjct: 413 KGSYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score =  155 bits (392), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 158/273 (57%), Gaps = 20/273 (7%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           ++ G+TLG GS G V+ A   S+N++ A+K++      +K +++++++           +
Sbjct: 31  YEFGKTLGAGSFGIVRQAKRISSNEEVAVKIL------LKQALRENAIQLRM-------L 77

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
            +E+ I+K L+H N++   + +ET+  LY+V + A  GELF+ ++  G   E +A++   
Sbjct: 78  YQELSILKKLHHRNIVEFKNWFETDDKLYIVTQLATGGELFDRIIMEGKFTEDDAVKIIV 137

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHK---FNIKIADFGMAA-LETEDKLLETSCGSP 195
           QI+  + Y H+  IVHRDLKPENLL   K     + IADFG+A  L++ ++L+  + GS 
Sbjct: 138 QILSAVEYIHSKNIVHRDLKPENLLYLTKEKDSQLVIADFGIAKELKSGEELIFKAAGSL 197

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE--DGNIRNLLLQVQSGRYEM 253
            Y APE+++ +  HG   D+WS GVI + LL G   F  E  +G +   +   Q  +++ 
Sbjct: 198 GYVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSAFKAETVEGFLDECIANDQPVQFQK 256

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILK 286
           P  D IS  A++ I + L + PEQR  A ++LK
Sbjct: 257 PYWDNISQSAKNFILKCLDLTPEQRPTATELLK 289

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  159 bits (403), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 138/229 (60%), Gaps = 7/229 (3%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + H N+++  D +E ++N+Y++LE    G L +LL  R  L E E +RFF  Q
Sbjct: 126 EIQIHKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPE-VRFFTTQ 184

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 199
           IV  + Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 200 PEIVSGIPY-HGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE+++G    H +  D+WSCGV+++ALL G+ PF  ++ NI  +  +++ G Y  P D  
Sbjct: 245 PEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDYVFPRDKC 302

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKHPLLQK-YPSINDSKSIRNLP 306
           IS +A  LI  IL++DP +R    +I+ +   +  +P   D+  + + P
Sbjct: 303 ISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGIFPPRIDASVLSSAP 351

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  160 bits (405), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/318 (30%), Positives = 162/318 (50%), Gaps = 40/318 (12%)

Query: 3   AMSNRSVPTVKGNKIGPWK----LGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNV 58
            +++ +   V  +K G +K    + E +G G+   V+ A + +T +  A+K+ISK    V
Sbjct: 177 GLTSSTPSVVAAHKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR--KV 234

Query: 59  KGSVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGE 118
            G++               G+ RE+ +++ L+HP ++RL   +E   + YMV+E+   G+
Sbjct: 235 IGNMD--------------GVTRELEVLQKLHHPRIVRLKGFYEDTESYYMVMEFVSGGD 280

Query: 119 LFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLL--DHKFNIKIADF 176
           L + +   G + E       RQI+  + Y H++GI HRDLKP+N+L+  D    +KI DF
Sbjct: 281 LMDFVAAHGAVGEDAGREISRQILEAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDF 340

Query: 177 GMAALETEDKLLETSCGSPHYAAPEIVSGI-------------PYHGFASDVWSCGVILF 223
           G+A ++     ++T CG+  Y APE++ G               Y     D+WS G +++
Sbjct: 341 GLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDSSVSPDEYEERNEYSSLV-DMWSMGCLVY 399

Query: 224 ALLTGRLPFDDEDGNIRNLLLQVQSGRY-EMPGDD-EISPDAQDLIARILTVDPEQRIKA 281
            +LTG LPF     +   L  Q+  G Y E P  D  IS +A+D I  +L VDP  R+ A
Sbjct: 400 VILTGHLPFSGSTQD--QLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTA 457

Query: 282 RDILKHPLLQKYPSINDS 299
              L HP ++  P ++ S
Sbjct: 458 AKALCHPWIKMNPLVSQS 475

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  154 bits (390), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/279 (32%), Positives = 157/279 (56%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG G+ G V+ A +  T +  A+K++      +K ++K + V           +
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKIL------IKKALKGNKVQLE-------AL 83

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E++A+R   
Sbjct: 84  YDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILV 143

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSP 195
           +I+  + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++LL    GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSL 203

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM-- 253
            Y APE+++    HG   D+WS GVI + LL G   F  E   +++ L +  +G Y +  
Sbjct: 204 GYVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEYPVKF 260

Query: 254 --PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             P  D +S  A+  I + L +DP +R  A ++L+ P +
Sbjct: 261 HRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  154 bits (388), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 89/279 (31%), Positives = 158/279 (56%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG G+ G V+ A +  T +  A+K++      +K ++K + +           +
Sbjct: 37  YVFGKTLGAGTFGVVRQARNSETGEDVAVKIL------IKKALKGNKIQLE-------AL 83

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN++   D +E+N   Y++ + A+ GELF+ ++++G   E +A+R   
Sbjct: 84  YDELDILQRLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILV 143

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSP 195
           +I+  + Y H+  IVHRDLKPENLL   K +   + IADFG+A  L+++++L+  + GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYKAAGSL 203

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM-- 253
            Y APE+++    HG   D+WS GVI + LL G   F  E   + + L +  +G+Y +  
Sbjct: 204 GYVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGKYPVTF 260

Query: 254 --PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             P  D +S  A+  I + L ++P +R  A ++L+ P +
Sbjct: 261 HRPYWDSVSDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  154 bits (388), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 153/279 (54%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G TLG GS G V+ A   STN+  AIK++      +K +++ ++V           +
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKIL------LKKALQGNNVQLQM-------L 93

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    
Sbjct: 94  YEELSILQKLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVV 153

Query: 140 QIVIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMA-ALETEDKLLETSCGSP 195
           QI+  + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ ++ L+  + GS 
Sbjct: 154 QILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSL 213

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY---- 251
            Y APE+++    HG   D+WS GVI + LL G  PF  E  ++   + +  + RY    
Sbjct: 214 GYVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVEGFMEECTAYRYPVTF 270

Query: 252 EMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
            MP  D IS DA+  I + L +DP  R  A ++L  P +
Sbjct: 271 HMPYWDSISVDAKHFILKALRLDPADRPTATELLDDPWI 309

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score =  154 bits (388), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 148/278 (53%), Gaps = 21/278 (7%)

Query: 25  TLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREII 84
           TLG GS G V+ A    +++  A+K++ K      G ++               I  E+ 
Sbjct: 70  TLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLE--------------PIYDELN 115

Query: 85  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIG 144
           I++ L+HPN+++  D +ET S  Y+V + A  GELF+ ++  G   E++A+    QI+  
Sbjct: 116 IIQHLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKA 175

Query: 145 ISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMA-ALETEDKLLETSCGSPHYAAP 200
           + Y H+  I+HRDLKPENLL   K     I +ADFG+A  LE +D ++    GS  Y AP
Sbjct: 176 VEYLHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAP 235

Query: 201 EIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE--DGNIRNLLLQVQSGRYEMPGDDE 258
           E+ +    HG  SD+WS GVI + LL G  PF  E  DG +  +       +++ P  D 
Sbjct: 236 EVFTS-DGHGKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDG 294

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
           IS  A++ I RIL +DP  R  A ++L  P +Q   S+
Sbjct: 295 ISELAKNFILRILDLDPACRPSATELLNDPWIQSKCSL 332

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  159 bits (401), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 95/297 (31%), Positives = 156/297 (52%), Gaps = 32/297 (10%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A + +T +  A+K+I+K    V G++               G+ RE+
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINKR--KVMGNLD--------------GVTREL 234

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            ++K LNHP ++ L   +E N + YMV+E+   G+L + +   G + E       RQI+ 
Sbjct: 235 EVLKRLNHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILE 294

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 295 AVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 354

Query: 202 IVSGIPYHG--------FAS--DVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY 251
           ++     +         ++S  D+WS G +++ +LTG LPF         L  Q+  G Y
Sbjct: 355 VIGSSSKYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF--SGSTQEQLYKQISRGSY 412

Query: 252 -EMPGDD-EISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLP 306
            E P  D  IS +A+D I  +L VDP  R+ A   L+HP ++     N+ +S+ + P
Sbjct: 413 HEGPLKDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIKMVSLNNEIESLGSEP 469

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  158 bits (399), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 131/209 (62%), Gaps = 6/209 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + HPN+++  D +E ++N+Y++LE    G L +LL +R  L E E +RFF  Q
Sbjct: 120 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 199
           IV  I Y H+  I+HRDLK  N+  D  FN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 200 PEIVSGIPY-HGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE+++G    H F  D+WS GV+++ALL G+ PF  ++ N   +  +++   +  P D  
Sbjct: 239 PEVLTGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFSFPKDKP 296

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKH 287
           IS +A+ LI  IL++DP +R    +I+++
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLAEIMEY 325

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  158 bits (399), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 131/209 (62%), Gaps = 6/209 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + HPN+++  D +E ++N+Y++LE    G L +LL +R  L E E +RFF  Q
Sbjct: 120 EIQIHKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 199
           IV  I Y H+  I+HRDLK  N+  D  FN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 200 PEIVSGIPY-HGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE+++G    H F  DVWS GV+++ALL G+ PF  ++ N   +  +++   +  P D  
Sbjct: 239 PEVLTGKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFNFPRDKP 296

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKH 287
           IS +A+ LI  IL++DP +R    +I+++
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLTEIMEY 325

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  153 bits (387), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 152/279 (54%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G TLG GS G V+ A   STN+  AIK++      +K +++ +++           +
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKIL------LKKALQGNNIQLQM-------L 93

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    
Sbjct: 94  YEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIV 153

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMA-ALETEDKLLETSCGSP 195
           QI+  + Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+ ++ L+  + GS 
Sbjct: 154 QILGAVEYIHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSL 213

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY---- 251
            Y APE+++    HG   D+WS GVI + LL G  PF  E  ++   + +  + RY    
Sbjct: 214 GYVAPEVLTQ-DGHGKPCDIWSVGVITYTLLCGYSPFIAE--SVEGFMEECTASRYPVTF 270

Query: 252 EMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
            MP  D IS DA+  I + L ++P  R  A ++L  P +
Sbjct: 271 HMPYWDNISVDAKRFILKALILNPADRPTATELLDDPWI 309

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  152 bits (385), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 155/279 (55%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG G+ G V+ A +  T +  A+K++      +K ++K + +           +
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKIL------IKKALKGNKIQLE-------AL 83

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R   
Sbjct: 84  YDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILV 143

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSP 195
           +I+  + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++L+    GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELIYKPAGSL 203

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSG----RY 251
            Y APE+++    HG   D+WS GVI + LL G   F  E   +++ L +  +G    R+
Sbjct: 204 GYVAPEVLTQ-DGHGKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDECTTGEYPVRF 260

