Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C062101.80ON47947921930.0
ZYRO0F16720g1.80ON49242413241e-180
Suva_5.31.80ON48348413111e-178
YEL064C (AVT2)1.80ON48048212891e-174
Kwal_33.133861.80ON46942412721e-172
Skud_5.251.80ON48349012661e-171
NCAS0J018401.80ON44543012411e-168
Smik_5.231.80ON48348812341e-166
SAKL0C02574g1.80ON47346112311e-166
Ecym_10841.80ON49547612241e-164
KLTH0F02332g1.80ON46946712191e-164
NDAI0I001301.80ON44443011641e-156
KLLA0C02277g1.80ON46546410771e-143
AFR671W1.80ON48838810261e-135
KNAG0C007801.80ON5134688851e-113
ZYRO0B04026g7.420ON4363322211e-18
Kwal_27.107027.420ON4672892007e-16
KLTH0C06006g7.420ON4452911934e-15
TDEL0C028207.420ON4543031802e-13
KNAG0B021907.420ON4613661802e-13
CAGL0H04587g7.420ON4452951784e-13
KAFR0L019107.420ON4453521722e-12
Kpol_1045.207.420ON4662181695e-12
SAKL0F13134g7.420ON5103631687e-12
YBL089W (AVT5)7.420ON4593511642e-11
KLLA0E06931g7.420ON4563521632e-11
TPHA0K006707.420ON4643321633e-11
TBLA0C030305.252ON5232821623e-11
YER119C (AVT6)7.420ON4483041606e-11
Smik_2.317.420ON4593531606e-11
Ecym_71337.420ON4573031597e-11
Suva_5.2407.420ON4483041581e-10
Skud_5.2607.420ON4483041562e-10
Suva_2.287.420ON4593001552e-10
NDAI0E040107.420ON4712901517e-10
Skud_2.197.420ON4593231491e-09
TBLA0F014007.420ON4533491491e-09
TBLA0F01390singletonON4282911463e-09
CAGL0G03619g7.420ON4603071454e-09
KAFR0H036605.252ON6464201446e-09
Smik_5.2647.420ON4483531428e-09
TPHA0F017002.177ON4442251411e-08
NCAS0B062102.295ON4811351402e-08
AGL285C7.420ON4402861392e-08
CAGL0M06611g2.295ON4851461374e-08
Kwal_23.28395.252ON6143031341e-07
CAGL0E06468g5.252ON6814121341e-07
AER380C2.177ON7164341332e-07
TPHA0B025305.252ON5964201322e-07
Kpol_1003.442.295ON4702711312e-07
KLTH0G10604g2.295ON4682511312e-07
Smik_14.2242.177ON7154351313e-07
TPHA0C034602.295ON4732701303e-07
Smik_11.905.252ON6804251304e-07
KNAG0H023305.252ON6434141295e-07
NCAS0F023105.252ON6682801286e-07
NCAS0E024407.420ON4951981276e-07
YKL146W (AVT3)5.252ON6923071286e-07
Kpol_505.52.177ON6872421251e-06
KLLA0E13795g5.252ON5732781251e-06
Skud_14.2292.177ON7134351251e-06
Suva_9.1122.295ON4911121241e-06
KLLA0C13277g2.177ON7214401233e-06
YNL101W (AVT4)2.177ON7134351223e-06
Kpol_1032.885.252ON5754181205e-06
ZYRO0A02112g2.295ON4671471195e-06
Skud_11.815.252ON7123051197e-06
KLLA0E08559g2.295ON4601891188e-06
Smik_9.972.295ON4901121161e-05
SAKL0G11462g5.252ON6164141161e-05
TBLA0F03230singletonON5612661152e-05
Suva_14.2382.177ON7164351162e-05
Kwal_26.84012.177ON7203241134e-05
KNAG0C033807.420ON5452261124e-05
ZYRO0B09548g2.177ON7184341124e-05
NDAI0C037905.252ON7212851126e-05
YIL088C (AVT7)2.295ON4901041116e-05
Kwal_27.114852.295ON4713041116e-05
NDAI0B035102.295ON4961041107e-05
TDEL0G022502.295ON4672271107e-05
Suva_11.795.252ON7193561081e-04
SAKL0E07392g2.295ON4721981062e-04
KAFR0J013202.295ON4791041062e-04
KNAG0A053802.295ON4741081053e-04
NCAS0G026302.177ON7052441045e-04
Skud_9.862.295ON4901041035e-04
KLTH0D09042g2.177ON7183241045e-04
ZYRO0A10538g5.252ON6084211036e-04
ADL205C2.295ON468901026e-04
Ecym_82495.252ON6271651028e-04
KAFR0D020002.177ON7143911028e-04
TDEL0F013202.177ON715323990.002
ACR051C5.252ON678281980.002
TDEL0E037405.252ON613154970.003
Kpol_1029.62.177ON767428960.005
CAGL0G06622g2.177ON733313940.008
SAKL0E10362g2.177ON733432920.013
KLTH0G07502g5.252ON601131910.017
Ecym_54082.177ON715425910.017
KNAG0I019702.177ON736331860.063
TPHA0B029802.177ON749440860.068
Ecym_33352.295ON474128800.34
TBLA0C056302.177ON742163800.35
NDAI0F026602.177ON710249723.3
TBLA0B072102.295ON497108713.9
Ecym_10321.26ON82881705.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C06210
         (479 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1...   849   0.0  
ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} simi...   514   e-180
Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL0...   509   e-178
YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}  AV...   501   e-174
Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {...   494   e-172
Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON} Y...   492   e-171
NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1....   482   e-168
Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON} Y...   479   e-166
SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {...   478   e-166
Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}...   476   e-164
KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {...   474   e-164
NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80 ...   452   e-156
KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {...   419   e-143
AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic ...   399   e-135
KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {O...   345   e-113
ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {...    90   1e-18
Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119...    82   7e-16
KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} simila...    79   4e-15
TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {O...    74   2e-13
KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.4...    74   2e-13
CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} simila...    73   4e-13
KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {...    71   2e-12
Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON} (42445....    70   5e-12
SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]...    69   7e-12
YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative...    68   2e-11
KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} simila...    67   2e-11
TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7....    67   3e-11
TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.2...    67   3e-11
YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}  ...    66   6e-11
Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)    66   6e-11
Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar t...    66   7e-11
Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON...    65   1e-10
Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C ...    65   2e-10
Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)    64   2e-10
NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420     63   7e-10
Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)    62   1e-09
TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {O...    62   1e-09
TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {O...    61   3e-09
CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {...    60   4e-09
KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.2...    60   6e-09
Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON...    59   8e-09
TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {O...    59   1e-08
NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON} Anc_2...    59   2e-08
AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON} S...    58   2e-08
CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa] ...    57   4e-08
Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -...    56   1e-07
CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} simila...    56   1e-07
AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}...    56   2e-07
TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.2...    55   2e-07
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    55   2e-07
KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {...    55   2e-07
Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101...    55   3e-07
TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {O...    55   3e-07
Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W...    55   4e-07
KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.2...    54   5e-07
NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {O...    54   6e-07
NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420     54   6e-07
YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuo...    54   6e-07
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    53   1e-06
KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]...    53   1e-06
Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101...    53   1e-06
Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON...    52   1e-06
KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} simi...    52   3e-06
YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuo...    52   3e-06
Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa] ...    51   5e-06
ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {...    50   5e-06
Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W...    50   7e-06
KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {...    50   8e-06
Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}...    49   1e-05
SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} simila...    49   1e-05
TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON}               49   2e-05
Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101...    49   2e-05
Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {O...    48   4e-05
KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.4...    48   4e-05
ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {...    48   4e-05
NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {O...    48   6e-05
YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}  ...    47   6e-05
Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088...    47   6e-05
NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295     47   7e-05
TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {O...    47   7e-05
Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W...    46   1e-04
SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} simila...    45   2e-04
KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2....    45   2e-04
KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.2...    45   3e-04
NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177     45   5e-04
Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}...    44   5e-04
KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {...    45   5e-04
ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} simila...    44   6e-04
ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON} S...    44   6e-04
Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar t...    44   8e-04
KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.1...    44   8e-04
TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.1...    43   0.002
ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON} S...    42   0.002
TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.2...    42   0.003
Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON} (11352.....    42   0.005
CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {...    41   0.008
SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {...    40   0.013
KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} simila...    40   0.017
Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}...    40   0.017
KNAG0I01970 Chr9 complement(379931..382141) [2211 bp, 736 aa] {O...    38   0.063
TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.1...    38   0.068
Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}...    35   0.34 
TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON} Anc_2...    35   0.35 
NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {O...    32   3.3  
TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON} Anc_2...    32   3.9  
Ecym_1032 Chr1 (59499..61985) [2487 bp, 828 aa] {ON} similar to ...    32   5.1  

>TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1.80
           YEL064C
          Length = 479

 Score =  849 bits (2193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/479 (88%), Positives = 424/479 (88%)

Query: 1   MPKNDGYSRLEEQSERIPLELEFELVDFDAKPGASDETXXXXXXXXXXXXXXXXIDESMV 60
           MPKNDGYSRLEEQSERIPLELEFELVDFDAKPGASDET                IDESMV
Sbjct: 1   MPKNDGYSRLEEQSERIPLELEFELVDFDAKPGASDETEENDSNEAKASSSNSAIDESMV 60

Query: 61  INLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLR 120
           INLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNC               VDWTLR
Sbjct: 61  INLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCGIIGGILAYIILVLLVDWTLR 120

Query: 121 LIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSI 180
           LIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFA            DTIPHFLQSI
Sbjct: 121 LIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAFGGCIGFCIIIGDTIPHFLQSI 180

Query: 181 FHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQGPRVD 240
           FHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLAL            QGPRVD
Sbjct: 181 FHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALISMVVIVFSVVVQGPRVD 240

Query: 241 MSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTF 300
           MSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTF
Sbjct: 241 MSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTF 300

Query: 301 ISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRD 360
           ISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRD
Sbjct: 301 ISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRD 360

Query: 361 VIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTAST 420
           VIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTAST
Sbjct: 361 VIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTAST 420

Query: 421 MAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQRHCEL 479
           MAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQRHCEL
Sbjct: 421 MAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQRHCEL 479

>ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} similar
           to uniprot|P39981 Saccharomyces cerevisiae YEL064C AVT2
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 492

 Score =  514 bits (1324), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 256/424 (60%), Positives = 314/424 (74%), Gaps = 5/424 (1%)

Query: 56  DESMVINLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXV 115
           D+  V +++R+N+KKSTM+WAFMNMANSILGAGV+GQP AI+N                V
Sbjct: 74  DDEFVNDVIRENNKKSTMKWAFMNMANSILGAGVIGQPIAIKNSGIVGAIIAYLVLFVLV 133

Query: 116 DWTLRLIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPH 175
           DWTLRLIVINLTLAGKKTYQDTV FA+G++GRI VL +NGLFA            DT+PH
Sbjct: 134 DWTLRLIVINLTLAGKKTYQDTVAFAMGKRGRIAVLTANGLFAFGGCIGFCIIIGDTLPH 193

Query: 176 FLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQ 235
             ++  H ++ F  R ++ITIVT+ ISYPL+LQRNIAALSKASFLAL            +
Sbjct: 194 VFRAFIHQNSVFLSRRLIITIVTICISYPLALQRNIAALSKASFLALISMVIIVFTVIIR 253

Query: 236 GPRVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLT 295
           GP +    K D  +  DI ++  IFRGISVISFALVCHHNTSFI+FSIKNRSL+KF RLT
Sbjct: 254 GPEIHA--KRDPLTWEDILVTPRIFRGISVISFALVCHHNTSFIYFSIKNRSLRKFNRLT 311

Query: 296 HISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEI 355
           HIST IS++FCM+MG+SG++ F   TKGN+LNNF  DD  +NIARLCFGFNMLTTFPLEI
Sbjct: 312 HISTSISVVFCMIMGFSGFAAFGQNTKGNVLNNFSADDKAVNIARLCFGFNMLTTFPLEI 371

Query: 356 FVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGA 415
           FVLRDVIA+F+ G +   +     LS    FIITT+ V  TMSISL TCNLGA+FELIGA
Sbjct: 372 FVLRDVIASFIGGHQPNGDPNV--LSKSNHFIITTILVFGTMSISLLTCNLGAIFELIGA 429

Query: 416 TTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQR 475
           TTAS MAYILPP+ NL+L+ +  TFRQK+PH+ CI FGF +M++SS QTI++ + G+D++
Sbjct: 430 TTASMMAYILPPWVNLLLTSD-KTFRQKLPHFACIAFGFSIMLISSIQTILDTMNGTDEK 488

Query: 476 HCEL 479
            CEL
Sbjct: 489 QCEL 492

>Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL064C
           (REAL)
          Length = 483

 Score =  509 bits (1311), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 261/484 (53%), Positives = 335/484 (69%), Gaps = 18/484 (3%)

Query: 7   YSRLEEQSERIPLELEFELVDF---DAKPGASDETXXXXXXXXXXXXXXXXIDESMVINL 63
           YS+LE +     L  EFEL +F         SD+                  D+ +V N+
Sbjct: 7   YSKLENKE----LRTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVNNV 62

Query: 64  LRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIV 123
           LR+NDKKS+MR AFMN+ANSILGAG++ QPFAI+N                VDWTLRLIV
Sbjct: 63  LRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIV 122

Query: 124 INLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHS 183
           INLTLAGK+TYQ TVE+ +G+KG++L+L +NGLFA            DTIPH L+++F  
Sbjct: 123 INLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVFSQ 182

Query: 184 SN----FFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQGPRV 239
           ++    F+ RRNV+I +VT+FIS+PLSL+RNI  LSKASFLA+            +GP +
Sbjct: 183 NDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPML 242

Query: 240 DMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHIST 299
               +G    L+DIFI + IFR +SVISFALVCHHNTSFIFFS++NRS+ KF +LTHIS 
Sbjct: 243 PYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISI 302

Query: 300 FISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR 359
            IS+I C LMGYSG++ F++KTKGN+LN+FP  D  IN+ARLCFGFNMLTTFP+EIFVLR
Sbjct: 303 VISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLR 362

Query: 360 DVIAAFLYG----KKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGA 415
           DV+   L+     K  ++ T+   LS ++  IIT++ V  TM ISLTTCNLGALFELIGA
Sbjct: 363 DVVGNLLHECHLIKNYDEHTQ---LSNKQHTIITSMLVFITMGISLTTCNLGALFELIGA 419

Query: 416 TTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQR 475
           TTASTMAYILPPYTNL+L+ +   ++ K+P+Y CI FGFM+MIVSSTQTI++ V G D +
Sbjct: 420 TTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPDGQ 479

Query: 476 HCEL 479
           HC++
Sbjct: 480 HCQI 483

>YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}
           AVT2Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 480

 Score =  501 bits (1289), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 264/482 (54%), Positives = 341/482 (70%), Gaps = 17/482 (3%)

Query: 7   YSRLEEQSERIPLELEFELVDFDAKPGASD-ETXXXXXXXXXXXXXXXXIDESMVINLLR 65
           YS+LE +     L  EFEL +F   PG +D ++                +D+++V ++LR
Sbjct: 7   YSKLENKE----LRTEFELTNFPF-PGTTDNDSDDGSQGQNSLNIITPDMDDTLVNDVLR 61

Query: 66  DNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVIN 125
           +NDKKS+MR AFMN+ANSILGAG++ QPFAI+N                VDWTLRLIVIN
Sbjct: 62  ENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVIN 121

Query: 126 LTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSN 185
           LTLAGK+TYQ TVE  +G+KG++L+L +NGLFA            DTIPH L++IF  ++
Sbjct: 122 LTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIFSQND 181

Query: 186 ----FFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQGPRVDM 241
               F+ RRNV+I +VT FIS+PLS++RNI ALSKASFLA+            +GP +  
Sbjct: 182 GNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPY 241

Query: 242 SLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFI 301
             KG    L+D F+ + IFR +SVISFALVCHHNTSFIFFS++NRS+ KF RLTHIS  I
Sbjct: 242 DWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIII 301

Query: 302 SMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDV 361
           S+I C LMGYSG++VF++KTKGN+LN+FP  D  INIARLCFGFNMLTTFP+EIFVLRDV
Sbjct: 302 SVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDV 361

Query: 362 IAAFLYG----KKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATT 417
           +   L+     K  ++ T+   LS ++  +IT+  V  TM ISLTTCNLGALFELIGATT
Sbjct: 362 VGNLLHECNLIKNYDEHTQ---LSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATT 418

Query: 418 ASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQRHC 477
           ASTMAYILPPYTNL+L+ +  ++++++P YLCI FGFM+MI+SSTQTII+ V GSD +HC
Sbjct: 419 ASTMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFMIMIISSTQTIIDAVNGSDGQHC 478

Query: 478 EL 479
           ++
Sbjct: 479 QI 480

>Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {ON}
           YEL064C - Hypothetical ORF [contig 118] FULL
          Length = 469

 Score =  494 bits (1272), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 245/424 (57%), Positives = 308/424 (72%), Gaps = 3/424 (0%)

Query: 56  DESMVINLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXV 115
           DES     LR+N  KS +  AFMNMANSILGAGV+GQPFAI+NC               V
Sbjct: 49  DESTTA-FLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLV 107

Query: 116 DWTLRLIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPH 175
           DWT+RLIV+N+ + GK TYQD+VEFA+GRKG++L+LLSNGLFA            DTIPH
Sbjct: 108 DWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAFGGCVGFCIIIGDTIPH 167

Query: 176 FLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQ 235
            L++ F      F RN++I +VT FIS+PLSL RNI+ LSKAS LAL            +
Sbjct: 168 VLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLALVSMVFIVVIVLVK 227

Query: 236 GPRVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLT 295
           GP +D + KG  ++ T++F +  IF+GISVISFALVCHHNTSFI+FS+K  SL++F RLT
Sbjct: 228 GPMIDDAYKGS-FNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLT 286

Query: 296 HISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEI 355
           H S F++MIFC LMGY+G+ VF+D+TKGNILNNFP  D V+N+AR CFGFNMLTTFPLEI
Sbjct: 287 HFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEI 346

Query: 356 FVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGA 415
           FVLRDVI  F++    +D  ++  LS +   I+TT+ V++TM ISLTTCNLGALFEL GA
Sbjct: 347 FVLRDVIRDFMF-FNSKDTNQSQELSLKLHVILTTILVMTTMLISLTTCNLGALFELTGA 405

Query: 416 TTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQR 475
           TTAS MAYILPP  NL+L  + +T R+K+PHY CI FGF +M+VSS+QTII  ++G DQ+
Sbjct: 406 TTASLMAYILPPSVNLLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQK 465

Query: 476 HCEL 479
           HCE+
Sbjct: 466 HCEV 469

>Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  492 bits (1266), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 260/490 (53%), Positives = 336/490 (68%), Gaps = 18/490 (3%)

Query: 1   MPKNDGYSRLEEQSERIPLELEFELVDF---DAKPGASDETXXXXXXXXXXXXXXXXIDE 57
           M +  GY++LE +     L  EFEL DF         SD+                  D+
Sbjct: 1   MTEVGGYTKLENKE----LRTEFELTDFPLLGITDNDSDDGSQGKDSPNFVYPITSDTDD 56

Query: 58  SMVINLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDW 117
            +V ++LR+NDKKS+MR AFMN+ANSILGAG++ QP AI+N                VDW
Sbjct: 57  PLVNSVLRENDKKSSMRMAFMNLANSILGAGIITQPVAIKNAGILGGLIAYIALGFIVDW 116

Query: 118 TLRLIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFL 177
           TLRLIVINLTLAGK+TYQ TVE  +G+KG++L+L +NGLFA            DTIPH L
Sbjct: 117 TLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVL 176