Query: 252 EMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             P  D +S  A+  I + L +DP +R  A  +L+ P +
Sbjct: 261 HRPYWDSVSDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON}
           CMK2Calmodulin-dependent protein kinase; may play a role
           in stress response, many CA++/calmodulan dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk1p and mammalian Cam Kinase
           II
          Length = 447

 Score =  152 bits (385), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 152/279 (54%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G TLG GS G V+ A   STN+  AIK++      +K +++ ++V           +
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKIL------LKKALQGNNVQLQM-------L 93

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    
Sbjct: 94  YEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIV 153

Query: 140 QIVIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMA-ALETEDKLLETSCGSP 195
           QI+  + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ E+ L+  + GS 
Sbjct: 154 QILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSL 213

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY---- 251
            Y APE+++    HG   D+WS GVI + LL G  PF  E  ++   + +  + RY    
Sbjct: 214 GYVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVEGFMEECTASRYPVTF 270

Query: 252 EMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
            MP  D IS D +  I + L ++P  R  A ++L  P +
Sbjct: 271 HMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWI 309

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  151 bits (382), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 152/287 (52%), Gaps = 28/287 (9%)

Query: 11  TVKGNKIG--PWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVA 68
           TV   K G   +++  TLG GS G+V L       +  AIKV+ K     +  +K   + 
Sbjct: 82  TVTKGKYGLQDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKK-----QQIIKMKQIE 136

Query: 69  ASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGP 128
            +         ER +  +KL+ HP ++RL+  ++ + NL+MV++Y + GELF+LL +   
Sbjct: 137 HTND-------ERRM--LKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSLLRKSQR 187

Query: 129 LPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLL 188
            P   A  +  ++V+ + Y HA  I++RDLKPEN+LLD   +IK+ADFG A  +    + 
Sbjct: 188 FPNPVAKFYAAEVVLALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFA--KEVSSVT 245

Query: 189 ETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQS 248
            T CG+P Y APE+++  PY+  + D WS GV+++ +L G  PF   D        ++  
Sbjct: 246 WTLCGTPDYIAPEVIATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDVTPMKTYEKILQ 302

Query: 249 GRYEMPGDDEISPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
           G+   P      PD  DL+ R++T D  +R+      +RD+  HP  
Sbjct: 303 GKINFP--QGFHPDVIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWF 347

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score =  158 bits (399), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 149/282 (52%), Gaps = 33/282 (11%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A + ST +  A+K+I+K    V G++               G+ RE+
Sbjct: 201 EVVGQGAFATVKKAVERSTGRTFAVKIINKR--KVMGNLS--------------GVTREL 244

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            I++ L+HP ++RL   +E   + Y+V+E+   G+L + +   G + E       RQI+ 
Sbjct: 245 EILRKLDHPRIVRLKGFYEDEESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 304

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            ++Y H  GI HRD+KP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 305 AVAYMHEKGISHRDIKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 364

Query: 202 IVSG----------IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY 251
           ++SG          I Y     D+WS G +++ +LT  LPF       + L  Q+  G Y
Sbjct: 365 VISGKNAATENDDRIEYSSLV-DMWSIGCLVYVILTAHLPFSGSTQ--QELYEQINRGSY 421

Query: 252 -EMPGDD-EISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
            E P  D  +S +A+D I  ++ VDP  R+ A+D LKH  ++
Sbjct: 422 HEGPLKDYRVSEEARDFIESLIQVDPNNRLTAKDALKHEWIK 463

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  152 bits (383), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 154/279 (55%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG G+ G V+ A +  T +  A+K++      +K ++K + +           +
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKIL------IKKALKGNKIQLE-------AL 83

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R   
Sbjct: 84  YDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILV 143

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSP 195
           +I+  + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++L+    GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKPAGSL 203

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSG----RY 251
            Y APE+++    HG   D+WS GVI + LL G   F  E   +++ L +  +G    R+
Sbjct: 204 GYVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVRF 260

Query: 252 EMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             P  D +S  A+  I + L +DP +R  A  +L  P +
Sbjct: 261 HRPYWDSVSGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score =  152 bits (383), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/279 (32%), Positives = 155/279 (55%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG G+ G V+ A   ST +  A+K++      +K ++K + V           +
Sbjct: 40  YVFGKTLGAGTFGVVRQARKISTRENVAVKIL------LKKALKGNDVQLQL-------L 86

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++ +G   E +A++   
Sbjct: 87  YDELKILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILSKGKFTEIDAVKIVT 146

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSP 195
           QI+  + Y H+  IVHRDLKPEN+L     +   + +ADFG+A  L++ D+L+  + GS 
Sbjct: 147 QILSAVQYIHSKNIVHRDLKPENILYIDPSDDSPLVLADFGIAKELKSGDELIFKAAGSL 206

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSG----RY 251
            Y APE+++    HG   D+WS GV+ + LL+G  PF  E  ++   L +   G    ++
Sbjct: 207 GYVAPEVLT-TSGHGKPCDIWSLGVVTYTLLSGYSPFIAE--SVEGFLEECTEGSKPVKF 263

Query: 252 EMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             P  D IS DA++ I R L + P +R  A ++L+ P +
Sbjct: 264 HKPYWDGISDDAKNFILRALVLSPSKRPTATELLEDPWI 302

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  151 bits (382), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 154/279 (55%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G TLG GS G V+ A   STN+  AIK++      +K +++ ++V           +
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKIL------LKKALQGNNVQLQM-------L 93

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    
Sbjct: 94  YEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVV 153

Query: 140 QIVIGISYCHALGIVHRDLKPENLL-LDHKFN--IKIADFGMA-ALETEDKLLETSCGSP 195
           QI+  + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ ++ L+  + GS 
Sbjct: 154 QILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSL 213

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY---- 251
            Y APE+++    HG   D+WS GVI + LL G  PF  E  ++   + +  + RY    
Sbjct: 214 GYVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVEGFMEECTASRYPVTF 270

Query: 252 EMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
            +P  D IS DA+  I + L ++P +R  A ++L  P +
Sbjct: 271 HIPYWDNISIDAKRFILKALRLNPTERPTATELLDDPWI 309

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score =  156 bits (394), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 89/283 (31%), Positives = 151/283 (53%), Gaps = 35/283 (12%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A +  T +  A+K+ISK    V G++               G+ RE+
Sbjct: 192 EVVGQGAFAIVKKAVERKTGKTFAVKIISKR--KVMGNID--------------GVTREL 235

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            +++ LNHP ++RL   +E + + Y+++E+   G+L + +   G + E       +Q++ 
Sbjct: 236 EVLRRLNHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITKQVLE 295

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            + Y H +GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 296 AVKYIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGTFMKTFCGTLAYVAPE 355

Query: 202 IVSGI----------PYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL-QVQSGR 250
           ++SG            Y     D+WS G +++ +LTG LPF    G+ ++ L  Q+  G 
Sbjct: 356 VISGKNSEDKSQNKNKYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQDQLYKQISRGS 411

Query: 251 Y-EMPGDD-EISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
           Y E P  D  IS +A++ I  +L V+P+ R+ A   L HP ++
Sbjct: 412 YHEGPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL016C (CMK2) and
           YFR014C (CMK1)
          Length = 453

 Score =  151 bits (381), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 92/274 (33%), Positives = 153/274 (55%), Gaps = 26/274 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG G+ G V+ A +   NQ  AIK++      +K ++K + +           +
Sbjct: 56  YIFGKTLGAGAFGVVRQARNSKQNQNVAIKIL------LKRALKGNELQM---------L 100

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A++   
Sbjct: 101 YDELSILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVV 160

Query: 140 QIVIGISYCHALGIVHRDLKPENLL-LD--HKFNIKIADFGMA-ALETEDKLLETSCGSP 195
           Q++  + Y H+  +VHRDLKPEN+L LD   +  + I+DFG+A  L +E +L+  + GS 
Sbjct: 161 QMLTAVEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSM 220

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSG----RY 251
            Y APE+++    HG   D+WS GVI + LL G  PF  E  +    L +V SG     +
Sbjct: 221 GYVAPEVLT-TSGHGKPCDIWSLGVITYTLLCGYSPFIAE--STEGFLEEVFSGSDPVTF 277

Query: 252 EMPGDDEISPDAQDLIARILTVDPEQRIKARDIL 285
             P  + IS +A+  I R LT+ P +R  A ++L
Sbjct: 278 HSPYWNNISKEAKQFILRALTLTPARRPTAAELL 311

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  152 bits (384), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 101/314 (32%), Positives = 157/314 (50%), Gaps = 46/314 (14%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           + LG+ LG G    V+ A +++T +  A+K+      + +   K                
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFR------------- 239

Query: 80  EREIIIMKLLNHPNVLRLYD-----VWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEA 134
           E   I+MK+ +HPN++ L D     + +T    Y+VLE    GELF+ +V++  LP++E+
Sbjct: 240 EETTILMKI-HHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEES 298

Query: 135 IRFFRQIVIGISYCHALGIVHRDLKPENLLLDHK-------------------FNIKIAD 175
              F+QI+ G+ Y H+  I+HRD+KPEN+LL+ +                     +KIAD
Sbjct: 299 KAIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIAD 358

Query: 176 FGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFAS--DVWSCGVILFALLTGRLPFD 233
           FG+A    E +   T CG+P Y APE++      G+ S  D+WS GVIL+  L G  PF 
Sbjct: 359 FGLAKFTGEMQFTNTLCGTPSYVAPEVLVK---KGYTSKVDLWSAGVILYVCLCGFPPFS 415

Query: 234 DEDGNIRNLLLQVQSGRYEM--PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
           D+ G   +L  Q+ S +Y    P  DEI   A  LI+ +L +DPE R        HP L 
Sbjct: 416 DQLGP-PSLKEQIMSAKYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPWLD 474

Query: 292 KYPSINDSKSIRNL 305
               ++ S +++ L
Sbjct: 475 SVSHLDVSHNLKRL 488

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score =  155 bits (393), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 149/282 (52%), Gaps = 33/282 (11%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A + ST +  A K+ISK    V G++               G+ RE+
Sbjct: 197 EVVGQGAFATVKKAVERSTGKTFAAKIISKR--KVMGNMD--------------GVTREL 240

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            +++ LNHP ++RL   +E +   Y+++E+   G+L + +   G + E       RQ++ 
Sbjct: 241 EVLRKLNHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLE 300

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
           G+ Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 301 GVKYIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 360

Query: 202 IVSGIP----------YHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY 251
           +++G            Y     D+WS G +++ +LTG LPF         L  Q+++G Y
Sbjct: 361 VIAGKANAEENEKRNEYSSLV-DMWSMGCLVYVILTGHLPFSGS--TQEQLYKQIKNGSY 417

Query: 252 -EMPGDD-EISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
            E P  D  IS +A+D I  +L V+P  R  A+  L+HP ++
Sbjct: 418 HEGPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  155 bits (392), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 82/207 (39%), Positives = 128/207 (61%), Gaps = 6/207 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + H N+++  D +E ++N+Y++LE    G L +LL +R  L E E +RFF  Q
Sbjct: 142 EIQIHKSMKHSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 200

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 199
           I   I Y H+  I+HRDLK  N+  D  +N+K+ DFG+AA+   D+  + T CG+P+Y A
Sbjct: 201 ICGAIKYLHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 260

Query: 200 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE++ G    H F  D+WS GV+++ALL G+ PF  +D N+  +  +++  +Y  P D  
Sbjct: 261 PEVLMGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYERIKLCKYGYPKDKY 318

Query: 259 ISPDAQDLIARILTVDPEQRIKARDIL 285
           +S +A+ LI  IL+++P QR    DI+
Sbjct: 319 VSKEAEILIHDILSLNPLQRPTIIDII 345

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  154 bits (390), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 83/231 (35%), Positives = 136/231 (58%), Gaps = 5/231 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQI 141
           EI I K + HPN+++  D +E ++N+Y++LE    G L +LL +R  L E E   F  QI
Sbjct: 124 EIQIHKSMKHPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKVLTEPEVRYFTTQI 183

Query: 142 VIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 200
           V  I Y H   ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 184 VGAIKYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 243

Query: 201 EIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           E+++G    H +  D+WS GV+++ALL G+ PF  ++ NI  +  +++SG Y  P +   
Sbjct: 244 EVLAGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNI--IYERIKSGDYIFPREKPT 301

Query: 260 SPDAQDLIARILTVDPEQRIKARDILKHPLLQK-YPSINDSKSIRNLPRED 309
           S +   LI  IL++DP +R    +I+ +   +  +P+  +   + ++P  D
Sbjct: 302 SKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSVPVYD 352

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  154 bits (390), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 86/235 (36%), Positives = 139/235 (59%), Gaps = 7/235 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + + N+++  D +E ++N+Y++LE    G L +LL +R  L E E +RFF  Q
Sbjct: 130 EIQIHKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 188

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 199
           I   I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 189 ICGAIKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 248

Query: 200 PEIVSGIPY-HGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE++ G    H +  D+WS GV+L+ALL G+ PF  +D N   +  +++   +  P D  
Sbjct: 249 PEVLMGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFTFPKDKY 306

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKHPLLQK-YPSINDSKSIRNLPREDTYL 312
           ISP+A+ LI  +L++DP +R    +I+ +   +  +P   +S  + N+P  D  L
Sbjct: 307 ISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQL 361

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  148 bits (374), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 120/214 (56%), Gaps = 5/214 (2%)

Query: 79  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFF 138
             RE+ I   L HPN+ RLY  +     +Y+++EY   GEL+  L   GP  +  A  F 
Sbjct: 168 FRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFV 227

Query: 139 RQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYA 198
            Q+   ++Y H+  I+HRD+KPEN+LL  +  +K+ DFG +     +   +T CG+  Y 
Sbjct: 228 HQMADALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLCGTMDYL 287

Query: 199 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           +PE++    Y     DVW+ GV+ + LL G  PF+++   +    +  +  R+     D+
Sbjct: 288 SPELIKSREYDN-KVDVWALGVLTYELLVGSPPFEEDTKELTYKRIIKRDLRFP----DQ 342

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
           +SP A+DLI+R+L  DP+ RI  +D+ +HP ++K
Sbjct: 343 VSPHARDLISRLLEYDPQNRIPLKDVKRHPWIKK 376

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  155 bits (392), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 116/189 (61%), Gaps = 4/189 (2%)

Query: 104 NSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENL 163
           +++ YM+ EY   G+L + +++ G L E+ A +F R I   + Y H   IVHRDLK EN+
Sbjct: 5   SNHFYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENI 64

Query: 164 LLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILF 223
           ++     IKI DFG++ +    K L T CGS ++AAPE++   PY G   DVWS GV+LF
Sbjct: 65  MISTSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLF 124

Query: 224 ALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARD 283
            L+ G++PFDDE+ ++  L  +++ G+ E P    +S +   L++++L VDP +R   + 
Sbjct: 125 VLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPTKRASLKQ 180

Query: 284 ILKHPLLQK 292
           ++ H  +Q+
Sbjct: 181 VVNHQWMQR 189

>ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and to YFR014C
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
           Calmodulin-dependent protein kinase
          Length = 471

 Score =  150 bits (379), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 151/279 (54%), Gaps = 24/279 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G TLG G+ G V+ A   ST Q  A+K++      +K ++K + V           +
Sbjct: 59  YVFGRTLGAGTFGIVRQARRYSTKQNVAVKIL------LKKALKGNDVQLQM-------L 105

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L HPN++R  D +E+    Y+V + A  GELF+ ++ +G   E++A++   
Sbjct: 106 YDELSILQKLRHPNIVRFEDWFESKDKFYIVTQLATGGELFDRIIAKGHFTEEDAVKIVV 165

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMAA-LETEDKLLETSCGSP 195
           Q++  + Y H+  IVHRDLKPEN+L     +   + IADFG+A  L   D+L+  + GS 
Sbjct: 166 QMLNAVEYMHSENIVHRDLKPENILYIDPSDDSPLVIADFGIAKELHNNDELIFKAAGSL 225

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
            Y APE+++    HG   D+WS GVI + LL G  PF  E  ++   L +V   RY +  
Sbjct: 226 GYVAPEVLT-TNGHGKPCDIWSLGVITYTLLCGYSPFVAE--SVEGFLEEVAKDRYPVKF 282

Query: 256 DDE----ISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
            ++    IS +A+  I R L ++P+ R  A ++L  P +
Sbjct: 283 HEQYWSKISTEARRFILRALEINPQYRPTASELLCDPWI 321

>SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 418

 Score =  149 bits (375), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 98/317 (30%), Positives = 165/317 (52%), Gaps = 42/317 (13%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  A+KV+ K     +  VK   V  +         
Sbjct: 108 FQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKK-----RTIVKLKQVEHTND------- 155

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  + +++HP  +R++  ++    ++M+++Y + GELF+LL +    P   A  +  
Sbjct: 156 ERRM--LSVVSHPFTIRMWGTFQDAQQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAA 213

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++ + + Y H++ I++RDLKPEN+LLD   +IK+ DFG A    +  +  T CG+P Y A
Sbjct: 214 EVCLALEYLHSMDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTYTLCGTPDYIA 271

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDG-----NIRNLLLQVQSGRYEMP 254
           PE+VS  PY+  + D WS G+++F +L G  PF D +      NI N  LQ  S      
Sbjct: 272 PEVVSTKPYNK-SVDWWSFGILIFEMLAGYTPFYDSNTMKTYENILNAELQFPS------ 324

Query: 255 GDDEISPDAQDLIARILTVDPEQRI-----KARDILKHPLLQKYPSINDSKSIRNLPRED 309
                 PDAQDL+ R++T D  +R+      + D+ +HP   +   + D    RN+  E 
Sbjct: 325 ---IFHPDAQDLLCRLITRDLSKRLGNLQNGSEDVKRHPWFSE--VVWDKLLCRNI--ET 377

Query: 310 TYLHPL--SEGESAEID 324
            Y  P+   +G++++ D
Sbjct: 378 PYEPPIQPGQGDTSQFD 394

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  154 bits (388), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 137/241 (56%), Gaps = 13/241 (5%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + HPN+++  D +E +SN+Y++LE    G L  LL  R  L E E +RFF  Q
Sbjct: 129 EIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLLETSCGSPHYAA 199
           I   I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 200 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE++ G    H F  D+WS GV+L+ALL G+ PF   D N   +  +++   +  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKHPLLQKY--PSI-----NDSKSIRNLPREDTY 311
           IS + + LI  IL++DP +R    +I+ +   +    PSI     +++ +  N+P E + 
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEASNFDNIPEEQSL 365

Query: 312 L 312
           +
Sbjct: 366 I 366

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  147 bits (370), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 144/271 (53%), Gaps = 26/271 (9%)

Query: 25  TLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREII 84
           TLG GS G+V L       +  AIKV+ K        V        T D      ER + 
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKE------QVIRMKQIEHTND------ERRM- 94

Query: 85  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIG 144
            +KL++HP ++R++  ++ + NL+MV++Y + GELF+LL +    P   A  +  ++++ 
Sbjct: 95  -LKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA 153

Query: 145 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 204
           + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG+P Y APE+++
Sbjct: 154 LEYLHAHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIA 211

Query: 205 GIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQ 264
             PY+  + D WS G+++F +L G  PF   D        ++  G+   P      PD  
Sbjct: 212 TKPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVV 266

Query: 265 DLIARILTVDPEQRI-----KARDILKHPLL 290
           DL+++++T D  +R+       +D+  HP  
Sbjct: 267 DLLSKLITADLTRRLGNLQSGPQDVKSHPWF 297

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 124/209 (59%), Gaps = 6/209 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K ++HPN+++  D +E +SN+Y++LE    G L  LL  R  L E E +RFF  Q
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLLETSCGSPHYAA 199
           I   I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 200 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE++ G    H F  D+WS GV+L+ALL G+ PF   D N   +  +++   +  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKH 287
           IS + + LI  IL++DP +R    +I+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score =  149 bits (375), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 154/278 (55%), Gaps = 20/278 (7%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG GS G V+ A   ST++  A+K+I      +K ++K + V           +
Sbjct: 47  YVFGKTLGAGSFGVVRQAKKLSTDENVAVKII------LKKALKGNDVQLQM-------L 93

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ +++RG   E +A++   
Sbjct: 94  YDELSILQRLHHPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFTEVDAVKIII 153

Query: 140 QIVIGISYCHALGIVHRDLKPENLLL---DHKFNIKIADFGMAA-LETEDKLLETSCGSP 195
           Q++  I Y H+  IVHRDLKPEN+L         + IADFG+A  L+  D L+  + GS 
Sbjct: 154 QMLKAIEYIHSQNIVHRDLKPENVLYIDPSDDSQLVIADFGIAKELKDGDDLIFKAAGSL 213

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE--DGNIRNLLLQVQSGRYEM 253
            Y APE+++    HG   D+WS GVI + LL G   F  E  +G +      +   ++  
Sbjct: 214 GYVAPEVLT-TNGHGKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTSNIYPVKFHE 272

Query: 254 PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
           P  + +S +A++ I + LT++P++R  A ++L  P ++
Sbjct: 273 PYWNNVSREAKEFILKALTLNPDERPTATELLNDPWIK 310

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score =  149 bits (376), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 116/393 (29%), Positives = 198/393 (50%), Gaps = 52/393 (13%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +  G+TLG G+ G V+ A + + ++  A+K++ K    +KG            D L   +
Sbjct: 54  YIFGKTLGAGAFGVVRQARNSNNDEDVAVKILLKRA--LKG------------DELNM-L 98

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
             E++I++ L+HP++++  D +E+    Y+V + A  GELF+ ++++G   E +A++   
Sbjct: 99  YDELMILQKLDHPHIVKFKDWFESKDKFYIVTQLATGGELFDRILKKGRFTETDAVKIVV 158