Query: 178 QSIFHSSN----FFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXX 233
           +++F  ++    F+ RRNV+I +VT+FIS+PLSL+RNI  LSKASFLA+           
Sbjct: 177 RAVFSQNDGEVHFWLRRNVIIVLVTIFISFPLSLKRNIEGLSKASFLAVISMIIIVLTVV 236

Query: 234 XQGPRVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFAR 293
            +GP +    KG      D  + + IFR +SVISFALVCHHNTSFIFFS++NRS+ KF R
Sbjct: 237 IRGPMLPYDWKGHSLKWPDFLVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTR 296

Query: 294 LTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPL 353
           LTHIS  IS+I C LMG+SG++ F++KTKGN+LNNFP  D  IN+ARLCFGFNMLTTFP+
Sbjct: 297 LTHISIIISVICCGLMGFSGFAAFKEKTKGNVLNNFPGTDTAINVARLCFGFNMLTTFPM 356

Query: 354 EIFVLRDVIAAFLYG----KKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGAL 409
           EIFVLRDV+   L+     K  ++ T+   LS ++  IIT++ V  TMSISLTTCNLGAL
Sbjct: 357 EIFVLRDVVGNSLHECHLIKSYDEHTQ---LSDKQHTIITSLLVFITMSISLTTCNLGAL 413

Query: 410 FELIGATTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVV 469
           FELIG+TTASTMAYILPPYTNL+L+ +   ++ K+P+YLCI FGFM+MIVSSTQTI++ +
Sbjct: 414 FELIGSTTASTMAYILPPYTNLLLTSKKKNWKAKLPYYLCICFGFMIMIVSSTQTILDAI 473

Query: 470 KGSDQRHCEL 479
            G+D++HCE+
Sbjct: 474 NGADEQHCEI 483

>NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1.80
           YEL064C
          Length = 445

 Score =  482 bits (1241), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 246/430 (57%), Positives = 303/430 (70%), Gaps = 8/430 (1%)

Query: 56  DESMVINLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXV 115
            E +   L+ +N+KKS +  AFMNMANSILGAG++ QP A++N                V
Sbjct: 18  SEELAKELIEENEKKSNVYMAFMNMANSILGAGIITQPLAVKNAGILGSIICYILLGFIV 77

Query: 116 DWTLRLIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPH 175
           DWTLRL+VIN+TL+ K+TYQDTVE  +G+KG+ L+L  NGLFA            DTIPH
Sbjct: 78  DWTLRLLVINITLSSKQTYQDTVEHVMGKKGKFLILGCNGLFALGGCIGFSIIIGDTIPH 137

Query: 176 FLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQ 235
            L+  F+S      RN+VI + TLFISYPLSL RNIAALSKASFLAL            +
Sbjct: 138 VLRIFFNSEKI--TRNMVIFLTTLFISYPLSLLRNIAALSKASFLALVSMVVIVFTVVIR 195

Query: 236 GPRVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLT 295
           GP +   LKG+  S + +F S ++F+ +S+ISFALVCHHNTSFIF SI+N+SL KF +LT
Sbjct: 196 GPALPSELKGEPLSHSSLFFSPSLFKSLSIISFALVCHHNTSFIFHSIRNKSLTKFTKLT 255

Query: 296 HISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEI 355
           HIS FIS+ FCMLMGYSG+ +F DKTKGNILNNFP  D +INIAR+CFGFNMLTTFPLEI
Sbjct: 256 HISVFISVAFCMLMGYSGFFIFTDKTKGNILNNFPAKDNIINIARICFGFNMLTTFPLEI 315

Query: 356 FVLRDVIAAFLYG----KKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFE 411
           FVLRDV+A  L        EE+    P LS +  F ITT  V  +M ISL TCNLGALFE
Sbjct: 316 FVLRDVVAVILLECHLVPSEENNPLLPYLSRKWHFCITTGLVFLSMGISLMTCNLGALFE 375

Query: 412 LIGATTASTMAYILPPYTNLVLSKEAN--TFRQKVPHYLCIFFGFMVMIVSSTQTIIEVV 469
           LIG+TTAS MAYILPPY NL+L ++ N  +F  K+PHY CIFFGF VMI+SST+TI++ V
Sbjct: 376 LIGSTTASVMAYILPPYVNLLLRQQRNELSFTTKLPHYFCIFFGFTVMIISSTETILDAV 435

Query: 470 KGSDQRHCEL 479
            G++Q+HCE+
Sbjct: 436 FGTEQKHCEI 445

>Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  479 bits (1234), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 267/488 (54%), Positives = 335/488 (68%), Gaps = 14/488 (2%)

Query: 1   MPKNDGYSRLEEQSERIPLELEFELVDFDAKPGASDETXXXXXXXXXXXXXXXXI----D 56
           M +   Y++LE +     L  EFEL DF   PG +D                  I    D
Sbjct: 1   MAELGAYTKLENKE----LRTEFELTDFPL-PGITDNNSDDRSQGKDSLKAIYPIASDTD 55

Query: 57  ESMVINLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVD 116
           +++V  +L +NDKKS+MR AFMN+ANSILGAG++ QPFAI+N                VD
Sbjct: 56  DTLVNKVLLENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLISYIALGFIVD 115

Query: 117 WTLRLIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHF 176
           WTLRLIVINLTLAGK+TYQ TVE  +G+KG++L+L +NGLFA            DTIPH 
Sbjct: 116 WTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHV 175

Query: 177 LQSIFHSSN----FFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXX 232
           L++IF   +    F+ RRNV+I IVT+FIS+PLSL+RNI ALSKASFLA+          
Sbjct: 176 LRAIFSQKDGDIHFWLRRNVIIIIVTIFISFPLSLKRNIEALSKASFLAVISMIIIVVTV 235

Query: 233 XXQGPRVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFA 292
             +GP +    KG    L D F+ + IFR +SVISFALVCHHNTSFIFFS++NRS+ KF 
Sbjct: 236 VIRGPMLPYDWKGHSLQLRDFFVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFT 295

Query: 293 RLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFP 352
           RLTHIS  IS+I C LMGYSG++ F++KTKGNILN+FP  D  INIARLCFGFNMLTTFP
Sbjct: 296 RLTHISIIISVICCGLMGYSGFAAFKEKTKGNILNSFPGTDTAINIARLCFGFNMLTTFP 355

Query: 353 LEIFVLRDVIAAFLYGKK-EEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFE 411
           +EIFVLRDV+   L+  K  ++  E   LS ++  +IT++ V  TM ISLTTCNLGALFE
Sbjct: 356 MEIFVLRDVVGNLLHECKIIKNYDEHTQLSGKQHIVITSLLVFITMGISLTTCNLGALFE 415

Query: 412 LIGATTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKG 471
           LIGATTASTMAYILPPYTNL+L+ +  ++  K+P YLCI FGFM+MI+SSTQTI++ V G
Sbjct: 416 LIGATTASTMAYILPPYTNLLLTSKKKSWSAKLPFYLCICFGFMIMIISSTQTILDAVNG 475

Query: 472 SDQRHCEL 479
           SD +HC++
Sbjct: 476 SDGQHCQI 483

>SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 473

 Score =  478 bits (1231), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 247/461 (53%), Positives = 315/461 (68%), Gaps = 4/461 (0%)

Query: 20  ELEFELVDFDA--KPGASDETXXXXXXXXXXXXXXXXIDESMVINLLRDNDKKSTMRWAF 77
           +L+FEL  FD   +P  +  +                +++ +V  ++ +N  KS +  AF
Sbjct: 14  DLQFELSSFDQHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAF 73

Query: 78  MNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTLAGKKTYQDT 137
           MNMANSILGAG++GQPFAI NC               VDWT+RLIV+NL L GK TYQD+
Sbjct: 74  MNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDS 133

Query: 138 VEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFFRRNVVITIV 197
           VEFA+GR+G++L+L +NGLFA            DTIPH L++ F +    F RN +I  V
Sbjct: 134 VEFAMGRRGKLLILAANGLFAFGGCIGFCIIIGDTIPHVLRAFFPAHTALFHRNAIIFFV 193

Query: 198 TLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQGPRVDMSLKGDKWSLTDIFISS 257
           TLF+SYPLSL R+I+ LSKAS LAL            +GP +D + KG   + + +FI+ 
Sbjct: 194 TLFVSYPLSLNRDISKLSKASMLALASMLLIVVIVIVKGPMLDAAYKGS-LTASKLFITP 252

Query: 258 AIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVF 317
            IF+GISVISFALVCHHNTSFI+FS+KN SL++F +LTH+S  +SM+ C +MGYSG+ VF
Sbjct: 253 RIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVF 312

Query: 318 RDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFLYGKKEEDETEA 377
           +DKTKGNILNNFP DD VIN+AR CFGFNMLTTFPLEIFVLRDV+    +    E  T  
Sbjct: 313 KDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGE-ATAP 371

Query: 378 PPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNLVLSKEA 437
             LST+K   +T+  V  TM++SLTTCNLGALFELIGATTAS MAYILPP TNL+L+  A
Sbjct: 372 AELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRA 431

Query: 438 NTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQRHCE 478
            T RQK+P+Y CI FGF VM++SSTQTI+  + G +Q+HCE
Sbjct: 432 KTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCE 472

>Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}
           similar to Ashbya gossypii AFR671W
          Length = 495

 Score =  476 bits (1224), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 249/476 (52%), Positives = 316/476 (66%), Gaps = 10/476 (2%)

Query: 8   SRLEEQSERIPL--ELEFELV---DFDAKPGASDETXXXXXXXXXXXXXXXXIDESMVIN 62
           S+    S  IP+  +L+FEL    D++  P  S                    ++  V  
Sbjct: 24  SKSTRHSSPIPVSSDLQFELSTFHDYELLPTTSGA--RNNKNVQNNVELNLQFEDPNVSQ 81

Query: 63  LLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLI 122
           L   N  KS M  AFMNMANSILGAGV+GQPFAI+NC               VDWT+RLI
Sbjct: 82  LTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNCGLIGGVCLIVLLTIIVDWTIRLI 141

Query: 123 VINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFH 182
           VINL L GK TYQD+VEFA+G KG++L+L  NGLFA            D+IPH L++ F 
Sbjct: 142 VINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAFGGCVGFCIIIGDSIPHVLKAFFP 201

Query: 183 SSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQGPRVDMS 242
           S +  FRRNVVI++VTLFISYPLSL RNI+ LSKAS LAL            + P+V+  
Sbjct: 202 SHSELFRRNVVISVVTLFISYPLSLNRNISKLSKASMLALVSLLLIVALVIIRAPKVEDE 261

Query: 243 LKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFIS 302
            KG +++  + FI+  +F+GIS+ISFALVCHHNTSFIFFS+KN SL++F  LTHIS  IS
Sbjct: 262 YKG-QFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIIS 320

Query: 303 MIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVI 362
           M+ C++ GY G+  F+DKTKGNILNNFP +D  IN AR CFGFNMLTTFPLEIFVLRDV+
Sbjct: 321 MLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVV 380

Query: 363 AAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMA 422
              LY +  + E+    L+T++ FI+T+V V  +MSISLTTCNLGAL EL+G+TTAS  A
Sbjct: 381 RDLLYFQSADSESII--LTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTTASLTA 438

Query: 423 YILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQRHCE 478
           YILPP T L L+ +  T +++ P+Y CI FGF +MIVSSTQTI+  + G++ +HCE
Sbjct: 439 YILPPATTLALTGKTKTLKERTPYYACIMFGFSIMIVSSTQTILSAIYGTEIKHCE 494

>KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 469

 Score =  474 bits (1219), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 242/467 (51%), Positives = 308/467 (65%), Gaps = 14/467 (2%)

Query: 12  EQSERIPLELEFELVDFDAKPGASDETXXXXXXXXXXXXXXXXIDESMVINLLRDNDKKS 71
              +R PL   FEL  FD       E                  ++      L +   KS
Sbjct: 16  SHDQRGPLGDNFELSSFDRSTEVRPERLSVDS------------EDRFTSTFLHEQRSKS 63

Query: 72  TMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTLAGK 131
            +  AFMNMANSILGAG++GQPFA++NC               VDWT+RLIV+NL ++GK
Sbjct: 64  NILMAFMNMANSILGAGIIGQPFAVKNCGLLGGVLAIVLLSLLVDWTIRLIVVNLRISGK 123

Query: 132 KTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFFRRN 191
            TYQD+VE A+GRKG++L+LLSNGLFA            DTIPH L++ F   +  F RN
Sbjct: 124 TTYQDSVELAMGRKGKLLILLSNGLFAFGGCIGFCIIIGDTIPHVLRAFFSGHDNLFHRN 183

Query: 192 VVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQGPRVDMSLKGDKWSLT 251
           +VI +VT  IS+PLSL R+I+ LSKAS LAL            +GP  D + KG  ++ +
Sbjct: 184 IVIVVVTCLISFPLSLNRDISKLSKASMLALASMVVIVVIVVIKGPGTDSAYKG-SFNSS 242

Query: 252 DIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGY 311
           ++ I+  IF+G+SVISFALVCHHNTSFI+FS+K  SL++F RLTH S FI+MIFC LMG+
Sbjct: 243 NLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGF 302

Query: 312 SGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFLYGKKE 371
           +G+ VF+DKTKGNILNNFP +D  +N+AR CFGFNMLTTFPLEIFVLRDVI   ++    
Sbjct: 303 TGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMF-FNS 361

Query: 372 EDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNL 431
           E +++   LS +   II+T  V  TM+ISLTTCNLGALFELIGATTAS MAYILPP+ NL
Sbjct: 362 EPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNL 421

Query: 432 VLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQRHCE 478
            L      +R ++PHY+CI FGF +M++SSTQTII  + G DQ+HCE
Sbjct: 422 KLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYINGGDQKHCE 468

>NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80
           YEL064C
          Length = 444

 Score =  452 bits (1164), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 233/430 (54%), Positives = 292/430 (67%), Gaps = 8/430 (1%)

Query: 56  DESMVINLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXV 115
            E++V  ++ +N+KKS +  AF+NMANSILGAG++ QP A++N                V
Sbjct: 17  SEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIV 76

Query: 116 DWTLRLIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPH 175
           DWTLRL++ N+TL+ K TY DTVE+ +GRKG+ L+L  NGLFA            DTIPH
Sbjct: 77  DWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALGGCIGFCIIIGDTIPH 136

Query: 176 FLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQ 235
            L+   HS   F  RN VI   TLFISYPLSL R+I+ALS  SFLAL             
Sbjct: 137 VLRIFIHSH--FVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALISMTVIVMTVVVF 194

Query: 236 GPRVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLT 295
           GP +   LKG     +    S ++FR +S++SFALVCHHNTSFIF SI+N+SL KF +LT
Sbjct: 195 GPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLT 254

Query: 296 HISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEI 355
           H+S FIS+IFCM+MGY+G+ +F  KTKGNILNNFP + + INIAR+CFGFNMLTT PLE+
Sbjct: 255 HLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLEL 314

Query: 356 FVLRDVIAAFLYGKK---EEDETEAPPLSTRKL-FIITTVCVVSTMSISLTTCNLGALFE 411
           FVLRDVIA  L   +     +E    P+ TRK  FI+TT+ V  TMS+SL TCNLGALFE
Sbjct: 315 FVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFE 374

Query: 412 LIGATTASTMAYILPPYTNLVL--SKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVV 469
           L+GATTAS MAYILPPY NL+L   KE    + K+PHY CI FGF VMIVSS QTI+E +
Sbjct: 375 LVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTIVEAL 434

Query: 470 KGSDQRHCEL 479
             ++Q+HCE+
Sbjct: 435 ADNEQKHCEI 444

>KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 465

 Score =  419 bits (1077), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 296/464 (63%), Gaps = 13/464 (2%)

Query: 7   YSRL---EEQSERIPLELEFELVDFDAKPGASDETXXXXXXXXXXXXXXXXIDESMVINL 63
           Y++L   ++QS+  P   E EL  FD     +D                   ++ +  ++
Sbjct: 9   YAKLALSDKQSKNEPNPFELELTSFDDTAKTADSAVDQNIFNVNE-------EDPLTDDI 61

Query: 64  LRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIV 123
              N+ KS    AFMNMANSILG+GV+GQPFA++NC               VDWT+RLIV
Sbjct: 62  YLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIV 121

Query: 124 INLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHS 183
           INL L GK TYQ +VE A+G+ G +L+L+SNGLFA            D+IPH L + F S
Sbjct: 122 INLKLTGKSTYQASVETAMGQWGGLLILVSNGLFAFGGCVGFCIIIGDSIPHVLSAFFPS 181

Query: 184 SNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQGPRVDMSL 243
               F RNV+IT+VTLFIS+PLSL R+I+ LSK S LAL            + P V    
Sbjct: 182 HTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMLALLGLIAIVIIIVVKAPLVSGEY 241

Query: 244 KGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISM 303
           KG  + L  +FI+  IF+GISVISFALVCHHNTSFIFFS++N SL++F +LTH+S  +S 
Sbjct: 242 KG-TFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSC 300

Query: 304 IFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIA 363
           I C+   YSG+  F+DKT GNILNNFP DD VIN ARL  GFNMLTTFPLEIFVLRDVI 
Sbjct: 301 IVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIR 360

Query: 364 AFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAY 423
             +Y  K  D+ E   L+T+   +IT+  V+  M I+L+T NLGAL E+IGAT+AS MAY
Sbjct: 361 DIIYYNK--DDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAY 418

Query: 424 ILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIE 467
           ILPP TNLV++ +  + ++K+P+  CI FG ++M VS+ QTI+E
Sbjct: 419 ILPPLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILE 462

>AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL064C (AVT2)
          Length = 488

 Score =  399 bits (1026), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 206/388 (53%), Positives = 259/388 (66%), Gaps = 3/388 (0%)

Query: 91  GQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTLAGKKTYQDTVEFALGRKGRILV 150
           G    ++NC               VDWT+RLI+INL L GK TYQDTVEFA+GR G+  V
Sbjct: 103 GSRLRLKNCGLLGGLVLTMLLTVIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAV 162

Query: 151 LLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRN 210
           L +NG+FA            D+IPH L++ F +   +F RN++ITIVT+F+SYPLSL RN
Sbjct: 163 LFANGMFAFGGCVGFCIIIGDSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRN 222

Query: 211 IAALSKASFLALXXXXXXXXXXXXQGPRVDMSLKGDKWSLTDIFISSAIFRGISVISFAL 270
           I+ LSKAS LAL            +GP V    +G  + L ++F+   +F+GISVISFAL
Sbjct: 223 ISKLSKASMLALVSLLLIVVIIVVRGPTVGNDYRGS-FDLEELFVKPRLFQGISVISFAL 281

Query: 271 VCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFP 330
           VC HNTSFI+FS++  SL++F  LTHIS  ISM+ C++ GYSG+  F+ KTKGNILNNFP
Sbjct: 282 VCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFP 341

Query: 331 QDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITT 390
             D  IN AR CFGFNMLTTFPLEIFVLRDVI   +    E  + E   LST++ FIITT
Sbjct: 342 SSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI--STETPKGEPLRLSTKRHFIITT 399

Query: 391 VCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCI 450
             V+STM ISLTTCNLGAL EL+G+TTAS  AYILPP TNL+L+ E    ++K+PHY CI
Sbjct: 400 ALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACI 459

Query: 451 FFGFMVMIVSSTQTIIEVVKGSDQRHCE 478
            FGF +M++SSTQ II  +       C+
Sbjct: 460 LFGFSIMVISSTQAIITAIHSDKSSQCD 487

>KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {ON}
           Anc_1.80 YEL064C
          Length = 513