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMA-ALETEDKLLETSCGSP 195
           Q++  I Y H+  +VHRDLKPEN+L  +  +   + I+DFG+A  L +ED L+  + GS 
Sbjct: 159 QMLEAIEYMHSKNVVHRDLKPENVLYLNPSDDSELVISDFGIAKQLSSEDHLIHRAAGSM 218

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEM-- 253
            Y APE+++    HG   D+WS GVI + LL G  PF  E       L +V   +Y +  
Sbjct: 219 GYVAPEVLT-TSGHGKPCDIWSLGVITYTLLCGYSPFVAESS--EGFLEEVTRSKYPVTF 275

Query: 254 --PGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTY 311
             P  + IS +A++ I + LT+DP +R  A ++L+           D+  I      +  
Sbjct: 276 HKPYWNSISVEAKEFILKALTLDPSERPTATELLQ-----------DTWIISKQQNTEDL 324

Query: 312 LHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFKSDT-E 370
           L  + EG +A        ++V+L + R     I KLR+        LY + D F +D  E
Sbjct: 325 LPTIREGFNASRKFREAMHIVIL-NNR-----IKKLRQ--------LYGVDDEFDTDLEE 370

Query: 371 NDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQT 403
           NDS    +    V  +    +  + K+P+   T
Sbjct: 371 NDSSSSERKSLGVESLQSTLRSLSLKSPTDQST 403

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 126/208 (60%), Gaps = 4/208 (1%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQI 141
           EI I K ++H N+++  D +E N N+Y++LE    G L  L+ +R  + E E   F  QI
Sbjct: 128 EIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQI 187

Query: 142 VIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 200
             GI Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 188 CGGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAP 247

Query: 201 EIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           E++ G    H +  D+WS GV+L+ALL G+ PF  +D N   +  +++   +  P D +I
Sbjct: 248 EVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVN--TIYERIKQRNFAYPKDKKI 305

Query: 260 SPDAQDLIARILTVDPEQRIKARDILKH 287
           S DA+ LI  IL+++P +R   ++I+ +
Sbjct: 306 SQDAKYLIDDILSLNPMERPSIQEIMDY 333

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 135/237 (56%), Gaps = 7/237 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + H N+++  D +E + N+Y++L     G L  LL +R  L E E +RFF  Q
Sbjct: 189 EIQIHKSMKHQNIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILTEPE-VRFFTVQ 247

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 199
           I   I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 248 ICGAIKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 307

Query: 200 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE++ G    H +  D+WS GV++FALL G+ PF  +D N   +  ++++  Y  P +  
Sbjct: 308 PEVLLGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVN--TIYSRIKNSEYTFPINKS 365

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKHPLLQ-KYPSINDSKSIRNLPREDTYLHP 314
           IS +A+ LI  IL  DP  R    +I+++   +  +PS+  +     +P  D +L P
Sbjct: 366 ISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYDQFLTP 422

>NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {ON}
           Anc_8.676
          Length = 799

 Score =  154 bits (388), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 147/280 (52%), Gaps = 31/280 (11%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A + ST +  A+K+ISK    V G+++              G+ RE+
Sbjct: 199 EVVGQGAFATVKKAVERSTGKTFAVKIISKR--KVMGNME--------------GVSREL 242

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            +++ L+HP ++RL   +E   + YMV+E+   G+L + +   G + E+      RQI+ 
Sbjct: 243 EVLQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILE 302

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            + Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 303 AVKYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPE 362

Query: 202 IVSGI--------PYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY-E 252
           ++ G          Y     D+WS G +++ +LTG LPF         L  Q+  G Y E
Sbjct: 363 VIGGKGETNEERNEYSSLV-DMWSMGCLVYVILTGHLPFSGSTQ--EQLYKQISRGSYHE 419

Query: 253 MPGDD-EISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
            P  D  IS +A+  I  +L V+P  R+ A   L+HP ++
Sbjct: 420 GPLKDFRISDEARSFIDSLLQVNPGNRLTAARALEHPWIK 459

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  153 bits (386), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 124/209 (59%), Gaps = 6/209 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K ++HPN+++  D +E +SN+Y++LE    G L  LL  R  L E E +RFF  Q
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLLETSCGSPHYAA 199
           I   I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 200 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE++ G    H F  D+WS GV+L+ALL G+ PF   D N   +  +++   +  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPRDKP 305

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKH 287
           IS + + LI  IL++DP +R    +I+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {ON}
           Anc_1.182 YJL164C
          Length = 424

 Score =  148 bits (373), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/315 (29%), Positives = 164/315 (52%), Gaps = 30/315 (9%)

Query: 10  PTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAA 69
           PT     +  +++  TLG GS G+V L       +  A+K++ K +      VK   V  
Sbjct: 104 PTSGKYSLKDFQILRTLGTGSFGRVHLIRSNHNGRFYALKILKKRLI-----VKLKQVEH 158

Query: 70  STPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPL 129
           +  + L         ++ L++HP ++R++  ++ + +LYMV++Y + GELF+LL +    
Sbjct: 159 TNDERL---------MLSLVSHPFIVRMWGTFQDSVHLYMVMDYVEGGELFSLLRKSQRF 209

Query: 130 PEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE 189
           P   A  +  ++ + + Y H+  I++RDLKPEN+LLD   +IK+ DFG A    +  +  
Sbjct: 210 PNPVAKFYAAEVCLSLEYLHSKDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTY 267

Query: 190 TSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSG 249
           T CG+P Y APE+VS  PY+  + D WS G++++ +L G  PF   D N       + + 
Sbjct: 268 TLCGTPDYIAPEVVSTKPYNK-SVDWWSFGILIYEMLAGHTPF--YDSNTVKTYENILNA 324

Query: 250 RYEMPGDDEISPDAQDLIARILTVDPEQRI-----KARDILKHPLLQKYPSINDSKSIRN 304
           + + P      PD +DL+++++T D   R+      + D+ +HP   +   I D    +N
Sbjct: 325 KLKFPA--FFHPDVRDLLSQLITKDLSNRLGNLQNGSEDVKRHPWFSE--VIWDKLLSKN 380

Query: 305 LPREDTYLHPLSEGE 319
           +  E  Y  P+ +G+
Sbjct: 381 I--ETPYEPPIQQGQ 393

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score =  147 bits (370), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 147/276 (53%), Gaps = 26/276 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  AIKV+ K     +  VK   V  +         
Sbjct: 72  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKK-----QQVVKMKQVEHTND------- 119

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  +KL+ HP ++R++  ++   N++MV++Y + GELF+LL +    P   A  +  
Sbjct: 120 ERRM--LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAA 177

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++++ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y A
Sbjct: 178 EVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIA 235

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           PE+++  PY+  + D WS GV+++ +L G  PF   D        ++  G+   P     
Sbjct: 236 PEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP--PYF 290

Query: 260 SPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
            PD  DL+++++T D  +RI      +RDI  HP  
Sbjct: 291 HPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 326

>Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa]
           {ON} complement(126043..127197) [1155 nt, 385 aa]
          Length = 384

 Score =  147 bits (370), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 92/274 (33%), Positives = 148/274 (54%), Gaps = 28/274 (10%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKA-IFNVKGSVKDSSVAASTPDSLPYG 78
           +++  TLG GS G+V L       +  AIKV+ K  IF +K           T D     
Sbjct: 74  FQIMRTLGTGSFGRVHLVRSVHNKRYYAIKVLKKQQIFKMKQ-------IEHTND----- 121

Query: 79  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFF 138
            ER+I  +K++ HP ++R++  ++ + NL+MV++Y + GELF+LL +    P   A  + 
Sbjct: 122 -ERKI--LKIVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYA 178

Query: 139 RQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYA 198
            ++++ + Y H+  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y 
Sbjct: 179 AEVILALDYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVSTVTWTLCGTPDYI 236

Query: 199 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           APE+++  PY+  + D WS G++++ +L G  PF   D        ++  G+   P    
Sbjct: 237 APEVIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGKVNYPS--F 291

Query: 259 ISPDAQDLIARILTVDPEQRI-----KARDILKH 287
             PD  DL+AR++T D  +R+      A DI  H
Sbjct: 292 FHPDVIDLLARLITADLTRRLGNLQSGAEDIKSH 325

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score =  146 bits (369), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 147/276 (53%), Gaps = 26/276 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  AIKV+ K     +  VK   V  +         
Sbjct: 70  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKK-----QQVVKMKQVEHTND------- 117

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  +KL+ HP ++R++  ++   N++MV++Y + GELF+LL +    P   A  +  
Sbjct: 118 ERRM--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAA 175

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++++ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y A
Sbjct: 176 EVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIA 233

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           PE+++  PY+  + D WS GV+++ +L G  PF   D        ++  G+   P     
Sbjct: 234 PEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVVYP--PYF 288

Query: 260 SPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
            PD  DL+++++T D  +RI      +RDI  HP  
Sbjct: 289 HPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 324

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  152 bits (385), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 123/209 (58%), Gaps = 6/209 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + HPN+++  D +E +SN+Y++LE    G L  LL  R  L E E +RFF  Q
Sbjct: 129 EIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPE-VRFFTTQ 187

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLLETSCGSPHYAA 199
           I   I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 200 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE++ G    H F  D+WS GV+L+ALL G+ PF   D N   +  +++   +  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKH 287
           IS + + LI  IL++DP +R    +I+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON} 
          Length = 354

 Score =  145 bits (367), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 96/292 (32%), Positives = 152/292 (52%), Gaps = 26/292 (8%)

Query: 2   AAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGS 61
           + +  RSV +     +  +++  TLG GS G+V L       +  AIKV+ K        
Sbjct: 26  SQLPQRSVVSKGKYTLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQ------Q 79

Query: 62  VKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFN 121
           V        T D      ER +  +KL+ HP ++R++  ++ + NL+MV++Y + GELF+
Sbjct: 80  VVRMKQIEHTND------ERRM--LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFS 131

Query: 122 LLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 181
           LL +    P   A  +  ++ +G+ Y H+  I++RDLKPEN+LLD   +IKI DFG A  
Sbjct: 132 LLRKSQRFPNPVAKFYAAEVTLGLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA-- 189

Query: 182 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRN 241
           +  D +  T CG P Y APE+++  PY+  + D WS GV++F +L G  PF   D     
Sbjct: 190 KEVDTVTWTLCGPPDYIAPEVIATKPYNK-SVDWWSLGVLIFEMLAGYTPF--YDTTPMK 246

Query: 242 LLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRI-----KARDILKHP 288
              ++  G+   P      PD  DL+ +++T D  +RI      ++DI  HP
Sbjct: 247 TYEKILQGKVVYP--TFFHPDVVDLLGKLITADLTRRIGNLQSGSKDIKCHP 296

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score =  146 bits (369), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 147/276 (53%), Gaps = 26/276 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  AIKV+ K     +  VK   V  +         
Sbjct: 71  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKK-----QQVVKMKQVEHTND------- 118

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  +KL+ HP ++R++  ++   N++MV++Y + GELF+LL +    P   A  +  
Sbjct: 119 ERRM--LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAA 176