 Score =  345 bits (885), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 195/468 (41%), Positives = 274/468 (58%), Gaps = 55/468 (11%)

Query: 55  IDESMVINLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXX 114
           ++  ++  ++  N++KS +  AFMNMANSILGAG++ QPFA+R                 
Sbjct: 22  LENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFL 81

Query: 115 VDWTLRLIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIP 174
           VDWTLRLIV NL + G +TYQ++V  ALG  GR+ +LL+NGLFA            DTIP
Sbjct: 82  VDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTIP 141

Query: 175 HFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXX 234
           H L+++      +  RN VI +VTL IS PLSL + I  L +ASFLAL            
Sbjct: 142 HVLRTVCPPQ--YIERNWVIIVVTLLISLPLSLSKKIKQLERASFLALVSMAVIVVTVAV 199

Query: 235 QGP------RVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSL 288
           +GP      +  +SL   +W     +    IF+ +S++SFALVCHHNTSFIF S++N+S+
Sbjct: 200 RGPFLPSELKSQVSLFAPQW-----WFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSI 254

Query: 289 QKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNML 348
            KF RLTH S  +S+  CMLMGY+G+  F++KTKGN+LNNF  DD  IN+ARL FGFNML
Sbjct: 255 YKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNML 314

Query: 349 TTFPLEIFVLRDVIAAFLYG--------------KKEEDETEAPP--------------- 379
           TTFPLEIFVLR+V+     G              +     T+ PP               
Sbjct: 315 TTFPLEIFVLRNVVLDIWAGPTHRWYQHRRHHPPRGGHTATQQPPPPEPHGSSPARGPAG 374

Query: 380 ----------LSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYT 429
                      S +    +T V V++TM ++L TCNLGAL E+IG+TT +  AYILPP T
Sbjct: 375 PHPGLPPDPEPSEQPHTAVTVVLVLATMGVALVTCNLGALLEVIGSTTGALTAYILPPLT 434

Query: 430 NLVLSK---EANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQ 474
           +++L++   + +T R+++ H  C+ FG  VM+VS+TQT+++  + + +
Sbjct: 435 HVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVSTTQTLLDWSRSAGR 482

>ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 436

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 142/332 (42%), Gaps = 40/332 (12%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D IP    + F S+     RN  IT+V LF+  PL   + + +L KAS +AL        
Sbjct: 104 DLIPQIFTT-FTSNKILLERNFHITMVMLFLVSPLCFMKRLTSLRKASLVALSSVAYLCC 162

Query: 231 XXXXQ--GPRVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSL 288
                   P  ++  +  K S+            + +  FA  CHHN   ++   K+ S 
Sbjct: 163 LVVVHFIWPSNEIDQRKGKVSIGFPRNEPTPLTTLPIFVFAYTCHHNAFSVYNEQKDTST 222

Query: 289 QKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNML 348
           ++  ++      I+ +   ++G +GY  F D   GNI+  +P   L   I R+     ++
Sbjct: 223 RQLNKIGRYGMSIAFVLYTIIGGAGYLTFGDHIAGNIITLYP-PSLSTTIGRVAIVLLVM 281

Query: 349 TTFPLEIFVLRDVIAAFLY-------------------GKKEEDETEA-----PPLSTRK 384
             FPL+    R  I   LY                    ++E  E++A     PPL  ++
Sbjct: 282 LAFPLQCHPARSSINNILYSFQSVEKNLQGQTENSNLISEEESVESQAHGPPVPPLQGKR 341

Query: 385 LFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP----------PYTNLVLS 434
             +IT V ++++  ++++  +L  L  ++G+T ++++++ILP           YT   L 
Sbjct: 342 FTVITLVILIASYLLAISVTSLARLLAIVGSTGSTSISFILPGIFGYWLIGSEYTPEELP 401

Query: 435 KEANTFRQKVPHYLCIFFGFMVMIVSSTQTII 466
           +  N    K    L   +GF+VMI S   +I+
Sbjct: 402 R--NLKFAKFAGLLLAIWGFIVMIASLAASIL 431

>Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119C -
           Hypothetical ORF [contig 33] FULL
          Length = 467

 Score = 81.6 bits (200), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 121/289 (41%), Gaps = 35/289 (12%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P    + F S +    RN  IT+V   I  PL   R + +L  AS +A+        
Sbjct: 127 DLMPRIFAT-FTSHSLLLNRNFHITLVMALIVSPLCFMRRLDSLRYASMIAVSSVAYLCV 185

Query: 231 XXXXQG--PRVDM-SLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRS 287
                   P  ++  LKG           SA+     +  FA  CHHN   I   +++ S
Sbjct: 186 LVVVHFLFPSEELRELKGYVSIQKPAGSFSALLSCFPIFVFAYTCHHNMFSIINELRDNS 245

Query: 288 LQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNM 347
           L+   ++  IS  +SM   +L+G SGY+ F D   GNI+  +PQ      I R+     +
Sbjct: 246 LKGIYKVCAISVALSMTLYLLIGGSGYATFGDNVPGNIITLYPQST-TTTIGRVAIALLV 304

Query: 348 LTTFPLEIFVLRDVI-------------------AAFLYGK--------KEEDETEAP-- 378
           +  FPL+    R  I                   A+ L            EED  + P  
Sbjct: 305 MLAFPLQCHPARASIDHIIQYFSKASDNPLQNSEASHLISSPRVSEDVMAEEDSPQQPQV 364

Query: 379 -PLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP 426
            PL  ++   IT   ++ +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 365 VPLEGKRFIAITAGILIFSFLLAISVTSLARVLAVVGATGSTSISFILP 413

>KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 445

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 126/291 (43%), Gaps = 37/291 (12%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P    + F S      RN+ IT+V LF+  PL   + + +L  AS +A+        
Sbjct: 104 DLMPRIFAT-FTSHGLLLSRNLHITLVMLFVVSPLCFMKRLDSLRYASMVAISSVAYLCV 162

Query: 231 XXXXQ--GPRVDM-SLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRS 287
                   P  ++  L+G       +   +A+     +  FA  CHHN   I   +++ S
Sbjct: 163 LVLVHYVWPSDEIRELRGHVSLGKPVGSFAALLSCFPIFVFAYTCHHNMFSIVNELRDNS 222

Query: 288 LQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNM 347
           L+   +++ IS  ++M   +L+G SGY+ F D   GNI+  +PQ      + R+     +
Sbjct: 223 LKGIYKVSIISVALAMSLYLLIGGSGYATFGDNVAGNIIMLYPQSA-ATTVGRVAIALLV 281

Query: 348 LTTFPLEIFVLRDVIAAFLY----GKKE-------------------ED---ETEAP--- 378
           +  FPL+    R  +   L+    GK                     ED   E   P   
Sbjct: 282 MLAFPLQCHPARASVDHILHYFGAGKSHEAAPSPSSESSQLIPSSDTEDIVVEEGGPRQL 341

Query: 379 ---PLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP 426
              PL  ++   ITT  ++ +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 342 AVMPLEGKRFIAITTSILLLSYLLAISVTSLARVLAVVGATGSTSISFILP 392

>TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {ON}
           Anc_7.420 YER119C
          Length = 454

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 126/303 (41%), Gaps = 52/303 (17%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D  P  + S+F S++    RNV IT++ LFI  PL   + +++L  AS +AL        
Sbjct: 104 DLTPQ-IASVFTSNHLLLDRNVHITLIMLFIVSPLCFLKRLSSLRYASLIALLSVAYLCV 162

Query: 231 XXXXQ--GPRVDM-SLKGDK--WSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKN 285
                   P  ++  LKG    W   D    +     + +  FA  CHHN   +    K+
Sbjct: 163 LIFIHFVWPSEEIHDLKGHVSLWIPHD---ETNPLTTLPIFVFAYTCHHNMFSVINEQKD 219

Query: 286 RSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGF 345
            S +   ++   + F+++   +L+G  GY  F D   GNI+  +PQ      + R+    
Sbjct: 220 TSFRHIKKVAIYAMFLALSLYLLIGGMGYLTFGDHIIGNIIKLYPQFA-STTVGRIAIVL 278

Query: 346 NMLTTFPLEIFVLRDVIAAFLY-------------------------------GKK---- 370
            ++  FPL+    R  I   L+                               G +    
Sbjct: 279 LVMLAFPLQCHPARASINHILFYLQEHLSQSKQNTRTDNTANAVDEASTLIVNGDQEYMI 338

Query: 371 ----EEDETEAP---PLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAY 423
               EED    P   PL  RK  IIT   ++++  ++++  +L  +  ++G+T ++++++
Sbjct: 339 DELIEEDSANQPPVVPLHGRKFVIITIFLLLASYLLAISVSSLARVLAVVGSTGSTSISF 398

Query: 424 ILP 426
           ILP
Sbjct: 399 ILP 401

>KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.420
           YER119C
          Length = 461

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/366 (22%), Positives = 150/366 (40%), Gaps = 87/366 (23%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P  + S++ S+     R+  IT+V +FI  PL   + + +L  AS +A+        
Sbjct: 104 DLLPQ-IWSVWTSNKLLLNRDFHITMVMIFIVAPLCFMKKLNSLRYASMIAISAVAYLCV 162

Query: 231 XXXX----QGP----------RVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNT 276
                   Q P          R+ + L  D+           I   + +  FA  CHHN 
Sbjct: 163 LVIYHFIFQDPNDTHFQDLKGRISIGLPRDE---------PPILTTLPIFVFAYTCHHN- 212

Query: 277 SFIFFSIKNRSL-QKFARLTHISTF---ISMIFCMLMGYSGYSVFRDKTKGNILNNFPQD 332
               FS+ N  + QKF  +T I+ +   ++ +  +++GYSGY  F DK  GNI+  +P +
Sbjct: 213 ---MFSVINEQVDQKFNVITKIAKYSMSLAFLLYIVIGYSGYLTFGDKIVGNIVTLYP-N 268

Query: 333 DLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFLY---------------------GKKE 371
           +    I R+     +  TFPL+    R  I   ++                     G   
Sbjct: 269 NASSTIGRIAIAILVTLTFPLQCHPARASIHHIIHFFQARSAENGNGSAMVLNQMEGVSP 328

Query: 372 EDET------------------------EAPPLSTRKLFIITTVCVVSTMSISLTTCNLG 407
           E ET                        +  PL  ++   IT   +  +  ++++  +L 
Sbjct: 329 ELETTPLTDAANCAEVDTAIEEGSPEELQVMPLEGKRFIFITCTILFCSYLLAVSVTSLA 388

Query: 408 ALFELIGATTASTMAYILPP-YTNLVLSKEANT-----FRQKVPHY--LCI-FFGFMVMI 458
            +  ++GAT ++++++ILP  +   ++  E  T     F+ K+  Y  LC+  +G +VM+
Sbjct: 389 KVLAIVGATGSTSISFILPGIFGYKLIGSECETGAELPFQTKMFKYLGLCLAVWGLVVMV 448

Query: 459 VSSTQT 464
            S T T
Sbjct: 449 ASLTAT 454

>CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119c
          Length = 445

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 117/295 (39%), Gaps = 44/295 (14%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P     +  SS     RNV IT+V LFI  PL   R + +L  AS +A+        
Sbjct: 103 DLMPKIWSRV-SSSGLLLSRNVNITLVMLFIVGPLCFMRRLNSLRYASMIAIGSVAYLCI 161

Query: 231 XXXXQGPRVDMSLKGDKWSLTDIFISSAIFRG-------ISVISFALVCHHNTSFIFFSI 283
                       L+  K       +S  +  G       + +  FA  CHHN   +    
Sbjct: 162 LVIVHFAHQTTELRELKGE-----VSVGLPHGEPTPLTTLPIFVFAYTCHHNMFSVINEQ 216

Query: 284 KNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCF 343
           KN        +  +S  ++ +  +++G +GY  F D   GNI+  +P D L   I R+  
Sbjct: 217 KNTGFTYVRYIAIVSILVAFVLYVVIGSTGYLTFGDNITGNIIALYP-DTLSTTIGRIAI 275

Query: 344 GFNMLTTFPLEIFVLRDVIAAFL------YGKK------------------------EED 373
              ++  FPL+    R+ I   +      Y  +                          +
Sbjct: 276 VLLVMLAFPLQCHPARESINNMIKYVQDRYSPQTSYELTAVDADNLEINNDVTSINSRAN 335

Query: 374 ETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPY 428
           + E   + T++  IIT   +  +  ++++  +L  +  ++GAT ++T+++ILP Y
Sbjct: 336 DKEEECMDTKRFMIITACILFCSYLLAISVTSLARVLAIVGATGSTTISFILPGY 390

>KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {ON}
           Anc_7.420 YER119C
          Length = 445

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 90/352 (25%), Positives = 146/352 (41%), Gaps = 71/352 (20%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P    ++F +S+    R+  I+++ LFI  PL   R + +L  AS +A+        
Sbjct: 104 DLMPQIF-AVFTTSHILLNRDFHISLIMLFIVSPLCFLRKLNSLRYASMIAISAVAYLCV 162

Query: 231 XXXX----QGPRVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNR 286
                   Q   V   LKG   S+       +    + +  FA  CHHN    FFS+ N 
Sbjct: 163 LVVAHFIFQTEDVH-DLKG-VVSIGLPKHEPSPLTTLPIFVFAYTCHHN----FFSVINE 216

Query: 287 SLQKFARLTHIS--TFISMIFC----MLMGYSGYSVFRDKTKGNILNNFPQDDLVINIAR 340
             Q     THI     I+MI      +L+G+SGY  F D   GNI+  +P+      I R
Sbjct: 217 --QSNIAFTHIKKIPIIAMILAYLLYILIGFSGYLTFGDNIVGNIITLYPRTASS-TIGR 273

Query: 341 LCFGFNMLTTFPLEIFVLRDVIAAFLYGKK----------------------------EE 372
           L   F ++  FPL+    R  I    +  +                            EE
Sbjct: 274 LAIVFLVMLAFPLQCHPCRASIHHIWHYIQEKNSNEIATQPINVPPDEEDTLLAVELIEE 333

Query: 373 DETEAP---PLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP--- 426
           D  + P   PL  ++  IIT   ++ + +++++  +L  +  ++GAT ++++++ILP   
Sbjct: 334 DSPKQPEEIPLRGKRFNIITVCILLFSYTLAISVNSLAKVLAIVGATGSTSISFILPGIF 393

Query: 427 ---------PYTNLVLSKEANTFRQKVPHYLCIF---FGFMVMIVSSTQTII 466
                      T+  L K A  FR     YL +F   +G  VMI S   T++
Sbjct: 394 GFKLIGSEFSATSSPLPKSARFFR-----YLGLFLSIWGLFVMIASLAATLL 440

>Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON}
           (42445..43845) [1401 nt, 467 aa]
          Length = 466

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 95/218 (43%), Gaps = 17/218 (7%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P  L S F +  +   RNV IT+V LFI  PL   +N+ +L  AS LA+        
Sbjct: 104 DVLPQVL-STFTNHEWLLNRNVNITLVMLFIVTPLCFLKNLNSLRYASMLAISSVAYLCA 162

Query: 231 XXXXQ--GPRVDM-SLKGD-KWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNR 286
                   P  +  + KGD  W L    ++      + +  FA  CHHN     FS+ N 
Sbjct: 163 LVLIHFIMPNDETHNFKGDVSWGLPKNGLNP--LTTLPIYVFAYTCHHN----MFSVINE 216

Query: 287 SL----QKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLC 342
            +        ++  IS  ++    +L+G +GY  F D   GNI+  +PQ ++   I R+ 
Sbjct: 217 QMDPTYNSVKKIAIISMILAGFLYILIGGAGYLTFGDHITGNIITLYPQ-NISTTIGRIA 275

Query: 343 FGFNMLTTFPLEIFVLRDVIAAFL-YGKKEEDETEAPP 379
             F +   FPL+    R  I   + Y K  +D   + P
Sbjct: 276 IIFLVTLAFPLQCHPARASINHIIHYFKPAQDNKNSNP 313

>SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]
           {ON} similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 510

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 74/363 (20%), Positives = 146/363 (40%), Gaps = 68/363 (18%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P    + F S      RN  IT+V +FI  PL   + + +L  AS +A+        
Sbjct: 146 DLLPQIFSN-FTSHEILLERNFHITVVMIFIVAPLCFMKRLDSLRYASMIAISAVGYLCV 204

Query: 231 XXXXQG--PRVDMS-LKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRS 287
                   P  ++  LKG         + +++     +  FA  CHHNT  I   +K+ S
Sbjct: 205 LVVAHFLFPSQEIKDLKGTVSLFRPKGLHTSMLSSFPIFVFAYTCHHNTFSIVNELKDNS 264

Query: 288 LQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNM 347
           ++   ++   +  +++   + +G SGY  F D   GNI+  +P       + R+     +
Sbjct: 265 VENVRKVVIGAMGLAVCLYIAIGGSGYGTFGDNIGGNIIMLYPHST-STTVGRIAIVLLV 323

Query: 348 LTTFPLEIFVLRDVIAAFLY------------GKKEED---------------------- 373
           +  FPL+    R  I   ++            G++ E                       
Sbjct: 324 MLAFPLQCHPARASINHIIHHLFEERRGGAQNGEERESNAASKNRTDESACNGNSESSRL 383

Query: 374 ----ETEAP----------------PLSTRKLFIITTVCVVSTMSISLTTCNLGALFELI 413
               ET  P                PL  RK  +IT+  ++ + +++++  +L  +  ++
Sbjct: 384 VQSTETSIPVDELIEECSARQPKVVPLEGRKFVVITSCILIFSYALAVSVTSLARVLAVV 443

Query: 414 GATTASTMAYILPPY--TNLVLSKEANT----FRQKVPHYLCI---FFGFMVMIVSSTQT 464
           GAT ++++++ILP      L+ S+  NT    ++ +   Y+ +    +G +VM+   + T
Sbjct: 444 GATGSTSISFILPGIFGYQLIGSEYENTSEMPWKTRWTKYIALALTCWGLVVMVTCLSAT 503

Query: 465 IIE 467
           ++ 
Sbjct: 504 LLS 506

>YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative
           transporter, member of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 459

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/351 (22%), Positives = 143/351 (40%), Gaps = 69/351 (19%)

Query: 171 DTIPHFLQSIFHSSN----------FFFRRNVVITIVTLFISYPLSLQRNIAALSKASFL 220
           D +P  +QSIF+ ++           F  R + IT++ +F+  PL  +R++ +L  AS +
Sbjct: 105 DLVPQIVQSIFYRNDDNMSGSQEHHMFLDRRLYITLIIVFVISPLCFKRSLNSLRYASMI 164

Query: 221 A---------LXXXXXXXXXXXXQGPRVDMSLKGDKWSLTDIFISSAIFRGISVISFALV 271
           A         L            +G    M   GD  S + +         + +  FA  
Sbjct: 165 AIVSVAYLSGLIIYHFVNRHQLERGQVYFMVPHGDSQSHSPL-------TTLPIFVFAYT 217

Query: 272 CHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQ 331
           CHHN   +     ++S +   R+   +  ++    +++G +GY  F +   GNIL  +P 
Sbjct: 218 CHHNMFSVINEQVDKSFKVIRRIPIFAIVLAYFLYIIIGGTGYMTFGENIVGNILTLYP- 276

Query: 332 DDLVINIARLCFGFNMLTTFPLEIFVLRD-------VIAAFLYGK--------------K 370
           + +   I RL     ++  FPL+    R         I  F  GK               
Sbjct: 277 NSISTTIGRLAMLLLVMLAFPLQCHPCRSSVKNIIIFIENFRKGKLYDNRASFIPLDNFN 336

Query: 371 EEDETEAPPL-----------STRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTAS 419
            ED  EAP             S R + IIT   ++ +  ++++  +L  +  ++GAT ++
Sbjct: 337 SEDPQEAPTQQNNEEPNLRSESLRHINIITLCILLFSYLLAISITSLAKVLAIVGATGST 396

Query: 420 TMAYILPP-YTNLVLSKEANTFRQKVPHYLCIF---------FGFMVMIVS 460
           ++++ILP  +   ++  E     ++VP  + IF         +G  VM+ S
Sbjct: 397 SISFILPGLFGYKLIGSEFTGTNERVPTSIKIFKYLSLSLFIWGIAVMVAS 447

>KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 456

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/352 (22%), Positives = 143/352 (40%), Gaps = 62/352 (17%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P  + S F +  +   R   IT VTL I  PL   + + +L   S +A+        
Sbjct: 104 DLLPQIM-STFTTHGWLLSRQFHITAVTLIIVTPLCFIKKLDSLRYTSSIAITAVGYLCV 162

Query: 231 XXXXQ--GPRVDMS-LKGDK--WSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKN 285
                   P  ++  L+G    W  +D+   S++     +  FA  CHHN   I     +
Sbjct: 163 LVVFHFAVPNSEIDHLRGHVSIWKPSDV--DSSMLSSFPIFVFAYTCHHNMFSIINEQSD 220

Query: 286 RSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGF 345
           +SL    +L  I+  ++M   + +G  GY  F D   GNI+  +P + +   I R+    
Sbjct: 221 KSLDSITKLIRIAITLAMSLYISIGALGYCTFGDHITGNIITLYP-NSISSTIGRIAIAL 279

Query: 346 NMLTTFPLEIFVLRDVIAAFL-YGKK---------------------------------- 370
            ++  FPL+    R  +   L Y  K                                  
Sbjct: 280 LVILAFPLQCHPARASVNHILHYFSKGNTHPPMTTTSAEQNSLLRDSELESSEQLTYECE 339

Query: 371 ----EEDETEAPPLST----RKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMA 422
               EE+    PP+ T    R +FI + + + S + ++++  +L  +  ++GAT +++++
Sbjct: 340 DELIEENSANQPPVVTLEGPRFIFITSGILLFSYI-LAMSVTSLANVLSIVGATGSTSIS 398

Query: 423 YILPPY--TNLVLSKEANTFRQ-------KVPHYLCIFFGFMVMIVSSTQTI 465
           +ILP      L+ S+ A +          ++   L   +GF+VMI S + TI
Sbjct: 399 FILPGIFGYKLIASEYAKSVVPPAKERILRIISLLLAIWGFIVMITSLSATI 450

>TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7.420
           YER119C
          Length = 464

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/332 (22%), Positives = 128/332 (38%), Gaps = 63/332 (18%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P  L + F  + FF  RNV ITIV LFI  PL   +N+ +L  AS  A+        
Sbjct: 104 DVMPQILGT-FTDTEFFLNRNVNITIVMLFIVTPLCFLKNLNSLRYASIAAISAVIYLCF 162

Query: 231 XXXXQGPRVDMSLKGDKWSLTDIFISSAI--FRGISVISFALVCHHNTSFIFFSIKNRSL 288
                    +  ++  +  ++  F    +     + +  FA  CHHN     FS+ N   
Sbjct: 163 LVMFHFFIPNEEIRDTRGPVSWGFPKDGLNPLNTLPIFVFAYTCHHN----MFSVINEQQ 218

Query: 289 Q-KFARLTHISTFISMIFCML---MGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFG 344
              F +L  I  F  ++ C L   +G SGY  F +   GNI+  +  +     + R+   
Sbjct: 219 DIHFNKLKQICIFAMLLACTLYIIIGGSGYLTFGNAITGNIITLY-SNSAATTVGRIAIV 277

Query: 345 FNMLTTFPLEIFVLRDVIAAFLY-----------------GKKE---------------E 372
             ++  FPL+    R  I   L+                 G +E               +
Sbjct: 278 ILVMLAFPLQCHPARASINHILHYFQLINCDNNQVQESESGHRESSGLIDNEITPQPQLQ 337

Query: 373 DETEAPPLST------------------RKLFIITTVCV-VSTMSISLTTCNLGALFELI 413
           +  E PP                      K F + T+C+ + +  ++++  +L  +  ++
Sbjct: 338 EAFEQPPDEVVEEEFPEQQKSFEPVTLDPKTFTVVTICILICSYILAVSVTSLAKVLAIV 397

Query: 414 GATTASTMAYILPPYTNLVLSKEANTFRQKVP 445
           GAT ++++A+ILP      L     +  Q VP
Sbjct: 398 GATGSTSIAFILPGVFGYQLIGSEYSTSQIVP 429

>TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.252
           YKL146W
          Length = 523

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 122/282 (43%), Gaps = 32/282 (11%)

Query: 200 FISYPLSLQRNIAALSKASFLA--------LXXXXXXXXXXXXQGP--RVDMSLKGDKWS 249
           F+  PLS  RNI  LS  + +A        +            +GP  +         WS
Sbjct: 255 FLFIPLSFTRNITKLSSTALIADLFIFIGLIYLYYYPIKIIATKGPDWQTMTPFNTKDWS 314

Query: 250 LTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFAR-LTHISTFISMIFC 306
           L   FI +AIF   GI ++            I      +S   F + L  +   I+++F 
Sbjct: 315 L---FIGTAIFTYEGIGLL------------IPIQESMKSPHHFKKSLILVLVIITLVF- 358

Query: 307 MLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFL 366
           + +G  GYS F       +L NFPQD+   ++ +L +   +L + PL++F    ++  ++
Sbjct: 359 ITIGLLGYSAFGSNVDTVLLQNFPQDNPCTSLVQLLYSLAILLSTPLQLFPAIKILENWI 418

Query: 367 YGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP 426
           + K    +     +   K +  +T+ +++++   L   +L     L+G+     + Y+ P
Sbjct: 419 FSKDASGKYNH-SIKWAKNYFRSTIVILTSLISYLGANDLNKFVALVGSFACIPLIYVYP 477

Query: 427 PYTNLVLSKEANTFRQK--VPHYLCIFFGFMVMIVSSTQTII 466
           P  +   ++  NTF  K  +  +  + FG + MI +S QTII
Sbjct: 478 PLLHYKATQLDNTFTWKTLLADFSLLTFGIITMIYTSLQTII 519

>YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}
           AVT6Vacuolar aspartate and glutamate exporter; member of
           a family of seven genes (AVT1-7) related to vesicular
           GABA-glycine transporters; involved in
           compartmentalizing acidic amino acids in response to
           nitrogen starvation
          Length = 448

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 126/304 (41%), Gaps = 56/304 (18%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P  + S++  + +   RNV I+++ LF   PLS  + + +L  AS +A+        
Sbjct: 104 DLMPQIM-SVWTRNAWLLNRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCV 162

Query: 231 XXXXQ--GPRVD-MSLKGD-KWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNR 286
                   P  + + LKG   + L        +   + +  FA  CHHN     FSI N 
Sbjct: 163 LVLLHYVAPSDEILRLKGRISYLLPPQSHDLNVLNTLPIFVFAYTCHHN----MFSIINE 218

Query: 287 SLQKFARLTH------ISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIAR 340
             Q+ +R  H      I+  +++I  + +G +GY  F D   GNI+  +PQ  +   I R
Sbjct: 219 --QRSSRFEHVMKIPLIAISLALILYIAIGCAGYLTFGDNIIGNIIMLYPQ-AVSSTIGR 275

Query: 341 LCFGFNMLTTFPLEIFVLRDVIAAFLYGKKEED--------------------------- 373
           +     ++  FPL+    R  I   L    EE+                           
Sbjct: 276 IAIVLLVMLAFPLQCHPARASIHQILQHFAEENVSISATSADEPTVATESSPLIRDSSLD 335

Query: 374 -----------ETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMA 422
                      + +  PL  +   +IT   +V++  ++++  +L  +  ++GAT +++++
Sbjct: 336 LNEVIEEESIYQPKETPLRGKSFIVITCSILVASYLVAISVSSLARVLAIVGATGSTSIS 395

Query: 423 YILP 426
           +ILP
Sbjct: 396 FILP 399

>Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 81/353 (22%), Positives = 146/353 (41%), Gaps = 63/353 (17%)

Query: 171 DTIPHFLQSIFHSSN----------FFFRRNVVITIVTLFISYPLSLQRNIAALSKASFL 220
           D +P  +QSIF+ ++              R + IT+V +F+  PL  +R++ +L  AS +
Sbjct: 105 DLVPQIVQSIFYHNDDSTGGLQEHHRLLDRRLYITLVMMFVIAPLCFKRSLNSLRYASMI 164

Query: 221 ALXXXXXXXXXXXXQGPRVDMSLKGDKWSLTDIFISSA--IFRGISVISFALVCHHNTSF 278
           A+                     +G  + +     SS+      + +  FA  CHHN   
Sbjct: 165 AIISVAYLSGLIIYHFLNRHQLERGQVYFMVPHRDSSSHSPLTTLPIFVFAYTCHHN--- 221

Query: 279 IFFSIKNRSLQK-FARLTHISTF---ISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDL 334
             FS+ N    K F  L  I  F    + I  +++G +GY  F +   GNIL  +P + +
Sbjct: 222 -MFSVINEQTDKTFRILRRIPIFAISFAYILYLIIGGAGYMTFGENIVGNILTLYP-NSI 279

Query: 335 VINIARLCFGFNMLTTFPLEIFVLRD-------VIAAFLYGKKEEDET------------ 375
              I RL     ++  FPL+    R         I  F  G+  ++ T            
Sbjct: 280 STTIGRLAMLLLVMLAFPLQCHPCRSSIKNIFIFIEDFRKGRLHDNRTGFIPLDDFNSEE 339

Query: 376 ----------EAPPL---STRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMA 422
                     E P L   S R   +IT   +V +  ++++  +L  +  ++GAT +++++
Sbjct: 340 PHDELSQQSSEGPTLRSESQRHTNVITLCVLVFSYILAISITSLAKVLAIVGATGSTSIS 399

Query: 423 YILPP-YTNLVLSKEANTFRQKVPHYLCIF---------FGFMVMIVSSTQTI 465
           +ILP  +   ++  E     ++VP  + IF         +G ++MI S + T+
Sbjct: 400 FILPGLFGYKLIGSEFTNRNERVPVSIKIFKYLGLSLFIWGLVIMIASLSATV 452

>Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar to
           Ashbya gossypii AGL285C
          Length = 457

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 62/303 (20%), Positives = 126/303 (41%), Gaps = 49/303 (16%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P  + S F S+ +   R + IT+  LFI  PL   R + +L  AS +A+        
Sbjct: 104 DLMPQIV-STFTSNQWLLERTLQITLCMLFIVTPLCFMRKLDSLRYASMVAISSVAYLCV 162

Query: 231 XXXXQGPRVDMSLKGDKWSLTDIFI----SSAIFRGISVISFALVCHHNTSFIFFSIKNR 286
                       ++  K  ++  F     ++++     +  FA  CHHN   I   +++ 
Sbjct: 163 LVVYHFLFPSSDIRQAKGIVSIGFPENNSAASMLSSFPIFVFAYTCHHNMFSIVNELRDN 222

Query: 287 SLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFN 346
           SL    R+  I+  +++    ++G SGY  F D   GNI+  +P+  +   +AR+     
Sbjct: 223 SLTNCVRVVLIAMGLAVSLYTVIGGSGYLTFGDNITGNIVTIYPR-SVSSTLARIAIVLL 281

Query: 347 MLTTFPLEIFVLR----DVIAAFLYGK-------------KEEDETEAPP---------- 379
           ++  FPL+    R    ++   F   K             + E     PP          
Sbjct: 282 VMLAFPLQCHPARASINNIWCYFSESKIFSPLANEESGLMRHEGSPRTPPSNNEFSISPD 341

Query: 380 ----------------LSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAY 423
                           +  ++ F+ITT  ++++ +++++  +   +  ++GAT ++++++
Sbjct: 342 WSPLQTSSQPIPTTTTIEGKRFFVITTSILIASYTLAVSVSSFARVLAIVGATGSTSISF 401

Query: 424 ILP 426
           ILP
Sbjct: 402 ILP 404

>Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/304 (22%), Positives = 122/304 (40%), Gaps = 56/304 (18%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P  + S +  + +   RNV I+++ LF   PLS  + + +L  AS +A+        
Sbjct: 104 DLMPQIMSS-WTGNAWLLSRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCV 162

Query: 231 XXXXQGPRVDMSLKGDKWSLTDIFISSA----IFRGISVISFALVCHHNTSFIFFSIKNR 286
                       +   K  ++ +F   +        + +  FA  CHHN     FSI N 
Sbjct: 163 LVLVHYVVPSDEILRLKGRVSYLFPQQSHDLNFLNTLPIFVFAYTCHHN----MFSIINE 218

Query: 287 SLQKFARLTH------ISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIAR 340
             QK  R  H      IS  +++   + +G +GY  F D   GNI+  +PQ  +   + R
Sbjct: 219 --QKSVRFEHVMKIPLISISLALALYIAIGCAGYLTFGDNIIGNIIMLYPQ-TVSSTVGR 275

Query: 341 LCFGFNMLTTFPLEIFVLRDVIAAFLYGKKEEDET------------------------- 375
           +     ++  FPL+    R  I   L    EE+ T                         
Sbjct: 276 IAIVLLVMLAFPLQCHPARASIHQILQYFTEENATTSTTSVAGRTVTNESSPLIRNNSID 335

Query: 376 ------EAP-------PLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMA 422
                 E P       PL  +   IIT   +V++  ++++  +L  +  ++GAT +++++
Sbjct: 336 INEVIEEEPIYQPKDTPLRGKSFIIITCGILVASYCVAISVSSLAHVLAIVGATGSTSIS 395

Query: 423 YILP 426
           +ILP
Sbjct: 396 FILP 399

>Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C
           (REAL)
          Length = 448

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/304 (21%), Positives = 124/304 (40%), Gaps = 56/304 (18%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P  + S++  + +   RNV I+++ +F+  PLS  + + +L  AS +A+        
Sbjct: 104 DLMPQIM-SVWTRNAWLLSRNVQISLIMVFLVAPLSFLKKLNSLRYASMIAISSVAYLCV 162

Query: 231 XXXXQGPRVDMSLKGDKWSLTDIFISSA----IFRGISVISFALVCHHNTSFIFFSIKNR 286
                       +   K  ++  F   +    I     +  FA  CHHN     FSI N 
Sbjct: 163 LVLVHYIAPSEEILHMKGRISYFFPKQSHDLNILNTFPIFVFAYTCHHN----MFSIINE 218

Query: 287 SLQKFARLTH------ISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIAR 340
             Q+ +R  H      I+  +++I  + +G +GY  F D   GNI+  +PQ      + R
Sbjct: 219 --QRSSRFEHVMKIPLIAISLALILYVAIGCAGYLTFGDNIIGNIIMLYPQTTSS-TVGR 275

Query: 341 LCFGFNMLTTFPLEIFVLRDVIAAFLYGKKEEDE--------TEAP-------------- 378
           +     ++  FPL+    R  I   L    EE+         + AP              
Sbjct: 276 VAIVLLVMLAFPLQCHPARASIHQILQHFTEENATISTTSTSSPAPTNESSPLIRDNSLD 335

Query: 379 ----------------PLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMA 422
                           PL  +   +IT   ++++  ++++  +L  +  ++GAT +++++
Sbjct: 336 INEVIEEESIYQPKETPLKGKSFIVITCAILIASYFVAISVSSLARVLAIVGATGSTSIS 395

Query: 423 YILP 426
           +ILP
Sbjct: 396 FILP 399

>Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/300 (19%), Positives = 126/300 (42%), Gaps = 45/300 (15%)

Query: 171 DTIPHFLQSIFHSSN----------FFFRRNVVITIVTLFISYPLSLQRNIAALSKASFL 220
           D +P  L SI + ++           F  R + I++V +F+  PL  ++++ +L  AS +
Sbjct: 105 DLMPQILSSILYRNDDSTGDSQEHHMFLDRRLCISLVMMFVIAPLCFKKSLNSLRHASMI 164

Query: 221 ALXXXXXXXXXXXXQGPRVDMSLKGDKWSLT--DIFISSAIFRGISVISFALVCHHNTSF 278
           A+                     +G  + +T      S +    + +  FA  CHHN   
Sbjct: 165 AIVSVAYLCGLIIFHFLYRSELERGQVYFMTPHQDAQSHSPLTTLPIFVFAYTCHHNMFS 224

Query: 279 IFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINI 338
           +     ++S +   R+  ++  ++ +  +++G +GY  F D   GNI+  +P + +   I
Sbjct: 225 VINEQADKSFKILRRIPILAISLAYVLYVVIGGTGYMTFGDNIVGNIITLYP-NSIYTTI 283

Query: 339 ARLCFGFNMLTTFPLEIFVLR-------------------DVIAAFL------------- 366
            RL     +   FPL+    R                   D  A F+             
Sbjct: 284 GRLAMLLLVTLAFPLQCHPCRSSIKNMIVFIKNLRKDKTDDSTAGFIPLDDLSSEDPQEE 343

Query: 367 YGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP 426
             ++  +++  P  S+R+  +IT   ++ +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 344 VAQQNNEQSNLPIESSRQTNVITLCILIFSYLLAISITSLAKVLAIVGATGSTSISFILP 403

>NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420
          Length = 471

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 118/290 (40%), Gaps = 61/290 (21%)

Query: 190 RNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQ--GPRVDMS-LKGD 246
           RN  ITI+ L I  PL   +N+++L  AS +A+                P  ++  LKG+
Sbjct: 136 RNFHITIMMLCIVSPLCFMKNLSSLRYASMVAISSVVYLCVLVVFHFLSPSQEIKDLKGE 195

Query: 247 --KWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNR----SLQKFARLTHISTF 300
              W   +     +    + +  FA  CHHN     FS+ N     S     +L  I+  
Sbjct: 196 LSYWLPNN---EPSPLVTLPIFVFAYTCHHN----MFSVINEQIDNSFHNIKKLAIIAMS 248

Query: 301 ISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRD 360
           ++    +++G SGY  F D   GNI+  +PQ  +   I R+   F +   FPL+    R 
Sbjct: 249 LAFSLYIIIGGSGYYTFGDNIVGNIITLYPQ-SVSSTIGRMAIVFLVTLAFPLQCHPARA 307

Query: 361 VIA-----------------------------------AFLYGKKEED---ETEAP---- 378
            I                                    A L   +  D   E E+P    
Sbjct: 308 SIHHIILYITMKINDAKEIKPSNPQQEPLALSANNQERAMLIRSERSDTLIEEESPLQPV 367

Query: 379 --PLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP 426
             PL  ++  +ITT  ++ +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 368 TVPLEGKQFILITTSILICSYLLAISVSSLAHVLAIVGATGSTSISFILP 417

>Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/323 (21%), Positives = 137/323 (42%), Gaps = 51/323 (15%)

Query: 190 RNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQGPRVDMSLKGDKWS 249
           R + I+++ LF+  PL  ++++ +L  AS +A+                     +G  + 
Sbjct: 134 RRLYISLIMLFVIAPLCFKKSLNSLRHASMIAIISVAYLSGLIIYHFLNRHQLERGQVYF 193

Query: 250 L-----TDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMI 304
           +     T+   S A    + +  FA  CHHN   +     ++  +   R+  I+  ++ +
Sbjct: 194 MVPHRDTE---SHAPLTTLPIFVFAYTCHHNMFSVINEQADKGFRILKRIPIIAISLAFV 250