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++++ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y A
Sbjct: 177 EVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIA 234

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           PE+++  PY+  + D WS GV+++ +L G  PF   D        ++  G+   P     
Sbjct: 235 PEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP--PYF 289

Query: 260 SPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
            PD  DL+++++T D  +RI      +RDI  HP  
Sbjct: 290 HPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 325

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score =  153 bits (386), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 146/282 (51%), Gaps = 33/282 (11%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A + ST +  A+K+I+K    V G++               G+ RE+
Sbjct: 197 EVVGQGAFAIVKKAVERSTGKTFAVKIINKR--KVMGNMD--------------GVTREL 240

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            +++ L+HP ++RL   +E   + Y+++E+   G+L + +   G + E       RQI+ 
Sbjct: 241 DVLRKLDHPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 300

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            + Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 301 AVKYIHLQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 360

Query: 202 IVSG----------IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY 251
           ++ G          I Y     D+WS G +++ +LTG LPF     +   L  Q+  G Y
Sbjct: 361 VIGGKNSAEENEDRIEYSSLV-DMWSIGCLVYVILTGHLPFSGSTQD--QLYKQICRGSY 417

Query: 252 -EMPGDD-EISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
            E P  D  IS +A+D I  +L V P +R+ A   L HP ++
Sbjct: 418 HEGPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 146/276 (52%), Gaps = 26/276 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  AIKV+ K        V        T D      
Sbjct: 84  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKT------QVVRMKQIEHTND------ 131

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  +KL+ HP ++R++  ++   NL+MV++Y + GELF+LL +    P   A  +  
Sbjct: 132 ERRM--LKLVEHPFLIRMWGTFQDAHNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAA 189

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++V+ + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+P Y A
Sbjct: 190 EVVLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVES-VTWTLCGTPDYIA 247

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           PE+++  PY+  + D WS G+++F +L G  PF   D        ++  G+   P     
Sbjct: 248 PEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDSTPMKTYEKILQGKVIYP--PFF 302

Query: 260 SPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
            PD  DL+++++T D  +RI      ++DI +HP  
Sbjct: 303 HPDVVDLLSKLITADLTRRIGNLQSGSQDIKQHPWF 338

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  153 bits (386), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 148/286 (51%), Gaps = 31/286 (10%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A + +T +  A+K+I+K    V G+V               G+ RE+
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINKR--KVMGNVD--------------GVTREL 264

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            +++ LNHP ++ L   +E + + Y+++E+   G+L + +   G + E       RQI+ 
Sbjct: 265 EVLRRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 324

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            + Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 325 AVRYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPE 384

Query: 202 IVSGIPYHGFAS---------DVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY- 251
           ++ G    G  +         D+WS G +++ +LTG LPF         L  Q+ +G Y 
Sbjct: 385 VIGGKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPFSGSTQ--EQLYKQIANGSYH 442

Query: 252 EMPGDDE-ISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSI 296
           E P  D  IS +A+D I  +L ++P  R+ A   L+HP L    SI
Sbjct: 443 EGPLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSI 488

>Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {ON}
           YPL203W (TPK2) - cAMP-dependent protein kinase catalytic
           subunit [contig 166] FULL
          Length = 353

 Score =  145 bits (366), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 89/271 (32%), Positives = 143/271 (52%), Gaps = 26/271 (9%)

Query: 25  TLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREII 84
           TLG GS G+V L       +  AIKV+ K        V        T D      ER + 
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKE------QVIRMKQIEHTND------ERRM- 94

Query: 85  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIG 144
            +KL++HP ++R++  ++ + NL+MV++Y + GELF+LL +    P   A  +  ++++ 
Sbjct: 95  -LKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA 153

Query: 145 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 204
           + Y H+  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG+P Y APE+++
Sbjct: 154 LEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIA 211

Query: 205 GIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQ 264
             PY+  + D WS G+++F +L G  PF   D        ++  G+   P      PD  
Sbjct: 212 TKPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVV 266

Query: 265 DLIARILTVDPEQRI-----KARDILKHPLL 290
           DL+ +++T D  +R+       +D+  HP  
Sbjct: 267 DLLCKLITSDLTRRLGNLQSGPQDVKSHPWF 297

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  152 bits (383), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 127/209 (60%), Gaps = 6/209 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + H N+++  D +E ++N+Y++LE    G L +LL +R  L E E +RFF  Q
Sbjct: 142 EIQIHKSMKHVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 200

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 199
           I   I Y H+  ++HRDLK  N+  D K+N+KI DFG+AA    D+  + T CG+P+Y A
Sbjct: 201 ICGAIKYMHSRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTVCGTPNYIA 260

Query: 200 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE++ G    H +  D+WS GV+++AL+ GR PF  +D N   +  +++   +  P D  
Sbjct: 261 PEVLMGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVN--TIYERIKCRDFSFPKDKL 318

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKH 287
           IS +A+ LI  IL++DP +R    +I+ +
Sbjct: 319 ISSEAKILIQDILSLDPLERPSVNEIMDY 347

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  145 bits (367), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 86/280 (30%), Positives = 145/280 (51%), Gaps = 25/280 (8%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISK---AIFNVKGSVKDSSVAASTP 72
           K+  +++G  LG G  GKV     + +    A+KV++K     FNV+   K         
Sbjct: 114 KLNDFEIGRKLGKGKFGKVYCVRHKPSGLICALKVMNKMEIVNFNVQKQFK--------- 164

Query: 73  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEK 132
                   REI I   LNH N+ +LY  +  + N+Y+V+EY   GEL+ LL + GP+ + 
Sbjct: 165 --------REIDIQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGPMNDI 216

Query: 133 EAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSC 192
            A  +  Q+   ++Y H   I+HRDLKPEN+L+     IK+ DFG +     ++  +T C
Sbjct: 217 TASNYVYQMTDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNPNNQKRKTLC 276

Query: 193 GSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYE 252
           G+  Y +PE++S   Y     DVW+ G++ + L+ G  PF+++         ++     +
Sbjct: 277 GTIDYLSPELISSREYDE-NVDVWALGILTYELVVGAPPFEEDTK--EQTYKRIAKSDLK 333

Query: 253 MPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
            P +  +S +A+DLI  +L V P +R   + ++ HP ++K
Sbjct: 334 FPPN--VSSEARDLITNLLKVVPSERFNLQQVMNHPWIEK 371

>CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203w TPK2 cAMP-dependent protein kinase 2 catalytic
           chain
          Length = 361

 Score =  145 bits (365), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 142/271 (52%), Gaps = 26/271 (9%)

Query: 25  TLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREII 84
           TLG GS G+V L       +  AIKV+ KA       V        T D      ER + 
Sbjct: 56  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKA------QVVKMKQIEHTND------ERRM- 102

Query: 85  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIG 144
            +KL+ HP ++R++  ++ + NL+MV++Y + GELF LL +    P   A  +  ++ + 
Sbjct: 103 -LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLA 161

Query: 145 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 204
           + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+P Y APE+++
Sbjct: 162 LEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-TVTWTLCGTPDYIAPEVIA 219

Query: 205 GIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQ 264
             PY+  + D WS GV+++ +L G  PF   D        ++  G+   P     + D  
Sbjct: 220 TKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILHGKVVYP--QFFNSDVI 274

Query: 265 DLIARILTVDPEQRI-----KARDILKHPLL 290
           DL++++LT D  +RI      A+DI  HP  
Sbjct: 275 DLLSKLLTADLTRRIGNLQKGAQDIKSHPWF 305

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  145 bits (366), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 124/222 (55%), Gaps = 9/222 (4%)

Query: 75  LPYGIER----EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLP 130
           L Y + +    EI I   LNH N+ +LY  +  +  +Y+++EY   GEL+++L + GP  
Sbjct: 163 LTYNVTKQFRNEIEIQSNLNHENLTKLYGFFHDSKRVYLIMEYIYNGELYSILKKNGPFN 222

Query: 131 EKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLET 190
           +  A  F  Q+   I Y H   I+HRDLKPEN+L+D    IKI DFG +         +T
Sbjct: 223 DIVASNFVFQLTNAIRYLHKKRIIHRDLKPENILIDFNNVIKITDFGWSVYNEAGNKRKT 282

Query: 191 SCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGR 250
            CG+  Y +PE+++   Y G   DVW+ G+I + L+ G  PF+++   +     ++++  
Sbjct: 283 LCGTIDYLSPELINSKEYDGLI-DVWALGIIAYELIVGTPPFEEDTKELT--YKRIKNCD 339

Query: 251 YEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
              P    +S DA++LI+ +L ++P +RI   D+LKHP + K
Sbjct: 340 LNFPA--HVSQDAKNLISSLLKLNPSERITLTDVLKHPWINK 379

>TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {ON}
           Anc_8.676 YPL153C
          Length = 845

 Score =  152 bits (384), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 148/281 (52%), Gaps = 31/281 (11%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A + ST +  A+K+ISK    V G++               G+ RE+
Sbjct: 201 EVVGQGAFAIVKKAVERSTGKTFAVKIISKR--KVMGNMD--------------GVTREL 244

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            +++ L+HP ++RL   +E   + Y+++E+   G+L + +   G + E       RQI+ 
Sbjct: 245 EVLRKLDHPRIVRLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 304

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            + Y H+  I HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 305 AVKYIHSKCISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 364

Query: 202 IVSG---------IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY- 251
           I+SG            +    D+WS G +++ +LTG LPF         L  QV++G Y 
Sbjct: 365 IISGSNNLEENEERNEYSSLVDMWSIGCLVYVILTGHLPFSGSTQ--EQLYKQVRNGSYH 422

Query: 252 EMPGDD-EISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
           E P  D  IS +A++ I  +L V+P  R+ A   L+HP ++
Sbjct: 423 EGPLKDFRISDEARNFIDSLLQVNPNDRLSAERALQHPWIK 463

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  151 bits (381), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 137/235 (58%), Gaps = 7/235 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + H NV++  D +E ++N+Y++LE    G L +LL +R  L E E +RFF  Q
Sbjct: 129 EIQIHKSMKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPE-VRFFTTQ 187

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 199
           I   I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 247

Query: 200 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE++ G    H +  D+WS GV+L+ALL G+ PF  +D N   +  +++   +  P +  
Sbjct: 248 PEVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFSFPKEKH 305

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKHPLLQK-YPSINDSKSIRNLPREDTYL 312
           IS +A+ LI  +L++DP +R    +I+ +   +  +P   +S  +  +P  D  L
Sbjct: 306 ISNEAKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKTL 360

>KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {ON}
           Anc_1.374 YFR014C
          Length = 432

 Score =  146 bits (368), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 154/279 (55%), Gaps = 20/279 (7%)

Query: 18  GPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPY 77
           G +  G+TLG G+ G V+ A   ST++  A+K+I      +K ++K + +          
Sbjct: 37  GNYTFGKTLGAGTFGVVRQARKVSTDEDVAVKII------LKKALKGNDIQLQM------ 84