Query: 305 FCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRD---- 360
             +++G +GY  F     GNIL  +P + +   I RL     ++  FPL+    R     
Sbjct: 251 LYVIIGGAGYMTFGKNIVGNILTLYP-NSVSTTIGRLAMLLLVMLAFPLQCHPCRSSIKN 309

Query: 361 ---VIAAFLYGKKEEDETEAPPL-------------------------STRKLFIITTVC 392
               I  F  GK +E+  +  PL                         S+R   IIT   
Sbjct: 310 IIIFIENFRKGKLQENRDDCIPLDVLSSVNSQEESRQQNNEQQNFPSESSRHTNIITLCI 369

Query: 393 VVSTMSISLTTCNLGALFELIGATTASTMAYILPP-YTNLVLSKEANTFRQKVP------ 445
           + S+  ++++  +L  +  ++GAT ++++++ILP  +   ++  E  +  ++VP      
Sbjct: 370 LGSSYLLAISITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEYISRDERVPASVKIL 429

Query: 446 HYLCIF---FGFMVMIVSSTQTI 465
            YL +    +G +VMI S + T+
Sbjct: 430 KYLGLLLFIWGIVVMIASLSATV 452

>TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {ON}
           Anc_7.420 YER119C
          Length = 453

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/349 (22%), Positives = 146/349 (41%), Gaps = 72/349 (20%)

Query: 177 LQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQ- 235
           L ++ HSSN    R ++IT+V  FI  PLS  + I AL   SFLA+              
Sbjct: 105 LPTLLHSSN----RFLLITLVWGFIIAPLSFLKKITALRYTSFLAVVSVIYLSILVTFHY 160

Query: 236 -GPRVDM-SLKGDK---WSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQK 290
             P  ++  L+G+    +   D   S + F+ + +  FA  CHHN   +F  +  +S  +
Sbjct: 161 ADPSQEIIDLRGNVSLFFPGEDQHNSVSPFKTLPIFVFAYTCHHN---MFAVLNEQSTNE 217

Query: 291 FARLTHI---STFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNM 347
           F++L +I   +  I+ I  +++G  GY  F      NI+  +P + +   + +      +
Sbjct: 218 FSKLKYIPLTAISIACIMYLIVGTFGYVTFGSNITSNIVAQYPTNSIATILGQTAMLTVV 277

Query: 348 LTTFPLEIFVLR----DVIAAF----------------LY-------------------G 368
              FPL+    R    ++I AF                +Y                    
Sbjct: 278 TLAFPLQCQPARASFINIINAFFPRFKYTPPPLQDEESMYISSTADSINNNNNQNSTPST 337

Query: 369 KKEEDETEAPPLSTR------------KLFIITTVCVVSTMSISLTTCNLGALFELIGAT 416
            +E    E  P+  R            +  ++TT+ ++ +  I+++  +L  +  ++GAT
Sbjct: 338 PRESTPNETTPIEARSKLPFAQEPTQFQHILLTTIILLGSWLIAISVKSLAHVLAIVGAT 397

Query: 417 TASTMAYILPPYTNLVLSKEANTFRQKVPHYL-----CIFFGFMVMIVS 460
            ++++++ILP     +L    N+F      ++      +F+G  V++VS
Sbjct: 398 GSTSISFILPGLFGAILISRDNSFEGNKKLWVLLGRGLLFWGCSVVVVS 446

>TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 125/291 (42%), Gaps = 41/291 (14%)

Query: 188 FRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQ--GPRVDMS-LK 244
           +R N  IT V LFI  PLS  R I AL   S LA+                P  ++S L+
Sbjct: 113 YRMNT-ITFVWLFIILPLSYLRKINALRYTSLLAVTSVFYLCILVTYHYCKPSEEISELR 171

Query: 245 GDKWSLTDIFI--SSAI--FRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTF 300
           G       +F+  SS I  F+ + +  FA  CHHN   +    K+   ++   +  I+  
Sbjct: 172 GT----VSLFLPKSSGISPFKTLPIFVFAYTCHHNMFAVINEQKHTDFKRLKFIPLIAIS 227

Query: 301 ISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRD 360
           I+ I  +++G  GY+ F      NI+  +P + ++  + +      +   +PL+    R 
Sbjct: 228 IACILYLIVGCLGYATFGANITSNIVAKYPTNSVLTVLGQTAMLTVVTLAYPLQCQPARA 287

Query: 361 VIAAFLYG-----------------------KKEEDETEAPP---LSTRKLF---IITTV 391
            I   LY                          EE++ ++ P   +S   +    I+T++
Sbjct: 288 SILNILYALFPKLKNNKSDVEEASMNDGYQVDLEENKQQSEPERIISEPSIILHSIVTSL 347

Query: 392 CVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNLVLSKEANTFRQ 442
            +  +  I+++  +L  +  ++GAT ++ +++ILP    +VL  + N F +
Sbjct: 348 ILFGSWCIAVSVNSLAQVLAIVGATGSTFISFILPGLFAVVLIPKDNDFGK 398

>CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119c or uniprot|P38176 Saccharomyces cerevisiae
           YBL089w or uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 460

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 118/307 (38%), Gaps = 53/307 (17%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P    SI  +      R+  IT+V +F+  PL L++ + +L   S LA+        
Sbjct: 105 DLLPQIAGSI-TTKPLLLNRDFHITLVMIFVVTPLCLKKRLNSLRHTSSLAIMSVAYLCV 163

Query: 231 XXXXQGPRVDMSLKGDKW--SLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSL 288
                    D  ++  K   S+       +    + +  FA  CHHN   +    K+   
Sbjct: 164 LVIIHLVSSDGDIEQMKGHVSIGLPHHGPSPLTTLPIFVFAYTCHHNMFSVINEQKDNRF 223

Query: 289 QKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNML 348
           +    +  IST ++ I  +L+G  GY  F DK  GNI+  +P     I I R+     + 
Sbjct: 224 KTTKYIPLISTSLACILYILIGGCGYMTFGDKIVGNIITLYPHSVSSI-IGRIAIALLVT 282

Query: 349 TTFPLEIFVLRDVIA---AFLYGKKEED--------------------ETEAPPL----- 380
             FPL+    R  I    AF Y     D                     TE  PL     
Sbjct: 283 LAFPLQCHPARSSIHNILAFFYPSLNPDLKNTQEPTANADTMSSSQLLATERTPLVRSIS 342

Query: 381 --------------------STRKLFI-ITTVCVVSTMSISLTTCNLGALFELIGATTAS 419
                                 RKLF+ IT   ++ +  ++++  +L  +  ++GAT ++
Sbjct: 343 SIEDNELAEEQGSIKDVPIEMERKLFLAITAAILIPSYLVAMSVHSLDKVLAIVGATGST 402

Query: 420 TMAYILP 426
           ++++ILP
Sbjct: 403 SISFILP 409

>KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.252
           YKL146W
          Length = 646

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 96/420 (22%), Positives = 159/420 (37%), Gaps = 34/420 (8%)

Query: 61  INLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLR 120
           I+ +R   K ST + A + +  S +G GV+  P A  N                  +   
Sbjct: 244 ISSIRAAHKTSTFK-AVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLMCAVLSYYCFI 302

Query: 121 LIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSI 180
           L++I     G   Y D  E   G K ++ +L S  L                +  F Q  
Sbjct: 303 LLIITKDKVGVAGYGDMGEVLYGSKMKLAILASIALSQIGFSAAYTVFTATNLQVFCQGA 362

Query: 181 FHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLA-------LXXXXXXXXXXX 233
            +  +      + I +  L I  PLSL RNIA LS  + LA       L           
Sbjct: 363 LNLPDGSLGLGIFIVLQAL-IFIPLSLTRNIAKLSVTALLADLFILLGLIYVYYYAIYYV 421

Query: 234 XQGPRVDMSL---KGDKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSL 288
            +      ++       WSL   FI +AIF   GI ++            I      R  
Sbjct: 422 AKNSIATATMVWFNNSDWSL---FIGTAIFTFEGIGLL------------IPIQESMRHP 466

Query: 289 QKF-ARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNM 347
           +KF + L  +   +S++F +  G   YS F    +  +L NFPQD     + +L +   +
Sbjct: 467 EKFQSSLFGVMCIVSVVF-ISCGLLCYSAFGSNVQTVVLLNFPQDSPYTLLVQLFYSMAI 525

Query: 348 LTTFPLEIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLG 407
           L + PL++F    ++  + +      +   P +  RK +    + V++++   +   NL 
Sbjct: 526 LLSTPLQLFPAIRILEHWTFPSNASGKYN-PKIKWRKNYFRCIIVVLTSVLAWVGASNLD 584

Query: 408 ALFELIGATTASTMAYILPPYTNLVLSKEANTFR--QKVPHYLCIFFGFMVMIVSSTQTI 465
               L+G+     + YI PP  +    K+    R    +   L + FG  VM  +S QT+
Sbjct: 585 KFVSLVGSLACIPLIYIHPPLLHFKAFKDDQDTRYWSLICDILLLAFGVGVMTYTSVQTL 644

>Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 78/353 (22%), Positives = 150/353 (42%), Gaps = 69/353 (19%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P  + S++ ++ +   RNV I+++ LF   PL   + + +L  AS +A+        
Sbjct: 104 DLMPQIM-SVWTNNAWLLSRNVQISLIMLFFVTPLCFLKKLNSLRYASMIAISSVAYLCA 162

Query: 231 XXXXQ--GPRVD-MSLKGDKWSLTDIFISSA----IFRGISVISFALVCHHNTSFIFFSI 283
                   P  D + L+G    ++  F   +    +   + +  FA  CHHN     FSI
Sbjct: 163 LVLVHYIAPSEDILRLRGQ---ISYFFPPQSHDLNVLNTLPIFVFAYTCHHN----MFSI 215

Query: 284 KNRSLQKFARLTH------ISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVIN 337
            N   Q+ +R  H      I+  +++I  + +G +GY  F D   GNI+  +PQ  +   
Sbjct: 216 INE--QRSSRFEHIMKIPLIAVSLALILYIAIGCTGYLTFGDNIIGNIIMLYPQ-TVSST 272

Query: 338 IARLCFGFNMLTTFPLEIFVLRDVIAAFLYGKKEEDET--------------EAPPLSTR 383
           + R+     ++  FPL+    R  I   L   + E+ T               +P +  R
Sbjct: 273 VGRIAIVLLVMLAFPLQCHPARASIHQILQHLERENITTSTTSVSGPTFANENSPLMGDR 332

Query: 384 KLFI------------------------ITTVCVVSTMSISLTTCNLGALFELIGATTAS 419
            L I                        IT   ++++  ++++  +L  +  ++GAT ++
Sbjct: 333 GLDINEVIEEESIYQPKETSLKGKSFVFITCGILLASYLVAISVSSLARVLAIVGATGST 392

Query: 420 TMAYILPP-YTNLVLSKEANT---FRQKVPHY--LCIF-FGFMVMIVSSTQTI 465
           ++++ILP  +   ++  E NT   F  ++  Y  L +F +G ++MI   T  +
Sbjct: 393 SISFILPGLFGYKLIGTEHNTVIPFTTRLFKYTGLALFIWGLVIMITCLTAAL 445

>TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {ON}
           Anc_2.177 YNL101W
          Length = 444

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 101/225 (44%), Gaps = 50/225 (22%)

Query: 237 PRVDMSLKGDKWSLTDIFISSAI--FRGISVISFALVCHHNTSFIFFSIKNRSLQKFARL 294
           P V +    ++W+L   FI +AI  F G+ ++   +  H+N S         S + F ++
Sbjct: 198 PGVMLFFNSNEWTL---FIGTAIYAFEGVGLL---IPIHNNMS---------SPKDFPKI 242

Query: 295 THISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLE 354
             +      I  +L+G  GY  + +K K  IL +F    + +NI  +CF   +L + PL+
Sbjct: 243 LLLVMLTMSIIFILIGTCGYLSYGEKIKVIILQSF-APGIFVNIIIVCFTIGILLSTPLQ 301

Query: 355 IFVLRDVIAAFLYGKKE-------------------EDETEA---PPLSTR------KLF 386
           +F L  ++  FL+ KK+                   E +TEA     ++ R      +  
Sbjct: 302 LFSLTSLLEDFLFTKKKIAVADEDLKVLEESDILCSESDTEAQGTKHINLRVYKIILRFL 361

Query: 387 IITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNL 431
           I+TTVC++      +T+  L  L  ++G+     + YI PP  NL
Sbjct: 362 IVTTVCLIG----YITSDKLNKLVAIVGSLACIPLVYIYPPLLNL 402

>NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON}
           Anc_2.295
          Length = 481

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 68/135 (50%), Gaps = 3/135 (2%)

Query: 253 IFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYS 312
           I+    +    S+I FA V   N   I   ++N S++   ++ + S  IS IF +L+G S
Sbjct: 183 IYDGKGLLSTFSIIIFAYVGAMNLFSICRELENDSMENILKVINGSIGISSIFFLLVGIS 242

Query: 313 GYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFL--YGKK 370
           GY  F    +GNI+ N+  + + I + + C  F +L +FPL    LR  +   +  +G  
Sbjct: 243 GYLTFGSNVQGNIILNYDPNSIWIYLGKFCLAFMLLLSFPLLFHPLRIAVNNLVVWFGMT 302

Query: 371 -EEDETEAPPLSTRK 384
              D+T A P +T++
Sbjct: 303 FGADDTCAVPSTTQE 317

>AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER119C
           (AVT6) and YBL089W (AVT5)
          Length = 440

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/286 (21%), Positives = 113/286 (39%), Gaps = 32/286 (11%)

Query: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXX 230
           D +P  L     ++ +   RNV IT  T  +  PL   R++ +L  AS +A+        
Sbjct: 104 DLMPQ-LAGTVTAAPWLLDRNVQITFWTAAVIAPLCCMRHLHSLKYASMVAVAAVAYLGA 162

Query: 231 XXXXQG--PRVDMS-LKGD-KWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNR 286
               +   P  ++  L+G     L       A+     +  FA  CHHN   I   +++ 
Sbjct: 163 LVAARAAWPSPELERLRGPVSLGLPPGTSGGAMLSSFPIFVFAYTCHHNMFSIVNELRDN 222

Query: 287 SLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFN 346
           SL    R+   +  +++     +G +GY  F D   GNI+  +P       + R      
Sbjct: 223 SLGACLRVVVAAIALAVALYATIGGAGYLTFGDHITGNIIAQYPPAP-ATTLGRAAIAVL 281

Query: 347 MLTTFPLEIFVLRDVI-------------------AAFLYGKKEEDETEAP-------PL 380
           ++  FPL+    R  I                   A    G    D  E P       PL
Sbjct: 282 VMLAFPLQCHPARASINHIWHYCIPSHTVAPSEASALIRGGSPPADAAEGPGNEPAAVPL 341

Query: 381 STRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP 426
              +   IT   ++++ +++++  +L  +  ++GAT ++ +++ILP
Sbjct: 342 GPPRFAAITAALLIASYAVAVSVTSLARVLAVVGATGSTAISFILP 387

>CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa]
           {ON} similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 485

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 65/146 (44%), Gaps = 2/146 (1%)

Query: 240 DMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHIST 299
           ++S +  + S   ++    +    S+I FA V   N   I   +++ S+    ++   S 
Sbjct: 173 EISFERGEISWFKVYDYKGLLSTFSIIIFAYVGAMNIFTIVNELQDNSMTNVRKVVDSSI 232

Query: 300 FISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR 359
            IS I  + +G  GY  F   T GNIL N+  D L I I + C    ++ TFPL    LR
Sbjct: 233 LISTILFLFVGLFGYLTFGSLTMGNILLNYDSDSLAIGIGKFCLAMMLILTFPLLFHPLR 292

Query: 360 DVIAAFL--YGKKEEDETEAPPLSTR 383
             I   +  +  K E  +  P +S R
Sbjct: 293 TAINNIVVWFIIKFEKSSLTPEISAR 318

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 16/95 (16%)

Query: 379 PLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNLVLSKEAN 438
           P    + +IIT + +VS  +++L   +   +  L+GAT ++++++ILP    L   K   
Sbjct: 385 PFPETRFYIITALLLVSMYAMALNVKSFALVLSLVGATGSTSISFILP---GLFGYKLIG 441

Query: 439 TFRQKVPHYLC-------------IFFGFMVMIVS 460
           T    + H +              I+FGF VM +S
Sbjct: 442 TDALAIGHTMTKEDRLYRRLSLLLIYFGFAVMFLS 476

>Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -
           Hypothetical ORF [contig 246] FULL
          Length = 614

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 126/303 (41%), Gaps = 36/303 (11%)

Query: 180 IFHSSNFFFRRNVVI-TIVTLFISYPLSLQRNIAALSKASFLA--------LXXXXXXXX 230
           +F ++ F F+ ++    ++ L +  PLSL RNIA LS  + +A        L        
Sbjct: 326 VFFANVFKFKASMAFWLLIQLPVYLPLSLTRNIAKLSGTALIADAFILFGLLYVYYYCSH 385

Query: 231 XXXXQGPRVDMSLKGDK--WSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNR 286
                G   D  L  +K  W+L   FI +AIF   GI ++            I      +
Sbjct: 386 YVVDHGVASDSMLLFNKNDWTL---FIGTAIFTYEGIGLL------------IPIQESMK 430

Query: 287 SLQKFARL---THISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCF 343
             +KF++       S  ++ I C L+ YS    F D  K  IL NFP+D  +    +L +
Sbjct: 431 HPEKFSKCLFGVMASVSVAFIVCGLLCYSA---FGDSVKIVILLNFPRDSAMTATVQLLY 487

Query: 344 GFNMLTTFPLEIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTT 403
              +L + PL++F +  ++   ++ K    +   P +   K +    + +++ +   L  
Sbjct: 488 ALAILLSTPLQLFPIIRILETSIFPKDASGKYN-PRVKWMKNYFRVAIVLLNMLIAWLGA 546

Query: 404 CNLGALFELIGATTASTMAYILPPYTNLVLSKEANTFRQK-VPHYLCIFFGFMVMIVSST 462
            +L     L+G+     + YI PP  +     +    +   +   L  FFG  VMI ++ 
Sbjct: 547 NDLDKFVSLVGSFACIPLIYIYPPMLHYKTFAQGGASKLALLGDQLIAFFGVAVMIYTTY 606

Query: 463 QTI 465
           Q +
Sbjct: 607 QAV 609

>CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146w or
           uniprot|P50944 Saccharomyces cerevisiae YNL101w
          Length = 681

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 87/412 (21%), Positives = 151/412 (36%), Gaps = 34/412 (8%)

Query: 67  NDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINL 126
           +  KS+   A + +  S +G GV+  P A  N                  W   L++   
Sbjct: 286 HGHKSSTTKAVLLLLKSFVGTGVLFLPRAFHNGGWGFSSSVLLICALISYWCFVLLIDTK 345

Query: 127 TLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNF 186
              G   Y D      G   ++ +L S  L                +  F  ++F     
Sbjct: 346 NHVGLDGYGDMGNHLYGSSMKLAILWSIALSQIGFSSAYTVFTATNLQVFTNNVFKQE-- 403

Query: 187 FFRRNVVITIVTLFISYPLSLQRNIAALSKASFLA--------LXXXXXXXXXXXXQGPR 238
            +   + I I  LF   PL+L RNIA LS  + +A        +             G  
Sbjct: 404 -YGITIFIIIQVLFF-LPLALTRNIAKLSGTALIADLFILLGLVYVYWFSISHVSTHGVA 461

Query: 239 VDMSLKGDK--WSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKF-AR 293
            +  L  +K  WSL   FI +AIF   GI ++            I      +  + F A 
Sbjct: 462 SETMLMFNKADWSL---FIGTAIFTFEGIGLL------------IPIQESMKKPEHFHAS 506