Query: 78  GIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRF 137
            +  E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ +G   E +A++ 
Sbjct: 85  -LYDELSILQHLSHPNIVEFKDWFESRDKFYIVTQLAIGGELFDRILSKGKFTELDAVKI 143

Query: 138 FRQIVIGISYCHALGIVHRDLKPENLLLDHKFN---IKIADFGMA-ALETEDKLLETSCG 193
             QI+  I Y H+  +VHRDLKPEN+L     +   I IADFG+A  L+ ++ L+  + G
Sbjct: 144 VVQILGAIEYMHSQDVVHRDLKPENVLYVDNSDSSPIVIADFGIAKKLKNKNDLIFKAAG 203

Query: 194 SPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDE--DGNIRNLLLQVQSGRY 251
           S  Y APE+++    HG   D+WS GVI + LL G   F  E  +G +          ++
Sbjct: 204 SLGYVAPEVLTE-GGHGKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTRSKFPVKF 262

Query: 252 EMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLL 290
             P  D IS +A++ I R LT++P++R  A ++L+ P +
Sbjct: 263 HKPYWDNISDEAKNFILRSLTLNPDERPTATELLEDPWI 301

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score =  151 bits (382), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 146/287 (50%), Gaps = 42/287 (14%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSL 75
           ++G +++ + +G GS GKV LA    T+++  +K                     T D  
Sbjct: 37  EVGNYRILKQIGEGSFGKVYLALHRPTHRKVVLK---------------------TSDKN 75

Query: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135
              I RE+   +  ++P + ++Y++  T + ++M LEY    EL++ L+    +P  E  
Sbjct: 76  DPNIVREVFYHRQFDYPYITKVYEIIVTETKVWMALEYCPGKELYDHLLFSKRIPIAECT 135

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
             F QIV  + Y H+L  VHRDLK EN+LLD     K+ DFG          LET CG+ 
Sbjct: 136 ELFAQIVGAVYYAHSLNCVHRDLKLENILLDKHGRAKLTDFGFTRECMTRSTLETVCGTT 195

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
            Y APE++    Y GF  D+W+ GVIL+ ++ G +PFD++D        +V++ ++++  
Sbjct: 196 VYMAPELIERKSYDGFKIDIWALGVILYTMIYGAMPFDEDD--------EVKT-KWKIVN 246

Query: 256 DDEISPDAQDLIA---------RILTVDPEQRIKARDILKHPLLQKY 293
           +D   PD  + I+         ++L  DP +R   R+ILKH  L+ Y
Sbjct: 247 ED---PDFTNNISSNDVKDLIKKLLKKDPTERPTIREILKHDFLKPY 290

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 81/221 (36%), Positives = 129/221 (58%), Gaps = 5/221 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQI 141
           EI I K + H NV++  D +E ++N+Y++LE    G L  LL +R  + E E   F  QI
Sbjct: 138 EIQIHKSMRHFNVVQFIDCFEDDTNVYILLEICPNGSLMELLKKRRTVTEPEVRYFMTQI 197

Query: 142 VIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 200
              I Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 198 CGAIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 257

Query: 201 EIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           E++ G    H +  D+WS GV+++ALL G+ PF  +D N+  +  ++++  +  P D  I
Sbjct: 258 EVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNM--IYERIKNRDFAFPKDKYI 315

Query: 260 SPDAQDLIARILTVDPEQRIKARDILKHPLLQK-YPSINDS 299
           S +A+ LI  IL+ DP +R    +I+ +   +  +PS   S
Sbjct: 316 SNEAKTLIHDILSTDPLERPSIEEIIDYVWFRGIFPSCTLS 356

>Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}
           similar to Ashbya gossypii ACR142W
          Length = 872

 Score =  151 bits (381), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 147/281 (52%), Gaps = 31/281 (11%)

Query: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83
           E +G G+   V+ A +  T +  A+K+ISK    V G+V+              G+ RE+
Sbjct: 194 EVVGQGAFATVKKAVERKTGKTFAVKIISKR--KVMGNVE--------------GVTREL 237

Query: 84  IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVI 143
            ++  LNHP ++ L   +E   + Y+++E+   G+L + +   G + E       RQI+ 
Sbjct: 238 EVLHRLNHPRIVSLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 297

Query: 144 GISYCHALGIVHRDLKPENLLL--DHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPE 201
            + Y H   I HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 298 AVKYIHQQEISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPE 357

Query: 202 IVSG-------IPYHGFAS--DVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRY- 251
           ++ G       +  + ++S  D+WS G +++ +LTG LPF         L  Q+  G Y 
Sbjct: 358 VIDGKSLEEKSVNKNLYSSLVDMWSIGCLVYVILTGHLPF--SGSTQEQLYEQISRGSYH 415

Query: 252 EMPGDD-EISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291
           E P  D +IS +A+D I  +L V+P  R+ A   LKHP +Q
Sbjct: 416 EGPLKDFKISDEARDFIDALLQVNPRDRLTAAKALKHPWIQ 456

>Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203W
           (REAL)
          Length = 383

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 90/276 (32%), Positives = 146/276 (52%), Gaps = 26/276 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  AIKV+ K     +  VK   V  +         
Sbjct: 73  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKK-----QQIVKMKQVEHTND------- 120

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  +KL+ HP ++R++  ++   N++MV++Y + GELF+LL +    P   A  +  
Sbjct: 121 ERRM--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAA 178

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y A
Sbjct: 179 EVILALEYLHGHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIA 236

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           PE+++  PY+  + D WS GV+++ +L G  PF   D        ++  G+   P     
Sbjct: 237 PEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP--PYF 291

Query: 260 SPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
            PD  DL+++++T D  +RI      +RDI  HP  
Sbjct: 292 HPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 327

>Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 143/273 (52%), Gaps = 26/273 (9%)

Query: 25  TLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREII 84
           TLG GS G+V L       +  A+KV+ K I      V+   V  +  + L         
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIV-----VRLKQVEHTNDERL--------- 137

Query: 85  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIG 144
           ++ ++ HP ++R++  ++ +  ++M+++Y + GELF+LL +    P   A  +  ++ + 
Sbjct: 138 MLSIVTHPFIIRMWGTFQDSQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 197

Query: 145 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 204
           + Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE+VS
Sbjct: 198 LEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVS 255

Query: 205 GIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQ 264
             PY+  + D WS G++++ +L G  PF   D N      ++ +     P     + D +
Sbjct: 256 TKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVK 310

Query: 265 DLIARILTVDPEQRI-----KARDILKHPLLQK 292
           DL++R++T D  QR+        D+  HP  ++
Sbjct: 311 DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score =  150 bits (379), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 125/213 (58%), Gaps = 4/213 (1%)

Query: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIR 136
           + +  EI I + L + ++++  D +E   N+Y++LE    G L +LL +R  L E E   
Sbjct: 135 FKLLSEIQIHQNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILTEAEVKF 194

Query: 137 FFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLLETSCGSP 195
              Q+   I+Y H+  I+HRDLK  N+  D  FNIKI DFG+AA L    +   T CG+P
Sbjct: 195 MTTQVCGAINYMHSNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLSNVSEKKYTMCGTP 254

Query: 196 HYAAPEIV-SGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMP 254
           +Y APE++ S    H F +D+WS G++++A++ G+ PF  +D  +  +  +++  +YE P
Sbjct: 255 NYIAPEVILSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKD--VTTIYEKIKLCQYEFP 312

Query: 255 GDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
            D  I+ D + LI  +L +DP QR +  DILK+
Sbjct: 313 PDKYITNDVKVLIQDLLVLDPSQRPRIMDILKY 345

>KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.214
           YPL203W
          Length = 373

 Score =  144 bits (362), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/294 (30%), Positives = 153/294 (52%), Gaps = 26/294 (8%)

Query: 2   AAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGS 61
           + +  RS  +     +  +++  TLG GS G+V L       +  AIKV+ K     +  
Sbjct: 45  SVLQQRSTVSKGKYTLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKK-----QQI 99

Query: 62  VKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFN 121
           VK   +  +         ER +  +KL+ HP ++R++  ++ ++NL+MV++Y + GELF+
Sbjct: 100 VKMKQIEHTND-------ERRM--LKLVEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFS 150

Query: 122 LLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 181
           LL +    P   A  +  ++V+ + Y H   I++RDLKPEN+LLD   +IKI DFG A  
Sbjct: 151 LLRKSQRFPNPVAKFYAAEVVLALEYLHFNNIIYRDLKPENILLDRNGHIKITDFGFAKE 210

Query: 182 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRN 241
            T   +  T CG+P Y APE+++  PY+  + D WS G++++ +L G  PF   D     
Sbjct: 211 VT--TVTWTLCGTPDYIAPEVIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMK 265

Query: 242 LLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
              ++  GR   P     + D  DL+++++T D  +RI       ++I  HP  
Sbjct: 266 TYEKILHGRVTYPS--FFNSDVVDLLSKLITADLTRRIGNLQNGTQEIKSHPWF 317

>SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 373

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 90/276 (32%), Positives = 144/276 (52%), Gaps = 26/276 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  AIKV+ K        +        T D      
Sbjct: 63  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQ------QIIRMKQIEHTND------ 110

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  +KL+ HP ++R++  ++ + NL+MV++Y + GELF+LL +    P   A  +  
Sbjct: 111 ERRM--LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAA 168

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++ + + Y H+  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG+P Y A
Sbjct: 169 EVTLALEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIA 226

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           PE+++  PY+  + D WS G+++F +L G  PF   D        ++  G+   P     
Sbjct: 227 PEVITTKPYNK-SVDWWSLGILIFEMLAGYTPF--YDVTPVKTYEKILQGKVVYP--PFF 281

Query: 260 SPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
            PD  DL+ R++T D  +R+       +DI  HP  
Sbjct: 282 HPDVVDLLGRLITADLTRRLGNLQSGPQDIKSHPWF 317

>YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON}
           TPK1cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; inhibited by regulatory
           subunit Bcy1p in the absence of cAMP; partially
           redundant with Tpk2p and Tpk3p
          Length = 397

 Score =  144 bits (362), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 89/301 (29%), Positives = 154/301 (51%), Gaps = 30/301 (9%)

Query: 25  TLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREII 84
           TLG GS G+V L       +  A+KV+ K I      V+   V  +  + L         
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIV-----VRLKQVEHTNDERL--------- 137

Query: 85  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIG 144
           ++ ++ HP ++R++  ++    ++M+++Y + GELF+LL +    P   A  +  ++ + 
Sbjct: 138 MLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 197

Query: 145 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 204
           + Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE+VS
Sbjct: 198 LEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVS 255

Query: 205 GIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQ 264
             PY+  + D WS G++++ +L G  PF   D N      ++ +     P     + D +
Sbjct: 256 TKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVK 310

Query: 265 DLIARILTVDPEQRI-----KARDILKHPLLQKYPSINDSKSIRNLPREDTYLHPLSEGE 319
           DL++R++T D  QR+        D+  HP  ++   + +    RN+  E  Y  P+ +G+
Sbjct: 311 DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE--VVWEKLLSRNI--ETPYEPPIQQGQ 366

Query: 320 S 320
            
Sbjct: 367 G 367

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score =  149 bits (376), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 125/210 (59%), Gaps = 7/210 (3%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + H N++   D +E + N+Y++LE    G L +LL  R  L E E +RFF  Q
Sbjct: 145 EIQIHKNMRHQNIVHFIDCFEDDINVYILLEICPNGSLMDLLKRRKILTEPE-VRFFTTQ 203

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA-LETEDKLLETSCGSPHYAA 199
           I   + + H+  I+HRDLK  N+  D  FN+KI DFG+AA +  E++   T CG+P+Y A
Sbjct: 204 ICGALDHMHSRNIIHRDLKLGNIFFDKDFNLKIGDFGLAAIINNENERKYTICGTPNYIA 263

Query: 200 PEIVSGIPY--HGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDD 257
           PE++ G     H F  D+WS GV++FA++TG+ PF  ++  +  +  +++   Y  P D 
Sbjct: 264 PEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKE--VSTIYDRIKHCNYSFPTDK 321

Query: 258 EISPDAQDLIARILTVDPEQRIKARDILKH 287
            +S D + LI  IL+++P +R   ++IL +
Sbjct: 322 YVSKDVKKLIQDILSMNPMERPTIQEILNY 351

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score =  149 bits (375), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 80/231 (34%), Positives = 134/231 (58%), Gaps = 5/231 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQI 141
           EI I K + HPN+++  D +E ++N+Y++LE    G +  LL +R  L E E      QI
Sbjct: 137 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQI 196

Query: 142 VIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 200
           +  I Y H+  ++HRDLK  N+  D ++N+KI DFG+AA+   DK  + T CG+P+Y AP
Sbjct: 197 IGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAP 256

Query: 201 EIVSGIPY-HGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           E+++G    H +  D+WS GV+L+ALL G+ PF  ++  +  +  +++   +  P D  +
Sbjct: 257 EVLTGKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKE--VETIYERIKCRDFIFPADKPV 314

Query: 260 SPDAQDLIARILTVDPEQRIKARDILKHPLLQK-YPSINDSKSIRNLPRED 309
           S DA++LI+ +L ++P  R    +I  +   +  +PS   S   + +P  D
Sbjct: 315 SSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLPSTITKEIPNFD 365

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score =  143 bits (361), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 122/214 (57%), Gaps = 5/214 (2%)

Query: 79  IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFF 138
             RE+ I   LNHPN+ +LY  +  +  +Y+++EY   GEL+ LL   GP  +  A RF 
Sbjct: 199 FRREVEIQTSLNHPNLTKLYGHFYDDKRVYLIMEYLVYGELYKLLRSHGPFNDIIASRFV 258

Query: 139 RQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYA 198
            QI   +++ H  GI+HRDLKPEN+L+     +K+ DFG + +  +    +T CG+  Y 
Sbjct: 259 YQIADALNHLHEKGIIHRDLKPENILIGFNNVLKLTDFGWSIINPKGVKRKTLCGTIDYL 318

Query: 199 APEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           +PE++    Y     DVW+ GV+ + L+ G  PF+++   +     ++  G    PG   
Sbjct: 319 SPEMIRSREYDD-TVDVWALGVLTYELVAGDPPFEEDSKELT--YKRILKGEIRFPG--T 373

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
           +S D +DLI+R+L  DP++RI  ++++ HP + +
Sbjct: 374 VSQDVRDLISRLLKNDPKERILLKEVMVHPWIMR 407

>KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {ON}
           Anc_1.182 YJL164C
          Length = 401

 Score =  143 bits (360), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 147/284 (51%), Gaps = 37/284 (13%)

Query: 7   RSVPTVKGNK------IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG 60
           R  P  +G K      +  +K+  TLG GS G+V L       +  A+KV+ K       
Sbjct: 72  RDYPNFEGRKTSGKYTLNDFKILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKQTI---- 127

Query: 61  SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120
            VK   V  +  + L         ++ +++HP ++R++  ++ +  ++MV++Y + GELF
Sbjct: 128 -VKLKQVEHTNDERL---------MLSVVSHPFLVRMWGTFQDSQQVFMVMDYIEGGELF 177

Query: 121 NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180
           +LL +    P   A  +  ++ + + Y H L I++RDLKPEN+LLD   +IKI DFG A 
Sbjct: 178 SLLRKSQRFPTPVAKFYAAEVCLALEYLHNLDIIYRDLKPENILLDKNGHIKITDFGFAK 237

Query: 181 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDG--- 237
              +  +  T CG+P Y APE++S  PY+  + D WS GV+++ +L G  PF D +    
Sbjct: 238 YVPD--VTYTLCGTPDYIAPEVMSTKPYNK-SVDWWSFGVLIYEMLAGHTPFYDSNAMKT 294

Query: 238 --NIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRI 279
             NI N  L+  S  ++         D +DL+ R++  D  QR+
Sbjct: 295 YENILNAKLKFPSFFHD---------DVKDLLTRLINRDLSQRL 329

>Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  143 bits (360), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 89/301 (29%), Positives = 154/301 (51%), Gaps = 30/301 (9%)

Query: 25  TLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREII 84
           TLG GS G+V L       +  A+KV+ K I      V+   V  +  + L         
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEI-----VVRLKQVEHTNDERL--------- 137

Query: 85  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIG 144
           ++ ++ HP ++R++  ++    ++M+++Y + GELF+LL +    P   A  +  ++ + 
Sbjct: 138 MLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 197

Query: 145 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 204
           + Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE+VS
Sbjct: 198 LEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVS 255

Query: 205 GIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQ 264
             PY+  + D WS G++++ +L G  PF   D N      ++ +     P     + D +
Sbjct: 256 TKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVK 310

Query: 265 DLIARILTVDPEQRI-----KARDILKHPLLQKYPSINDSKSIRNLPREDTYLHPLSEGE 319
           DL++R++T D  QR+        D+  HP  ++   + +    RN+  E  Y  P+ +G+
Sbjct: 311 DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE--VVWEKLLSRNI--ETPYEPPIQQGQ 366

Query: 320 S 320
            
Sbjct: 367 G 367

>ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {ON}
           highly similar to uniprot|P06245 Saccharomyces
           cerevisiae YPL203W TPK2 Involved in nutrient control of
           cell growth and division cAMP-dependent protein kinase
           catalytic subunit
          Length = 362

 Score =  142 bits (358), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 88/276 (31%), Positives = 145/276 (52%), Gaps = 26/276 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  A+KV+ K     +  VK   +  +         
Sbjct: 52  FQIMRTLGTGSFGRVHLVRSVHNGRYYAMKVLKK-----QQVVKMKQIEHTND------- 99

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  +KL+ HP ++R++  ++   NL+MV++Y + GELF+LL +    P   A  +  
Sbjct: 100 ERHM--LKLVEHPFIIRMWGTFQDAKNLFMVIDYIEGGELFSLLRKSHRFPNPVAKFYAA 157

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++ + + Y H+  I++RDLKPENLLLD   +IKI DFG A  +    +  T CG+P Y A
Sbjct: 158 EVTLALDYLHSHNIIYRDLKPENLLLDRNGHIKITDFGFA--KEVVTVTWTLCGTPDYIA 215

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           PE+++  PY+  + D WS GV++F +L G  PF   D        ++  G+   P     
Sbjct: 216 PEVITTKPYNK-SVDWWSLGVLIFEMLAGYTPF--YDATAMKTYEKILQGKVNYP--PFF 270

Query: 260 SPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
            PD  DL+++++  D  +R+      ++DI  HP  
Sbjct: 271 HPDVVDLLSKLIMADLTRRLGNLQSGSQDIKSHPWF 306

>NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {ON}
           Anc_1.182
          Length = 408

 Score =  143 bits (360), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 98/311 (31%), Positives = 159/311 (51%), Gaps = 40/311 (12%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  A+KVI K       +V        T D      
Sbjct: 98  FQIMRTLGTGSFGRVHLVRSIHNGRFYALKVIKK------NTVVRLKQIEHTND------ 145

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  + ++NHP ++R++  ++ +  ++M+++Y + GELF+LL      P   A  +  
Sbjct: 146 ERRM--LSVVNHPFLVRMWGTFQDSEQIFMIMDYIEGGELFSLLRRSQKFPNPVAKFYAA 203

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++ + + Y H+L I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y A
Sbjct: 204 EVCLALEYLHSLDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIA 261

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDG-----NIRNLLLQVQSGRYEMP 254
           PE+VS  PY+  + D WS G++++ +L+GR PF D        NI +  L   S  +E  
Sbjct: 262 PEVVSSKPYNK-SVDWWSFGILIYEMLSGRTPFYDRSTIKTYENILSAPLTFPSYLHE-- 318

Query: 255 GDDEISPDAQDLIARILTVDPEQRI-----KARDILKHPLLQKYPSINDSKSIRNLPRED 309
                  D QDL+ R++T D  +R+      + D+  H    +   I D    R +  E 
Sbjct: 319 -------DVQDLLNRLITRDLSKRLGNLQNGSEDVKNHAWFSE--VIWDKLLARCI--ET 367

Query: 310 TYLHPLSEGES 320
            Y  P+S+G+ 
Sbjct: 368 PYEPPISQGQG 378

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  144 bits (362), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 83/277 (29%), Positives = 144/277 (51%), Gaps = 26/277 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISK---AIFNVKGSVKDSSVAASTPDSLP 76
           +++G  LG G  GKV     + +   +A+KV+ K     +N +   K             
Sbjct: 175 FEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKKEIVSYNAEKQFK------------- 221

Query: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF-NLLVERGPLPEKEAI 135
               RE+ +   LNHPN+++++  ++    +Y+++EY   GEL+ +L    GP  +  A 
Sbjct: 222 ----REVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNNNGPFNDILAS 277

Query: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195
            +  QI   + Y H+  I+HRD+KPEN++L     IK+ADFG +     +   +T CG+ 
Sbjct: 278 NYIYQIADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPPNLRRKTICGTI 337

Query: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255
            Y APE+V+   Y  +  D+W+ G++ + L+ G  PF++E  +    L   +    ++  
Sbjct: 338 DYLAPELVTFKEY-DYNVDIWALGILTYELIVGNPPFEEETKD----LTYKRIINVDLNF 392

Query: 256 DDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQK 292
              +S DA+DLI R+L  DP +R+   D++KHP + K
Sbjct: 393 PQTVSMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit and to YJL164C uniprot|P06244 Saccharomyces
           cerevisiae YJL164C TPK1 putative catalytic subunit of
           cAMP- dependent protein kinase
          Length = 455

 Score =  144 bits (363), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 88/276 (31%), Positives = 145/276 (52%), Gaps = 26/276 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  A+KV+ K       +V        T D      
Sbjct: 145 FQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKK------NTVVKLKQVEHTND------ 192