Query: 294 LTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPL 353
           L+ +   ++++F +  G   Y  F    +  +L NFPQ+ +     +L +   +L + PL
Sbjct: 507 LSGVMCVVTVVF-ISCGLICYCAFGADVETVVLLNFPQESIYTRAVQLLYALAILLSTPL 565

Query: 354 EIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELI 413
           ++F    ++  + +      +        +  F    VC  + ++ +    +L     L+
Sbjct: 566 QLFPAIKILENWTFSPHSSGKHNPKVKWLKNYFRAAIVCFSALIAWAGAN-DLDKFVSLV 624

Query: 414 GATTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTI 465
           G+     + YI PP  +    K+  +          +FFG +VMI +S QTI
Sbjct: 625 GSFACIPLIYIYPPMLHFKAFKKDKSKLFMASDIFLLFFGIIVMIYTSLQTI 676

>AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL101W
           (AVT4)
          Length = 716

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 89/434 (20%), Positives = 160/434 (36%), Gaps = 58/434 (13%)

Query: 69  KKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTL 128
           K ST + AF+ M  S +G GV+  P A  N                  W   ++V +   
Sbjct: 298 KTSTFK-AFLLMIKSFIGTGVLFLPNAFSNGGLAFSISMLFFFSAYSYWCYYILVRSKDA 356

Query: 129 AGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFF 188
            G  ++ D      G   + ++L S  L                +  FL ++F+  +   
Sbjct: 357 TGVSSFGDIGGILFGSWMKFIILFSLVLTQMGFAGAYVVFTAKNLIAFLDNVFNWPDIPV 416

Query: 189 RRNVVITIVTLFISYPLSLQRNIAALSKASFLA-------------LXXXXXXXXXXXXQ 235
           +    + +  LFI  PLS  RN++ LS  S  A                           
Sbjct: 417 K---YLLLTQLFIFIPLSFVRNVSKLSITSLFANFFIISGLIIVVYYTACRWMYDLSFKP 473

Query: 236 GPRVDMSLKGDKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFAR 293
              V M    ++WSL   FI +AIF   GI +I            I      R  ++F +
Sbjct: 474 AEGVIMVFNPNRWSL---FIGTAIFAFEGIGLI------------IPVQESMRHPEEFPK 518

Query: 294 LTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPL 353
           +  +    + +  + +G  GY  +  + +  IL N PQD L +N+ +L +   +L + PL
Sbjct: 519 VLGLVIITTTVLFITIGTLGYLAYGSQIQSVILLNLPQDALSVNMIQLFYSMAILLSTPL 578

Query: 354 EIFVLRDVIAAFLYGK------KEEDETEAP----------PLSTRKLFIITTVCVVSTM 397
           ++F    +I    + +      K +D  +             +   K  + + + ++  +
Sbjct: 579 QLFPAIGIIENKFFPRFTKVDIKGQDSADFQLQQNSGRANWRVKWSKNLVRSIIVLLVII 638

Query: 398 SISLTTCNLGALFELIGATTASTMAYILPPYTNLVL-----SKEANTFRQKVP---HYLC 449
                  NL     ++G      + YI P   +L        +++NT++ +      Y+ 
Sbjct: 639 LAYFGADNLDLFVSIVGCLACIPLVYIYPSMLHLRSCSTPDHEKSNTWKTRCSVLIDYIL 698

Query: 450 IFFGFMVMIVSSTQ 463
           I FGF+ M  +S Q
Sbjct: 699 IIFGFVSMCYTSYQ 712

>TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.252
           YKL146W
          Length = 596

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 95/420 (22%), Positives = 162/420 (38%), Gaps = 43/420 (10%)

Query: 66  DNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWT-LRLIVI 124
           DN+KK++   A + +  S +G G++  P    N                  +  + LI  
Sbjct: 195 DNNKKASTFKAILLLLKSFVGTGILFLPKGFSNGGYTFSTISLLVCSLLSYYCFILLIST 254

Query: 125 NLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSS 184
              + G   Y D      G+  ++ +LLS  L                +    Q++F ++
Sbjct: 255 KDQMKGINGYGDLGNHLYGKNMKLAILLSIVLSQIGFSAAYTVFVATNLKTLCQNLFSNN 314

Query: 185 NFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLA--------LXXXXXXXXXXXXQG 236
             F     +I    LFI  PLS  RNI  L+  + +A        +             G
Sbjct: 315 QHFSIVLFIIFQTLLFI--PLSFTRNITKLTATALVADLFIFIGVIYIYYYPITYIIKNG 372

Query: 237 PRVD--MSLKGDKWSLTDIFISSAIF--RGISV---ISFALVCHHNTSFIFFSIKNRSLQ 289
              +  +      WSL   FI +AIF   GI +   I  ++   H              Q
Sbjct: 373 IATETIVPFNNKNWSL---FIGTAIFTFEGIGLLIPIQESMAKPH--------------Q 415

Query: 290 KFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLT 349
            F  LT +   +++IF + +G   Y  F    +  +L NFPQD       +L +   +L 
Sbjct: 416 FFISLTLVMVIVTVIF-ISVGLLCYCAFGSSVETVVLLNFPQDSPYTLTVQLLYCLAILL 474

Query: 350 TFPLEIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCN-LGA 408
           + PL++F    ++  +++ KK   +   P +   K +   ++ V+ T  I+ +  N L  
Sbjct: 475 STPLQLFPAIRILENWVFKKKGSGKYN-PKIKWAKNY-FRSLIVIGTTCIAWSGANDLDK 532

Query: 409 LFELIGATTASTMAYILPP---YTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTI 465
              L+G+     + YI PP   Y    ++  AN   Q     + I FG ++M  +S QTI
Sbjct: 533 FVSLVGSFACIPLIYIYPPLLHYKACKINGSAN-LVQNYLDIILILFGVILMSYTSFQTI 591

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/271 (21%), Positives = 107/271 (39%), Gaps = 67/271 (24%)

Query: 264 SVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKG 323
           S+I FA     N   I   ++N S++   ++ + S  IS    +L+G SGY  F   T G
Sbjct: 198 SIIIFAFTGAMNLFSIINELENNSIRNITKVINRSIGISTFLFLLVGISGYLTFGSNTLG 257

Query: 324 NILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFL------YGKKEEDETE- 376
           NI+ N+  D     I + C G  ++ +FPL    LR  +   +      YG  +E+ +  
Sbjct: 258 NIMLNYDPDSKWCYIGKFCLGSMIVLSFPLLFHPLRIAVNNMVIFYQINYGSNKENTSPN 317

Query: 377 --------AP----------------------------------------PLSTRKLFII 388
                   +P                                        P    + + I
Sbjct: 318 IRSNTSDLSPISLTINDDDIRSMPDDNVDDVLLSNEVTEIEELDNVLCETPFPNHRFYTI 377

Query: 389 TTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPY--------TNLVLSK---EA 437
           + + ++   S+SLT  +   +  ++GAT  +++++ILP           +L + +   ++
Sbjct: 378 SLLLLLVMYSVSLTVTSFAYVLAIVGATGGTSISFILPGIFGYKLIGSDSLAIGQMISDS 437

Query: 438 NTFRQKVPHYLCIFFGFMVMIVSSTQTIIEV 468
           + F +K   YL + FGF VM  S     I++
Sbjct: 438 DKFYKKCSLYLAL-FGFSVMFFSLYLIFIDI 467

>KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7
          Length = 468

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 93/251 (37%), Gaps = 73/251 (29%)

Query: 238 RVDMSLKG--DKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLT 295
           R D+S  G  DK  L   F         ++I FA     N   I   +K+ S+Q   ++ 
Sbjct: 176 RGDVSWIGVYDKKGLVSTF---------TIIVFAFTASMNLFSIINELKDNSMQNINKVI 226

Query: 296 HISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEI 355
             S   S    + +G  GY  F     GNI+ N+  + +   I +LC G  ++ +FPL +
Sbjct: 227 TSSISTSAALFLSVGVCGYLTFGSNVVGNIMLNYDPESIWTTIGKLCLGTMVILSFPLLL 286

Query: 356 FVLRDVIAA--------FLYGKKE--------------------EDE------------- 374
              R  IAA          YGK E                    EDE             
Sbjct: 287 HPCR--IAANNMMHWILLTYGKCEVHHEARNKHKHPTSPITMVIEDEEDRLLLGSEGNYE 344

Query: 375 -------------------TEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGA 415
                              TE  P   ++ +IIT V V+S   ++L   +   +  L+GA
Sbjct: 345 ATVNGPSYQEVEENREDSLTEVVPFPNQRFYIITAVLVISLYVLALNVSSFALVLALVGA 404

Query: 416 TTASTMAYILP 426
           T ++ +++ LP
Sbjct: 405 TGSTAISFTLP 415

>Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101W
           (REAL)
          Length = 715

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 97/435 (22%), Positives = 160/435 (36%), Gaps = 55/435 (12%)

Query: 71  STMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTLAG 130
           ++ R  F+ +  S +G GV+  P A  N                  W   ++V      G
Sbjct: 299 TSTRKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGLYSYWCYYILVQAKASCG 358

Query: 131 KKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFFRR 190
             ++ D      G   RI++L S  +                +  FL ++FH+       
Sbjct: 359 VSSFGDIGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFLDNVFHAGVLPLS- 417

Query: 191 NVVITIVTLFISYPLSLQRNIAALSKASFLA-LXXXXXXXXXXXXQGPRVDMSLKG---- 245
              + I    I  PLS  RNI+ LS  S LA                 R+   LK     
Sbjct: 418 --FLMIFQTIIFIPLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAKRLFFDLKASPAM 475

Query: 246 --------DKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFARLT 295
                   D+W+L   FI +AIF   GI +I            I      R+ +KF  + 
Sbjct: 476 GVVYGLNMDRWTL---FIGTAIFAFEGIGLI------------IPVQDSMRNPEKFPLVL 520

Query: 296 HISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEI 355
            +    + I  + +   GY  +    +  IL N PQ ++ +N+ +L +   ++ + PL++
Sbjct: 521 ALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQL 580

Query: 356 FVLRDVIAAFLYGK------KEEDET---EAPPLSTR--------KLFIITTVCVVSTMS 398
           F    +I    + K      K +D T   E  P S +        K FI + + ++    
Sbjct: 581 FPAIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLDWRVKWLKNFIRSIIVIIVVAI 640

Query: 399 ISLTTCNLGALFELIGATTASTMAYILPPYTNL---VLSKEANTFRQKVP--HYLCIFFG 453
               + NL     +IG+     + YI P   +L    L +    F +  P    + IFFG
Sbjct: 641 AYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGKFWRFKPMLDIILIFFG 700

Query: 454 FMVMIVSSTQTIIEV 468
              M+ +S Q+I  V
Sbjct: 701 IASMLYTSYQSIFGV 715

>TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {ON}
           Anc_2.295 YIL088C
          Length = 473

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/270 (21%), Positives = 108/270 (40%), Gaps = 74/270 (27%)

Query: 264 SVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKG 323
           ++I FA     N   I   ++  S++  + + + S  IS I  + +G +GY  F   T G
Sbjct: 195 NIIIFAFTGAMNLFSIINELEENSMKNISHVINYSIGISTILFLSVGITGYLTFGSNTVG 254

Query: 324 NILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRD----VIAAFLYGKKEEDE----- 374
           NI+ N+  + +  N+   C G  ++ +FPL    LRD    +I  + Y K   D+     
Sbjct: 255 NIMLNYDPNSVWTNVGNFCLGAMVILSFPLLFHPLRDAVNNIIVYYQYYKSNNDQDSGVI 314

Query: 375 -------TEAPPLS---------------------------------------------T 382
                  T + P+S                                             +
Sbjct: 315 VGNNYDSTYSRPISLSVADDEEEEVNSLVNGEMNITVDNSSILEDVNENQFTSGIKSDFS 374

Query: 383 RKLFIITTVCVVSTMSI-SLTTCNLGALFELIGATTASTMAYILPPY--------TNLVL 433
           +  F I T  +++ + I +LT  +   +   +GAT ++++++ILP Y         +L++
Sbjct: 375 QSRFYIITFALLAVIYITALTVTSFSLILAFVGATGSTSISFILPGYFGFKLIGTDSLIV 434

Query: 434 SK---EANTFRQKVPHYLCIFFGFMVMIVS 460
            +   + + F +K    LC FFG  +M+ S
Sbjct: 435 GEMIPKRDMFYKKCSQGLC-FFGLFIMVFS 463

>Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W
           (REAL)
          Length = 680

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 94/425 (22%), Positives = 155/425 (36%), Gaps = 53/425 (12%)

Query: 65  RDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVI 124
           R   K ST++ A + +  S +G GV+  P A  N                       ++ 
Sbjct: 280 RHPHKSSTVK-AVLLLLKSFVGTGVLFLPKAFHNGGWGFSAICLLSCALVSYGCFVSLIT 338

Query: 125 NLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSS 184
                G   Y D      G K +  +LLS  L                +  F +      
Sbjct: 339 TKDKVGVDGYGDMGRILYGPKMKFAILLSIALSQIGFSAAYTVFTATNLQVFCE------ 392

Query: 185 NFFFRRNVVITIVT-----LFISYPLSLQRNIAALSKASFLA--------LXXXXXXXXX 231
           NFF  +   I++ T     + I  PLSL RNIA LS  + +A        +         
Sbjct: 393 NFFHLKPGSISLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGLVYVYVYSIYY 452

Query: 232 XXXQGPRVDMSLKGDK--WSLTDIFISSAI--FRGISVISFALVCHHNTSFIFFSIKNRS 287
               G   D  L  +K  WSL   FI +AI  F GI ++                I+   
Sbjct: 453 IAVNGIASDTMLMFNKADWSL---FIGTAIFTFEGIGLL--------------IPIQ--- 492

Query: 288 LQKFARLTHISTFISMIFCMLM------GYSGYSVFRDKTKGNILNNFPQDDLVINIARL 341
            +      H    +S + C++       G   Y+ F    K  +L NFPQD       +L
Sbjct: 493 -ESMKHPNHFRPSLSAVMCIVAVVFISCGLLCYAAFGSDVKTVVLLNFPQDTSYTLTVQL 551

Query: 342 CFGFNMLTTFPLEIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISL 401
            +   +L + PL++F    ++  + +      +   P +   K +    + V++++   +
Sbjct: 552 LYALAILLSTPLQLFPAIRILENWTFPSNASGK-HNPKVKWLKNYFRCAIVVLTSVLAWV 610

Query: 402 TTCNLGALFELIGATTASTMAYILPPYTNLVLSKEANTFRQK-VPHYLCIFFGFMVMIVS 460
              +L     L+G+     + YI PP  +   S  + T R + +   + I FG  VM+ +
Sbjct: 611 GANDLDKFVSLVGSFACIPLIYIYPPLLHYKASSISGTSRARLLLDLIVIVFGVAVMVYT 670

Query: 461 STQTI 465
           S QTI
Sbjct: 671 SWQTI 675

>KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.252
           YKL146W
          Length = 643

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 93/414 (22%), Positives = 159/414 (38%), Gaps = 39/414 (9%)

Query: 70  KSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTLA 129
           K+T   A + +  S +G GV+  P A  N                  +   L++I     
Sbjct: 245 KTTTVKAVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLFCAILSYYCFVLLIITKDKV 304

Query: 130 GKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFFR 189
           G K Y +      G K ++ +LLS  L                +  F+ ++F+ S     
Sbjct: 305 GVKGYGEIGMKLYGGKMKLAILLSVALSQIGFAAAYTVFTATNLKLFMDNVFNLSEDVLG 364

Query: 190 RNVVITI-VTLFISYPLSLQRNIAALSKASFLA--------LXXXXXXXXXXXXQGPRVD 240
               I +   +FI  PLSL RNIA LS  + +A        +             G    
Sbjct: 365 LGWFIWLQAAIFI--PLSLTRNIAKLSGTALVADLFILLGLIYVYYYATYYVISNGVATS 422

Query: 241 MSLKGDK--WSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFAR-LT 295
             +  +K  W+L   FI +AIF   GI ++            I      +  + F + L+
Sbjct: 423 TMVWFNKSDWTL---FIGTAIFTFEGIGLL------------IPIQESMKHPEVFRKSLS 467

Query: 296 HISTFISMIF--CMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPL 353
            +   +++IF  C L+ YS +    D     +L NFPQD     I +L +   +L + PL
Sbjct: 468 GVMVIVTVIFISCGLLCYSAFGSHVDTV---VLVNFPQDSYTTAIVQLLYALAILLSTPL 524

Query: 354 EIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELI 413
           ++F    ++  + +      +   P +   K +    V + +T+   +   +L     L+
Sbjct: 525 QLFPAIRILEQWTFNSNASGK-HNPRVKWLKNYFRCGVVIFTTVLAWVGASDLDKFVSLV 583

Query: 414 GATTASTMAYILPPYTNLVLSKEANTFRQK--VPHYLCIFFGFMVMIVSSTQTI 465
           G+     + YI PP  +   S+   T  +   +   L   FGF VM+ +S Q I
Sbjct: 584 GSLACIPLIYIHPPLLHHRASRSDGTSSRGILILDLLICIFGFSVMVYTSWQAI 637

>NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {ON}
           Anc_5.252 YKL146W
          Length = 668

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 65/280 (23%), Positives = 109/280 (38%), Gaps = 40/280 (14%)

Query: 204 PLSLQRNIAALSKASFLA--------LXXXXXXXXXXXXQG--PRVDMSLKGDKWSLTDI 253
           PLSL RNIA LS  + +A        +             G   +  + L    WSL   
Sbjct: 406 PLSLTRNIAKLSGTALIADLFILLGLVYVYFYSTSYIIKNGISSKTMLWLNKSDWSL--- 462

Query: 254 FISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLM-- 309
           FI +AIF   GI ++                I+    +  +   H S  +SM+ C++   
Sbjct: 463 FIGTAIFTFEGIGLL--------------IPIQ----ESMSHPQHFSKCLSMVMCIVTVI 504

Query: 310 ----GYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAF 365
               G   YS F  K +  +L NFP D     + +L +   +L + PL++F    ++  +
Sbjct: 505 FISCGLLCYSAFGSKVETVVLLNFPHDSPYTLMVQLLYALAILLSTPLQLFPAIKILENW 564

Query: 366 LYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYIL 425
            +      +   P +   K +    + +++     +   +L     L+G+     + YI 
Sbjct: 565 CFPISASGKNN-PKVKWLKNYFRCIIVLLTAFIAYVGANDLDKFVSLVGSFACIPLIYIY 623

Query: 426 PPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTI 465
           PP  +L       T  + V   L + FG  VM  +S QTI
Sbjct: 624 PPLLHLKAYWGEQTILRMVLDSLVLIFGVAVMGYTSWQTI 663

>NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420
          Length = 495

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 86/198 (43%), Gaps = 25/198 (12%)

Query: 194 ITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQG--PRVDMS-LKGD--KW 248
           IT++  F++ PL L +N+ +L  AS +A+                P  ++  LKGD   W
Sbjct: 130 ITLIMAFVAGPLCLLKNLNSLRYASMVAISAVAYLCILVLVHFIFPSQEIKDLKGDFAVW 189

Query: 249 SLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTH------ISTFIS 302
              +     +    + +  FA  CHHN     F++ N   QK  R  H      I+  ++
Sbjct: 190 FPHN---EGSPLSTLPIFVFAYTCHHNV----FAVINE--QKKTRFAHVKVIAIIAMLLA 240

Query: 303 MIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR--- 359
           ++  +L+G +GY  F +   GNI+  +P   +   I R+   F +   FPL+    R   
Sbjct: 241 LVLYVLIGGAGYFTFGNHIVGNIITLYPH-SITSTIGRVAIVFLVTLAFPLQCHPARASI 299