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  + +++HP ++R++  ++ +  L+M+++Y + GELF+LL +    P   A  +  
Sbjct: 193 ERNM--LSIVSHPFIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAA 250

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++ + + Y H+ GI++RDLKPEN+LLD   +IK+ DFG A    +  +  T CG+P Y A
Sbjct: 251 EVCLALEYLHSKGIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTYTLCGTPDYIA 308

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           PE+VS  PY+  + D WS GV+++ +L G  PF   D N       + +     P     
Sbjct: 309 PEVVSTKPYNK-SVDWWSFGVLIYEMLAGYTPF--YDSNTIKTYENILNAPVRFP--PFF 363

Query: 260 SPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
             DAQDLI++++T D  QR+      + D+  HP  
Sbjct: 364 HSDAQDLISKLITRDLSQRLGNLQNGSEDVKNHPWF 399

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score =  148 bits (373), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 126/209 (60%), Gaps = 6/209 (2%)

Query: 82  EIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR-Q 140
           EI I K + H N+++  D +E  +N+Y++LE    G L  LL +R  L E E +RFF  Q
Sbjct: 148 EIQIHKSMRHANIVQFIDCFEDETNVYILLEICPNGSLMELLKKRKTLTEPE-VRFFTTQ 206

Query: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE-TSCGSPHYAA 199
           I  GI Y H+  ++HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 207 ICGGIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 266

Query: 200 PEIVSG-IPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDE 258
           PE++ G    H +  D+WS GV+++ALL G+ PF  +D N   +  +++   +  P +  
Sbjct: 267 PEVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVN--TIYERIKCCDFVFPKEKY 324

Query: 259 ISPDAQDLIARILTVDPEQRIKARDILKH 287
           IS +A+ L+  +L++DP +R    ++L +
Sbjct: 325 ISSEARILVQDLLSLDPLERPSIMEVLDY 353

>NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214
          Length = 367

 Score =  142 bits (357), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 90/276 (32%), Positives = 144/276 (52%), Gaps = 26/276 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  AIKV+ K        +        T D      
Sbjct: 57  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKH------QIVRMKQIEHTND------ 104

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  +KL+ HP ++R++  ++ + N++MV++Y + GELF+LL +    P   A  +  
Sbjct: 105 ERRM--LKLVEHPFLIRMWGTFQDSRNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAA 162

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++ + + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+P Y A
Sbjct: 163 EVTLALEYLHHHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-TVTWTLCGTPDYIA 220

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           PE+++  PY+  + D WS G+++F +L G  PF   D        ++  G+   P     
Sbjct: 221 PEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDSTPMKTYEKILQGKVIFP--TFF 275

Query: 260 SPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
            PD  DL+ +++T D  +RI      ++DI  HP  
Sbjct: 276 HPDVVDLLGQLITADLTRRIGNLQSGSKDIKCHPWF 311

>Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AFL090W
          Length = 352

 Score =  141 bits (355), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 147/278 (52%), Gaps = 30/278 (10%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  AIK++ K        V        T D      
Sbjct: 42  FQIMRTLGTGSFGRVHLVRSIHNGRYYAIKILKKQ------QVVRMKQIEHTND------ 89

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  +KL+ HP ++R++  ++ + NL+MV++Y + GELF+LL +    P   A  +  
Sbjct: 90  ERRM--LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAA 147

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++ + + Y HA  I++RDLKPEN+LL+   +IKI DFG A  +  D +  T CG+P Y A
Sbjct: 148 EVTLALEYLHAHNIIYRDLKPENILLERNGHIKITDFGFA--KEVDTVTWTLCGTPDYIA 205

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDED--GNIRNLLLQVQSGRYEMPGDD 257
           PE+++  PY+  + D WS G+++F +L G  PF D         +LL    G+   P   
Sbjct: 206 PEVITTKPYNK-SIDWWSLGILIFEMLAGYTPFYDVTPMKTYEKILL----GKIVYP--P 258

Query: 258 EISPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
              PD  DL+++++T D  +R+      ++DI  HP  
Sbjct: 259 FFHPDVVDLLSKLITEDLTRRLGNLQSGSQDIKSHPWF 296

>AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL203W (TPK2)
          Length = 346

 Score =  140 bits (354), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 148/276 (53%), Gaps = 26/276 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79
           +++  TLG GS G+V L       +  AIKV+ K        V        T D      
Sbjct: 36  FQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVLKKQ------QVIRMKQIEHTND------ 83

Query: 80  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFR 139
           ER +  +K++ HP ++R++  ++   NL++V++Y + GELF+LL +    P   A  +  
Sbjct: 84  ERRM--LKVVEHPFLIRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAA 141

Query: 140 QIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAA 199
           ++ + + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG+P Y A
Sbjct: 142 EVTLALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIA 199

Query: 200 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEI 259
           PE+++  PY+  + D WS G+++F +L G  PF D    I+    ++ +G+   P     
Sbjct: 200 PEVITTKPYNK-SIDWWSLGILIFEMLAGYTPFYDVT-PIKT-YEKILAGKVVFP--PFF 254

Query: 260 SPDAQDLIARILTVDPEQRI-----KARDILKHPLL 290
            PDA DL+ +++T D  +R+      ++DI  HP  
Sbjct: 255 HPDAIDLLGKLITDDLTRRLGNLQSGSQDIKSHPWF 290

>Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C
           (REAL)
          Length = 394

 Score =  142 bits (357), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 88/301 (29%), Positives = 154/301 (51%), Gaps = 30/301 (9%)

Query: 25  TLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREII 84
           TLG GS G+V L       +  A+KV+ K I      V+   V  +  + L         
Sbjct: 89  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEI-----VVRLKQVEHTNDERL--------- 134

Query: 85  IMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIG 144
           ++ ++ HP ++R++  ++    ++M+++Y + GELF+LL +    P   A  +  ++ + 
Sbjct: 135 MLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 194

Query: 145 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 204
           + Y H+  I++RDLKPEN+LLD   ++KI DFG A    +  +  T CG+P Y APE+VS
Sbjct: 195 LEYLHSKDIIYRDLKPENILLDKNGHVKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVS 252

Query: 205 GIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQ 264
             PY+  + D WS G++++ +L G  PF   D N      ++ +     P     + D +
Sbjct: 253 TKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNDDVK 307

Query: 265 DLIARILTVDPEQRI-----KARDILKHPLLQKYPSINDSKSIRNLPREDTYLHPLSEGE 319
           DL++R++T D  QR+        D+  HP  ++   + +    RN+  E  Y  P+ +G+
Sbjct: 308 DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE--VVWEKLLSRNI--ETPYEPPIQQGQ 363

Query: 320 S 320
            
Sbjct: 364 G 364

>KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.336
           YBR274W
          Length = 534

 Score =  144 bits (364), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/318 (34%), Positives = 160/318 (50%), Gaps = 40/318 (12%)

Query: 1   MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQ--AAIKVISKAIFNV 58
           M+      +P +K   IG     ET+G GS G V+ A  + +NQ    AIK I     N 
Sbjct: 1   MSTFCEEDLPKIKDVIIG-----ETIGQGSFGIVKSARIKDSNQNNIFAIKFIHLPSAND 55

Query: 59  KGSVKDSSVAASTPDSLPYGIEREIII-MKLLNHPNVLRLYDVWETNSNLYMVLEYAQKG 117
           KG  +               I RE+ I MK  NHPN+L+  D   TN  L+MVLE A  G
Sbjct: 56  KGITERE-------------ISREVSIHMKCSNHPNILKFIDCNVTNKFLWMVLEMADGG 102

Query: 118 ELFNLLVERGPLPEKEAIRFFRQIVIGISYCH-ALGIVHRDLKPENLLLDHKFNIKIADF 176
           +LF+ +     +    A  +F+Q++  + Y H   GI HRD+KPEN+LLD   N+K+ADF
Sbjct: 103 DLFDKIEPDYGVDSHIAQFYFQQLIRALDYLHNTCGIAHRDIKPENILLDKDGNLKLADF 162

Query: 177 GMA-ALETEDKLLETSC---GSPHYAAPEIVS-GIPYHGFASDVWSCGVILFALLTGRLP 231
           G+A + + +D  +  S    GSP Y APEI++   PYH   +D+WS GV+LF LL G++P
Sbjct: 163 GLASSFKRKDGTMRLSHDQRGSPPYMAPEILTLNSPYHANITDIWSVGVLLFVLLAGQVP 222

Query: 232 F-----DDEDGN--IRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDI 284
           +     +D D N  I+N      +G        +I  D  +L+ +IL  DP +R     +
Sbjct: 223 WELPVNEDSDYNAFIKN------NGNINAGPWSKIKLDQLNLLRKILHSDPSKRATLTTL 276

Query: 285 LKHPLLQKYPSINDSKSI 302
             H    K     +SK +
Sbjct: 277 KSHRWFLKKNMYANSKGL 294

>KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa]
           {ON} Anc_8.279 YLR096W
          Length = 539

 Score =  144 bits (363), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 89/282 (31%), Positives = 149/282 (52%), Gaps = 14/282 (4%)

Query: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISK---AIFNVKGS--VKDSSVAAS 70
           ++G W    TLG G+ G V+LA   ++ Q  A+K+  +    I N   +  ++D   +  
Sbjct: 51  QLGEWIFSRTLGKGAKGTVKLAKHRASGQICAVKITIRYQSVILNKCNTQNIEDVKCSKE 110

Query: 71  TPDSLPYG--IEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGP 128
              ++ +     +E  + ++L HP++ + Y + E   + YM LEY Q   L   +  +  
Sbjct: 111 FKTAIQHDRRTMQEFQLSRVLRHPHICKFYKMEEMRYHYYMFLEYIQGCTLLEYVSSQNA 170

Query: 129 --LPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHK-FNIKIADFGMAALETED 185
             L E+ A  F  QI+  ++Y H+  IVHRDLK EN+++ ++   IK+ DFG+     ++
Sbjct: 171 KKLNEEIARDFAGQILNALAYLHSNNIVHRDLKMENIMVTNEDKTIKLIDFGLGCFYDQN 230

Query: 186 KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQ 245
             L   CGS +YAAPE++    Y G   D+WS GV+L+ ++TG+LPF         L+  
Sbjct: 231 STLNDYCGSLYYAAPEVLKRDYYIGPEVDIWSFGVVLYIMVTGKLPFKGRSKG--RLMKH 288

Query: 246 VQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKH 287
           + SG+ + P  + +S D   L++RIL +D   R    DI+KH
Sbjct: 289 ILSGQVKFP--NFLSMDVISLLSRILEIDLSFRFSLSDIIKH 328

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 118,370,589
Number of extensions: 5404018
Number of successful extensions: 27772
Number of sequences better than 10.0: 2314
Number of HSP's gapped: 24495
Number of HSP's successfully gapped: 2627
Length of query: 1153
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1032
Effective length of database: 39,606,813
Effective search space: 40874231016
Effective search space used: 40874231016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)