Query: 360 -DVIAAFLYGKKEEDETE 376
             +I    +  K+ D+ +
Sbjct: 300 HHIICYIKHKAKKRDQNQ 317

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 31/51 (60%)

Query: 376 EAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP 426
           E  PL  +   IIT + +    +++++  +L  +  ++GAT ++++++ILP
Sbjct: 390 ENTPLEGKTFKIITLILIACAYTVAISVTSLAHVLAIVGATGSTSISFILP 440

>YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 692

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 122/307 (39%), Gaps = 46/307 (14%)

Query: 183 SSNFFFRRNVVITIVT-----LFISYPLSLQRNIAALSKASFLA--------LXXXXXXX 229
           S NFF  +   I++ T     + I  PLSL RNIA LS  + +A        +       
Sbjct: 403 SENFFHLKPGSISLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGLVYVYVYSI 462

Query: 230 XXXXXQGPRVDMSLKGDK--WSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKN 285
                 G   D  L  +K  WSL   FI +AIF   GI ++                I  
Sbjct: 463 YYIAVNGVASDTMLMFNKADWSL---FIGTAIFTFEGIGLL----------------IPI 503

Query: 286 RSLQKFARLTHISTFISMIFCMLM------GYSGYSVFRDKTKGNILNNFPQDDLVINIA 339
           +   K  +  H    +S + C++       G   Y+ F    K  +L NFPQD       
Sbjct: 504 QESMKHPK--HFRPSLSAVMCIVAVIFISCGLLCYAAFGSDVKTVVLLNFPQDTSYTLTV 561

Query: 340 RLCFGFNMLTTFPLEIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSI 399
           +L +   +L + PL++F    ++  + +      +   P +   K +    + V++++  
Sbjct: 562 QLLYALAILLSTPLQLFPAIRILENWTFPSNASGKYN-PKVKWLKNYFRCAIVVLTSILA 620

Query: 400 SLTTCNLGALFELIGATTASTMAYILPPYTNLVLSKEANTFRQK-VPHYLCIFFGFMVMI 458
            +   +L     L+G+     + YI PP  +   S  + T R + +   + I FG  VM 
Sbjct: 621 WVGANDLDKFVSLVGSFACIPLIYIYPPLLHYKASILSGTSRARLLLDLIVIVFGVAVMA 680

Query: 459 VSSTQTI 465
            +S QTI
Sbjct: 681 YTSWQTI 687

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 101/242 (41%), Gaps = 39/242 (16%)

Query: 248 WSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIF 305
           W+L   FI +AIF   GI +I            I      R   KF  +  +    + + 
Sbjct: 459 WTL---FIGTAIFAFEGIGLI------------IPLQNSMRDPSKFPLVLGLVMICTTVM 503

Query: 306 CMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAF 365
            +++   GY  +   T+  IL NFPQ ++V+N+ +L +   +L + PL+IF   +++   
Sbjct: 504 FIIIATIGYLSYGSSTETIILQNFPQKNIVVNLIQLFYALAILLSTPLQIFPAIEIVEDK 563

Query: 366 LYGKKEEDE--TEAPPLST---------------RKLFIITTVCVVSTMSISLTTCNLGA 408
           ++ K   D    +  P++T                K  I T +     +     + NL  
Sbjct: 564 IFPKPGSDPECKDEIPITTIYNANSGGLDWRIKWFKNMIRTMIVTCVILLAYFGSNNLDK 623

Query: 409 LFELIGATTASTMAYILPPYTNL-----VLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQ 463
           L  +IG+     + Y+ PP  +L      +SK       K   Y+ I FG + M+ ++ Q
Sbjct: 624 LVAIIGSLACIPLVYMYPPMLHLKTYSIPMSKGKRFTWSKSFDYILIVFGGVSMVYTTYQ 683

Query: 464 TI 465
           +I
Sbjct: 684 SI 685

>KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]
           {ON} similar to uniprot|P36062 Saccharomyces cerevisiae
           YKL146W AVT3 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 573

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 119/278 (42%), Gaps = 38/278 (13%)

Query: 204 PLSLQRNIAALSKASFLA--------LXXXXXXXXXXXXQGPRVD--MSLKGDKWSLTDI 253
           PLSL RNIA LS  + +A        +             G   D  +S     W+L   
Sbjct: 313 PLSLTRNIARLSATALVADLFILLGLVYVYYYSSFYIWNHGIASDSMVSFNKSDWTL--- 369

Query: 254 FISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFAR----LTHISTFISMIFCM 307
           FI +AIF   GI +    L+  H            S++K A     L ++   +++IF +
Sbjct: 370 FIGTAIFTYEGIGL----LIPIH-----------ESMEKPAHFKPALMYVILVVTIIF-I 413

Query: 308 LMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFLY 367
             G   YS F  K +  IL NFP + +  N  +L +   +L + PL++F    ++   ++
Sbjct: 414 SCGLICYSAFGAKVETVILLNFPSNSIFTNAVQLIYALAILLSTPLQLFPAIKILENKIF 473

Query: 368 GKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPP 427
            K    + +A  +  RK +    V +++ +   +   +L     LIG+     + YI PP
Sbjct: 474 HKNASGKFDA-KVKWRKNYFRAFVVLIAVIIAWIGANDLDKFVSLIGSFACIPLIYIYPP 532

Query: 428 YTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTI 465
             +  +  E N   Q +   + I FG +VM  +S QTI
Sbjct: 533 LFHYKVF-ENNKKLQAIDLAILI-FGALVMSYTSWQTI 568

>Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101W
           (REAL)
          Length = 713

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 96/435 (22%), Positives = 160/435 (36%), Gaps = 55/435 (12%)

Query: 71  STMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTLAG 130
           ++ R  F+ +  S +G GV+  P A  N                  W   ++V   +  G
Sbjct: 297 TSTRKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGVYSYWCYYILVQAKSSCG 356

Query: 131 KKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFFRR 190
             ++ D      G   RI++L S  +                +  FL ++FH        
Sbjct: 357 VSSFGDIGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFLDNVFHVGVLPLSY 416

Query: 191 NVVITIVTLFISYPLSLQRNIAALSKASFLA-------------LXXXXXXXXXXXXQGP 237
            +V   + +FI  PLS  RNI+ LS  S LA                             
Sbjct: 417 LMVFQTI-VFI--PLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAKRLFFDLKATPAA 473

Query: 238 RVDMSLKGDKWSLTDIFISSAI--FRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLT 295
            V   L  D+W+L   FI +AI  F GI +I            I      R+ +KF  + 
Sbjct: 474 GVIYGLNTDRWTL---FIGTAIFAFEGIGLI------------IPVQDSMRNPEKFPLVL 518

Query: 296 HISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEI 355
            +    + +  + +   GY  +    +  IL N PQ ++ +N+ +L +   ++ + PL++
Sbjct: 519 GLVILTATLLFISIATLGYLAYGSSVRTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQL 578

Query: 356 FVLRDVIAAFLYGK------KEEDET---EAPPLSTR--------KLFIITTVCVVSTMS 398
           F    +I    + K      K  D T   E  P S +        K FI + + ++    
Sbjct: 579 FPAIKIIENKFFPKFTKIYVKHNDLTTRVELRPNSGKLNWKIKWLKNFIRSIIVIIVVAI 638

Query: 399 ISLTTCNLGALFELIGATTASTMAYILPPYTNL---VLSKEANTFRQKVP--HYLCIFFG 453
               + NL     +IG+     + YI P   +L    L +    F +  P    + IFFG
Sbjct: 639 AYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFWRFKPVLDSILIFFG 698

Query: 454 FMVMIVSSTQTIIEV 468
              M+ +S Q+I  V
Sbjct: 699 IASMLYTSYQSIFGV 713

>Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON}
           YIL088C (REAL)
          Length = 491

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 3/112 (2%)

Query: 248 WSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCM 307
           W + D+     +    S+I FA     N   +   +K+ S++    + + S  +S I  +
Sbjct: 182 WKIHDV---KGLLSTFSIIIFAYTGSMNLFPMINELKDNSMENITLVINNSITLSTILFL 238

Query: 308 LMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR 359
           ++G SGY  F +KT GN++ N+  + + I I + C G  ++ +FPL    LR
Sbjct: 239 IVGLSGYLTFGNKTSGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFQPLR 290

>KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} similar
           to uniprot|P50944 Saccharomyces cerevisiae YNL101W AVT4
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 721

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 91/440 (20%), Positives = 164/440 (37%), Gaps = 56/440 (12%)

Query: 65  RDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVI 124
           R +  K++   AF+ M  S +G GV+  P A  N                  W   +++ 
Sbjct: 299 RPSQVKTSTFKAFLLMLKSFIGTGVLFLPSAFANGGLIFSVLMLSFFGMYSYWCYYILIR 358

Query: 125 NLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSS 184
           +    G  ++ D      G   R  +L S  L                +  F Q++FH  
Sbjct: 359 SKVATGVSSFGDIGIKLYGPWMRYAILASLILTQLGFSAAYVVFTCKNLLAFFQNVFHLH 418

Query: 185 NFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLA---LXXXXXXXXXXXXQGPRVDM 241
           +      +++  + +FI  PL+  RN++ LS  S LA                +   +D+
Sbjct: 419 SLRIEHLLILQTI-IFI--PLAFIRNVSKLSLTSLLANFFTMAGLIIIVFFVVKHLVIDL 475

Query: 242 SLKGD----------KWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQ 289
            LK +          KWSL   FI +AIF   GI +I            I      R  +
Sbjct: 476 DLKPEAGIIYGFNSSKWSL---FIGTAIFAFEGIGLI------------IPVQDSMRKPE 520

Query: 290 KFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLT 349
           KF  +  +    + +  + +   GY  F    +  IL N PQD++ +N+ +  +   +L 
Sbjct: 521 KFPLVLGLVILTATVLFISIAALGYLAFGRYIETVILLNLPQDNIFVNLVQFFYSLAILL 580

Query: 350 TFPLEIFVLRDVIAAFLYGK-------KEEDETEAPPLSTR--------KLFIITTVCVV 394
           + PL++F    +I + L  K         +++ +  P S +        K F+ + + + 
Sbjct: 581 STPLQLFPAIGIIESKLVPKFRKTVSPTNKNDVQLSPNSGKLDWKVKWTKNFLRSIIVIF 640

Query: 395 STMSISLTTCNLGALFELIGATTASTMAYILPPYTNL-----VLSKEANTFRQKV---PH 446
                   +  L      IG      + Y+ PP  +L        K+  T + ++     
Sbjct: 641 VICLAYFGSSKLDVFVSFIGCFACIPLVYMYPPLLHLKSCSQPAYKQNQTLKNRLMITMD 700

Query: 447 YLCIFFGFMVMIVSSTQTII 466
           Y  + FG + M+ +S Q I+
Sbjct: 701 YGLVIFGGVSMLYTSYQCIM 720

>YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 713

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 96/435 (22%), Positives = 161/435 (37%), Gaps = 55/435 (12%)

Query: 71  STMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTLAG 130
           ++ +  F+ +  S +G GV+  P A  N                  W   ++V   +  G
Sbjct: 297 TSTKKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGIYSYWCYYILVQAKSSCG 356

Query: 131 KKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFFRR 190
             ++ D      G   RI++L S  +                +  FL ++FH        
Sbjct: 357 VSSFGDIGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFLDNVFHVGVLPLSY 416

Query: 191 NVVITIVTLFISYPLSLQRNIAALSKASFLA-------------LXXXXXXXXXXXXQGP 237
            +V   + +FI  PLS  RNI+ LS  S LA                             
Sbjct: 417 LMVFQTI-IFI--PLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAKRLFFDLMGTPAM 473

Query: 238 RVDMSLKGDKWSLTDIFISSAI--FRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLT 295
            V   L  D+W+L   FI +AI  F GI +I            I      R+ +KF  + 
Sbjct: 474 GVVYGLNADRWTL---FIGTAIFAFEGIGLI------------IPVQDSMRNPEKFPLVL 518

Query: 296 HISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEI 355
            +    + I  + +   GY  +    +  IL N PQ ++ +N+ +L +   ++ + PL++
Sbjct: 519 ALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQL 578

Query: 356 FVLRDVIAAFLYGK------KEEDET---EAPPLSTR--------KLFIITTVCVVSTMS 398
           F    +I    + K      K +D T   E  P S +        K FI + + ++    
Sbjct: 579 FPAIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLNWKIKWLKNFIRSIIVIIVVSI 638

Query: 399 ISLTTCNLGALFELIGATTASTMAYILPPYTNL---VLSKEANTFRQKVP--HYLCIFFG 453
               + NL     +IG+     + YI P   +L    L +    F +  P    + IFFG
Sbjct: 639 AYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFWRFKPMLDTILIFFG 698

Query: 454 FMVMIVSSTQTIIEV 468
              M+ +S Q+I  V
Sbjct: 699 IASMLYTSYQSIFGV 713

>Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa]
           {ON} complement(188477..190204) [1728 nt, 576 aa]
          Length = 575

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 96/418 (22%), Positives = 157/418 (37%), Gaps = 40/418 (9%)

Query: 66  DNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIV-I 124
           D  KK +   A + +  S +G G++  P    N                  +   L++  
Sbjct: 175 DKSKKVSTTKAILLLLKSFVGTGILFLPKGFSNGGYSFSTISLLLCSVISYYCFVLLIST 234

Query: 125 NLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFH-- 182
             T  G   Y D  +   GR  +  +LLS  L                +     S+F   
Sbjct: 235 KDTTHGINGYGDLGQHLFGRPMKFAILLSIVLSQIGFSAAYTVFVATNLKTLCNSVFENL 294

Query: 183 -SSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLA--------LXXXXXXXXXXX 233
            SS  FF    +I    LFI  PLS  RNI  L+  + +A        L           
Sbjct: 295 DSSIKFF----IIFQAILFI--PLSFTRNITKLTATALIADFFILIGLLYIYYYPISYIS 348

Query: 234 XQG-PRVDM-SLKGDKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQ 289
             G  R  M       WSL   FI +AIF   GI +    L+          S+    L 
Sbjct: 349 YNGIARGTMVPFNNKSWSL---FIGTAIFTFEGIGL----LIPIQE------SMAKPHLF 395

Query: 290 KFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLT 349
           + + L+ +   +++IF   +G   YS F    +  +L NFPQD     I +L +   +L 
Sbjct: 396 RLS-LSLVMVIVTLIFVS-VGLLCYSAFGSDVETVVLLNFPQDSPYTLIVQLLYSLAILL 453

Query: 350 TFPLEIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGAL 409
           + PL++F    ++  +++  +   +   P +   K +  T V + ++    +   +L   
Sbjct: 454 STPLQLFPAIRILENWVFKSRYSGKYN-PKIKWAKNYFRTLVVIGTSFIAWIGADDLDKF 512

Query: 410 FELIGATTASTMAYILPPYTNLVLSKEANTFR--QKVPHYLCIFFGFMVMIVSSTQTI 465
             L+G+     + YI PP  ++   K   T      +     I FGF ++I +S QTI
Sbjct: 513 VSLVGSFACIPLIYIYPPLLHIKALKRNGTVTNLHLIVDSCMIIFGFTILIYTSCQTI 570

>ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 467

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 64/147 (43%), Gaps = 11/147 (7%)

Query: 243 LKGD--KWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTF 300
           ++GD   WS+ D      +    S+I FA     N   I   ++N ++     + + S  
Sbjct: 174 VRGDISWWSVYDY---KGLMSTFSIIIFAYTGSMNLFSIVNELRNNTMTNITAVVNRSIA 230

Query: 301 ISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRD 360
           I+ +F + +  +GY  F   T GNI+ N+    + ++I + C G  ++ TFPL     R 
Sbjct: 231 IATVFFIAVALAGYLTFGSNTLGNIMLNYDDTSIYVHIGKFCLGSMVVLTFPLLFHPCRI 290

Query: 361 VI------AAFLYGKKEEDETEAPPLS 381
            +      A     K+ E   E  PL+
Sbjct: 291 AVNNLCVWAQLQREKRAESHQECEPLN 317

>Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W
           (REAL)
          Length = 712

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 120/305 (39%), Gaps = 46/305 (15%)

Query: 185 NFFFRRNVVITIVT-----LFISYPLSLQRNIAALSKASFLA--------LXXXXXXXXX 231
           NFF  +   I + T     + I  PLSL RNIA LS  + +A        +         
Sbjct: 425 NFFHLKPGSINLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGLVYVYVYSIYY 484

Query: 232 XXXQGPRVDMSLKGDK--WSLTDIFISSAI--FRGISVISFALVCHHNTSFIFFSIKNRS 287
               G   D  L  +K  WSL   FI +AI  F GI ++                I+   
Sbjct: 485 ISVNGIASDTMLMFNKADWSL---FIGTAIFTFEGIGLL--------------IPIQ--- 524

Query: 288 LQKFARLTHISTFISMIFCMLM------GYSGYSVFRDKTKGNILNNFPQDDLVINIARL 341
            +      H    +S + C++       G   Y+ F    K  +L NFPQ+       +L
Sbjct: 525 -ESMRHPNHFRPSLSAVMCIVAVVFISCGLLCYAAFGADVKTVVLLNFPQNSSYTLTVQL 583

Query: 342 CFGFNMLTTFPLEIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISL 401
            +   +L + PL++F    ++  + +      +   P +   K +    + +++++   +
Sbjct: 584 LYALAILLSTPLQLFPAIRILENWTFPSNASGK-HNPKVKWLKNYFRCAIVLLTSILAWV 642

Query: 402 TTCNLGALFELIGATTASTMAYILPPYTNLVLSKEANTFRQK-VPHYLCIFFGFMVMIVS 460
              +L     L+G+     + YI PP  +   S  + T R + +   + I FG  VM+ +
Sbjct: 643 GANDLDKFVSLVGSFACVPLIYIYPPLLHFKASSISGTSRGRLLLDLIVISFGVAVMVYT 702

Query: 461 STQTI 465
           S QTI
Sbjct: 703 SWQTI 707

>KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 460

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 81/189 (42%), Gaps = 23/189 (12%)

Query: 204 PLSLQRNIAALSKAS---FLALXXXXXXXXXXXXQG----PRVDMSLKGDKWSLTDIFIS 256
           PLSL R+  +L   S    LAL             G    P+VD       +S++D    
Sbjct: 130 PLSLLRHFDSLKYTSVIGLLALGYIGLLIIGSYSFGNYPKPKVDW------FSISD---R 180

Query: 257 SAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSV 316
           S +    S+I FA     N   I   +K  S+    ++ + S  +S    +++G  GY  
Sbjct: 181 SGVLTTFSIIVFAFTGSMNLFSIINELKENSMTNIKKIINNSIVVSSACFIILGLFGYLT 240

Query: 317 FRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR---DVIAAFL---YGKK 370
           F  +T GN++ N+  D L +  AR   G  ++ +FPL     R   + +  +L   YG K
Sbjct: 241 FGKETLGNVILNYDADKLSVRFARFNLGLMVVLSFPLLFHPCRISANNMVHWLQLNYGTK 300

Query: 371 EE-DETEAP 378
            E DET  P
Sbjct: 301 SEIDETIGP 309

>Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 248 WSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCM 307
           W + D+     +    S+I FA     N   +   +K+ S++    + + S  +S    +
Sbjct: 182 WKIHDL---KGLLSTFSIIIFAYTGSMNLFPMINELKDNSMENITSVINNSISLSTALFL 238

Query: 308 LMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR 359
           ++G SGY  F +KT GN++ N+    + I I + C G  ++ +FPL    LR
Sbjct: 239 IVGLSGYLTFGNKTLGNLILNYDPTSIWIVIGKFCLGLMLILSFPLLFQPLR 290

>SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 616

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 91/414 (21%), Positives = 149/414 (35%), Gaps = 37/414 (8%)

Query: 68  DKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLT 127
             K+T+    + +  S +G GV+  P    N                  W   L++    
Sbjct: 221 QHKATVFKTIILLIKSFVGTGVLFLPKGFHNGGWGFSSVALLFCSVVSYWCFMLLINTKN 280

Query: 128 LAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFF 187
                 Y D      GRK +  +L S  L                +  F  +IFH     
Sbjct: 281 KIRVNGYGDLGGQLYGRKMKFAILSSIVLSQIGFAAAYTVFTATNLQAFFANIFH----- 335

Query: 188 FRRNVVITIVTLFISY-PLSLQRNIAALSKASFLA--------LXXXXXXXXXXXXQGPR 238
           +   + I I+   + Y PLSL R+IA LS    +A        L             G  
Sbjct: 336 WDYPLAIYILLQMVVYIPLSLTRSIAKLSGTVLIADFFILVGLLYLYYYCAYYVSVHGIA 395

Query: 239 VD--MSLKGDKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFAR- 293
            D  +      W+L   FI +AIF   GI ++            I      +  +KF R 
Sbjct: 396 SDSMVLFNSSNWTL---FIGTAIFTYEGIGLL------------IPIQESMKQPEKFPRC 440

Query: 294 LTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPL 353
           L  +   I++IF +  G   YS F    K  IL NFPQD +     +  +   +L + PL
Sbjct: 441 LFGVMLGITVIF-ISCGCLCYSAFGADVKTVILLNFPQDSIFTGGVQFSYALAILLSTPL 499

Query: 354 EIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELI 413
           ++F    ++   ++      +   P +   K +    V + S     +   +L     L+
Sbjct: 500 QLFPAIRILENAVFPSHASGK-HNPKVKWLKNYFRCFVVIASVAIAWVGANDLDKFVSLV 558

Query: 414 GATTASTMAYILPPYTNLVLSKEANTFRQK-VPHYLCIFFGFMVMIVSSTQTII 466
           G+     + YI PP  +    +  N  R   V   + ++FG  +M+  S QT++
Sbjct: 559 GSLACIPLIYIYPPMLHYKAFRGTNISRHDLVLDQVVLWFGIAIMVYISLQTVL 612

>TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/266 (19%), Positives = 108/266 (40%), Gaps = 51/266 (19%)

Query: 236 GPRVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKN--RSLQKFAR 293
           GP V       +W+          F GI++ SF  V       +   +++  R+ +KF  
Sbjct: 308 GPDVIFYFNSSQWT---------TFVGIAIFSFEGVG------LIIPVEDSMRNPEKFPL 352

Query: 294 LTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPL 353
           +  +   +     ML+G  GY  F       IL++F Q +  ++IA+LC+   +L + P+
Sbjct: 353 VLSLVLLVCTAIFMLIGTLGYLTFGKDITPVILSSFNQKNKFVSIAQLCYSIAILLSTPI 412

Query: 354 EIFVLRDVIAAFLYGK--------------KEEDETEAPPLSTRKLFII----------- 388
           ++F +  ++   ++ K              ++ D  E   + T K+ +            
Sbjct: 413 QLFPVYKMVEEAIFKKNKNNTAISSTSSEPQDNDNEENKAMLTEKIILSGRDSNKIKWLK 472

Query: 389 ----TTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNLVLSKEANTFRQKV 444
               TT+ ++ T+     + +L     ++G+     + YI PP+ +L      N+   K 
Sbjct: 473 NLSRTTIVLLVTIISYFGSQDLSKFVAIVGSVACIPLIYIYPPFFHLKTHSLPNSLNLKF 532

Query: 445 PHYLCI-----FFGFMVMIVSSTQTI 465
              + I      FG + ++ +S Q+I
Sbjct: 533 KWRVIIDITLLIFGLLAVLYTSYQSI 558

>Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101W
           (REAL)
          Length = 716

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 94/435 (21%), Positives = 159/435 (36%), Gaps = 55/435 (12%)

Query: 71  STMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTLAG 130
           ++ R  F+ +  S +G GV+  P A  N                  W   ++V   +  G
Sbjct: 300 TSTRKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLTFFGIYSYWCYYILVQAKSSCG 359

Query: 131 KKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFFRR 190
             ++ D      G   +I++L S  +                +  FL+++FH        
Sbjct: 360 VSSFGDIGLKLYGPWMKIIILFSLVITQVGFSGAYMIFTAKNLQAFLENVFHVGALPLSY 419

Query: 191 NVVITIVTLFISYPLSLQRNIAALSKASFLA-------------LXXXXXXXXXXXXQGP 237
            +    V +FI  PLS  RNI+ LS  S LA                             
Sbjct: 420 LMAFQTV-IFI--PLSFIRNISKLSLPSLLANFFIMAGLIIVIIFTAKRLFFDLKAVPAM 476

Query: 238 RVDMSLKGDKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFARLT 295
            V   L  D+W+L   FI +AIF   GI +I            I      +  +KF  + 
Sbjct: 477 GVVYGLNSDRWTL---FIGTAIFAFEGIGLI------------IPVQDSMKHPEKFPLVL 521

Query: 296 HISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEI 355
            +    + +  + +   GY  +    K  IL N PQ ++ +N+ +L +   ++ + PL++
Sbjct: 522 GLVILTATVLFISIATLGYLAYGSDVKTAILLNLPQSNIFVNLIQLFYSIAIMLSTPLQL 581

Query: 356 FVLRDVIAAFLYGK------KEEDET---EAPPLSTR--------KLFIITTVCVVSTMS 398
           F    +I    + K      K +D T   E  P S +        K FI + + ++    
Sbjct: 582 FPAIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLDWKVKWLKNFIRSIIVIIVVSI 641

Query: 399 ISLTTCNLGALFELIGATTASTMAYILPPYTNL---VLSKEANTFRQKVP--HYLCIFFG 453
               + NL     +IG+     + YI P   +L    L +    F +  P    + I FG
Sbjct: 642 AYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFWKFKPILDTILILFG 701

Query: 454 FMVMIVSSTQTIIEV 468
              M+ +S Q+I  V
Sbjct: 702 ITSMLYTSYQSIFGV 716

>Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {ON}
           YNL101W - Hypothetical ORF [contig 60] FULL
          Length = 720

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 73/324 (22%), Positives = 130/324 (40%), Gaps = 57/324 (17%)

Query: 184 SNFFFRRNVVIT---IVTLFISYPLSLQRNIAALS----KASFLALXXXXXXXXXXXXQ- 235
           +N F+   V I     + L I  PLS  RNIA LS     A+FL +              
Sbjct: 410 NNVFYWPGVTIVHLLALQLVIFIPLSFIRNIAKLSLSSLVANFLVMGGIVIVIGFTAKHL 469

Query: 236 ------GPRVD--MSLKGDKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKN 285
                  P  D  M     +W+L   ++ +AIF   GI +I            I      
Sbjct: 470 FFDLNFKPAEDIVMGFNSSRWTL---YVGTAIFAFEGIGLI------------IPIQGSM 514

Query: 286 RSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGF 345
           +  +KF  +  +    + +  + +G  GY  +  KT+  IL N PQ ++++N+ +  +  
Sbjct: 515 KHPEKFPLVLALVIISATVLFVTVGTLGYLSYGAKTETVILLNLPQGNILVNLIQFFYSS 574

Query: 346 NMLTTFPLEIFVLRDVIAAFLYGK------KEEDETEA--PPLSTR--------KLFIIT 389
            +L + PL++F    +I   ++ K      K  D T+    P S +        K F+ +
Sbjct: 575 AILLSTPLQLFPAIAIIENKVFPKFTKIYVKRSDHTKVHYKPNSGKLDWRVKWLKNFVRS 634

Query: 390 TVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNL-----VLSKEANTFRQKV 444
            +  +  ++      +L     ++G+     + YI PP  +L        +   +  +K 
Sbjct: 635 LIVSLVVIAAYFGADHLDTFVSIVGSFACIPLVYIYPPMLHLESCSRPACQNETSIWKKW 694

Query: 445 P---HYLCIFFGFMVMIVSSTQTI 465
           P    Y+ I FG + M+ +S Q+I
Sbjct: 695 PMAVDYVLIIFGAIGMVYTSYQSI 718

>KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.420
           YER119C
          Length = 545

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 89/226 (39%), Gaps = 63/226 (27%)

Query: 262 GISVISFALVCHHNTSFIFFSIKNRSLQKFAR--LTHISTFISMIFCMLMGYSGYSVFRD 319
           G+ ++ F   CH N        + R L+   R  LT+++ + ++  C++ G +GY  F  
Sbjct: 192 GLPLLMFMFTCHQNIFPTLNCARERGLKHTLRVPLTYLAAYAAV--CLICGITGYLTFHK 249

Query: 320 KTK---GNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFL--YGKKEE-- 372
            T+    N+L  +PQ  ++  + R+    ++  +FPL     R  +      +G+ ++  
Sbjct: 250 STRTIPSNVLLLYPQGSILGTLCRVTTLLSVTLSFPLLCHPTRAALNHIWAHWGRGQDSQ 309

Query: 373 ------------DETEAPPL-------------------------------------STR 383
                       DETE  PL                                      T 
Sbjct: 310 ASQPRYKTDATVDETEWTPLISIEGRRVSVDEMVEEGYTKSLPLRNNPCSTDSACTGGTT 369

Query: 384 KLFIITTVCVVST---MSISLTTCNLGALFELIGATTASTMAYILP 426
             FI  T+ +V+    +S+ + +  LGA+  L+G T + T+ Y+LP
Sbjct: 370 ASFIAITILLVAVPTCLSVFIDSATLGAVLGLVGITASVTVGYVLP 415

>ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 89/434 (20%), Positives = 159/434 (36%), Gaps = 64/434 (14%)

Query: 76  AFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTLAGKKTYQ 135
           AF+ +  S +G GV+  P A  N                  W   +++    + G  ++ 
Sbjct: 307 AFLLLLKSFIGTGVLFLPHAFSNGGLFFSIVMLLFFGLYSFWCYYILIRAKEVVGVTSFG 366

Query: 136 DTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFFRRNVVI- 194
           D      G   + ++L S                 + +  F  ++ H     F  N+ I 
Sbjct: 367 DIGLRLYGPWVKFIILFSLVFTQLGFSGAYVIFTAENLKAFCSNVLH-----FSENIPIL 421

Query: 195 --TIVTLFISYPLSLQRNIAALSKASFLA---------------LXXXXXXXXXXXXQGP 237
              +    I  PLS  RN++ LS  S LA               L            +G 
Sbjct: 422 YFMLAQFAIFIPLSFIRNVSKLSLPSLLANFFVMGGLVIVLFFSLKQLALESHMKPAEG- 480

Query: 238 RVDMSLKGDKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFARLT 295
            V +    ++W++   FI +AIF   GI ++            I      R  +KF  + 
Sbjct: 481 -VVLLFNTNRWTM---FIGTAIFAFEGIGLV------------IPVQDSMRHPEKFPLVL 524

Query: 296 HISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEI 355
            +    S +  + +G  GY  +  K K  IL N PQ ++ +N+ +  +   ++ + PL++
Sbjct: 525 GMVIITSTVLFITIGSIGYLAYGYKIKTVILLNLPQANISVNLIQFFYSLAIMLSTPLQL 584

Query: 356 F-----VLRDVIAAF--LYGKKEEDET--EAPPLSTR--------KLFIITTVCVVSTMS 398
           F     +   V   F  +Y KK+++ T  E  P S +        K F+ + +     + 
Sbjct: 585 FPAIKIIENKVFPKFIKIYVKKDDNTTGVEMRPNSGKLNWKVKWLKNFVRSLIVGSVILM 644

Query: 399 ISLTTCNLGALFELIGATTASTMAYILPPYTNLVLSKEANTFRQKVP-----HYLCIFFG 453
                  L     LIG+     + Y+ PP  +L      N    ++       Y+ I FG
Sbjct: 645 AYFGADQLDKFVALIGSFACIPLVYMYPPMLHLRSCSLPNHKGGRINWSAGLDYVLIIFG 704

Query: 454 FMVMIVSSTQTIIE 467
            + MI +S Q++ +
Sbjct: 705 AISMIYTSYQSVTQ 718

>NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {ON}
           Anc_5.252
          Length = 721

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 118/285 (41%), Gaps = 31/285 (10%)

Query: 196 IVTLFISYPLSLQRNIAALSKASFLA--------LXXXXXXXXXXXXQGPRVDMSLKGDK 247
           I+   I  PLSL R IA LS  + +A        +             G   +  L  +K
Sbjct: 448 ILQQLIFIPLSLTRKIAKLSGTALIADLFILLGLIYVYYYSSYYILSNGIASESMLWLNK 507

Query: 248 --WSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISM 303
             WSL   FI +AIF   GI ++            I      ++ Q F +   +   I  
Sbjct: 508 ADWSL---FIGTAIFTFEGIGLL------------IPIQESMQNPQVFPKCLSLVMCIVT 552

Query: 304 IFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIA 363
           I  +  G   YS F +K +  +L NFPQD     + +L +   +L + PL++F    ++ 
Sbjct: 553 IIFISCGLICYSAFGEKVETVVLLNFPQDSAFTLMVQLLYSLAILLSTPLQLFPAIKILE 612

Query: 364 AFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAY 423
            + +      +  +  +  +K +    + + + M   +   +L     L+G+     + Y
Sbjct: 613 NWTFPIHASGKHNS-RIKWKKNYFRCIMVIFTAMVAWVGANDLDKFVSLVGSFACIPLIY 671

Query: 424 ILPPYTNL--VLSKEANTFRQKVPHYLCIF-FGFMVMIVSSTQTI 465
           I PP  +    L+  + T R ++   + +F FG ++M+ +S +TI
Sbjct: 672 IYPPLLHFKAFLNDTSKTMRFRLGLDMLVFVFGIIIMVYTSWETI 716

>YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}
           AVT7Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 490

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 54/104 (51%), Gaps = 4/104 (3%)

Query: 260 FRGI----SVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYS 315
           F+G+    S+I FA     N   +   +K+ S++    + + S  +S    +++G SGY 
Sbjct: 187 FKGLLSTFSIIIFAFTGSMNLFPMINELKDNSMENITFVINNSISLSTALFLIVGLSGYL 246

Query: 316 VFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR 359
            F ++T GN++ N+  + + I I + C G  ++ +FPL    LR
Sbjct: 247 TFGNETLGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFHPLR 290

>Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088C -
           Hypothetical ORF [contig 27] FULL
          Length = 471

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 112/304 (36%), Gaps = 72/304 (23%)

Query: 190 RNVVITIVTLFISYPLSLQRNIAALSKASFLALXXXXXXXXXXXXQGPRVDM-------S 242
           RN+ I    L I  PLSL + + +L  +S L L               R D+       +
Sbjct: 120 RNMWIMASALII-VPLSLVKKLDSLKYSSILGLFAIAYLVCLIVGAFLR-DVVFTDNYTA 177

Query: 243 LKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFIS 302
           ++GD  S   ++    +    +++ FA     N   I   +K+ S+    ++   +  IS
Sbjct: 178 IRGDV-SWIRVYDFKGLISTFTIVIFAYTGSMNMFSIINELKDNSMTNINKVVSTTITIS 236

Query: 303 MIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVI 362
               + +G  GY  F   T GNI+ N+  +       +LC G  ++ +FPL +   R  I
Sbjct: 237 SFLFLAVGLCGYLTFGSNTLGNIMLNYDPNSAWTTTGKLCLGSMVILSFPLLLHPCR--I 294

Query: 363 AA--------FLYGK-----------------------KEED------------------ 373
           AA          YGK                        EED                  
Sbjct: 295 AANNMVHWTIINYGKCADHQIARNQHTHVTSPITMVVEDEEDRLLLESDAGYNATTQALP 354

Query: 374 -----------ETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMA 422
                      +TE  P   ++ +IIT + V S   ++L   +   +  L+GAT ++ ++
Sbjct: 355 SNDIEESRVDSKTEVVPFPNKRFYIITAILVTSLYILALNVSSFALVLALVGATGSTAIS 414

Query: 423 YILP 426
           + LP
Sbjct: 415 FTLP 418

>NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295
          Length = 496

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 51/104 (49%), Gaps = 4/104 (3%)

Query: 260 FRGI----SVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYS 315
           FRG+    S+I FA     N   +   +++ S+Q    + + S  IS    +L+G SGY 
Sbjct: 189 FRGLLSTFSIIIFAYTGAMNLFSMIRELEDISMQNIKNVINGSIIISTGLFLLVGISGYL 248

Query: 316 VFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR 359
            F    +GNI+ N+  +   I I + C G  ++ +FPL    LR
Sbjct: 249 TFGSNVEGNIILNYNPNSNWIYIGKFCLGTMLILSFPLLFHPLR 292

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 10/95 (10%)

Query: 384 KLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPP-YTNLVLSKEANTFRQ 442
           + + IT   ++    I+L   +   +  LIGAT ++++++ILP  +   ++  ++    Q
Sbjct: 398 RFYGITAFLLIVMYIIALNVKSFALVLALIGATGSTSISFILPGLFGYKLIGTDSLAIGQ 457

Query: 443 KVP---------HYLCIFFGFMVMIVSSTQTIIEV 468
            VP           L +FFG  VMI+S   T+ EV
Sbjct: 458 MVPLRDRLYKRLSLLLVFFGLAVMILSLYVTLSEV 492

>TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {ON}
           Anc_2.295 YIL088C
          Length = 467

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 87/227 (38%), Gaps = 60/227 (26%)

Query: 260 FRGI----SVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYS 315
           F+G+    S+I FA     N   I   +K  S+     + + S  IS    + +G  GY 
Sbjct: 187 FKGLLSTFSIIVFAYTGSMNLFSIINELKENSMANITSVINTSITISTAVFLAVGICGYL 246

Query: 316 VFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPL----------------EIFVLR 359
            F   T GNI+ N+  D   + + +LC G  ++ +FPL                EI   +
Sbjct: 247 TFGSNTLGNIMLNYDPDSTWVYVGKLCLGSMVMLSFPLLFHPCRIAINNLVVWSEIHFKK 306

Query: 360 DVIAAF----------------LYGKKEEDET------------------------EAPP 379
           D I                   L  + E++E+                        E  P
Sbjct: 307 DPIMPSQQAQARSRPGEGSPIRLSIQDEDNESLAGFDNDIESVDGDDTQVIRGNNVETTP 366

Query: 380 LSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP 426
               + + I+ + ++   S++L   +   +  L+GAT ++++++ILP
Sbjct: 367 FPNSRFYAISAILLILMYSLALKVKSFAFVLALVGATGSTSISFILP 413

>Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W
           (REAL)
          Length = 719

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 77/356 (21%), Positives = 131/356 (36%), Gaps = 44/356 (12%)

Query: 130 GKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFH-SSNFFF 188
           G   Y D      G K ++ +LLS  L                +  F +  FH       
Sbjct: 383 GVDGYGDMGRVLYGPKMKLAILLSIALSQIGFSAAYTVFTATNLQVFCEHFFHLKPGSIN 442

Query: 189 RRNVVITIVTLFISYPLSLQRNIAALSKASFLA--------LXXXXXXXXXXXXQGPRVD 240
               +   V +F+  PLSL RNIA LS  + +A        +             G   D
Sbjct: 443 LATYIFAQVLIFV--PLSLTRNIAKLSGTALIADVFILLGLVYVYYYSIYHIAVNGIASD 500

Query: 241 MSLKGDK--WSLTDIFISSAI--FRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTH 296
             L  +K  WSL   FI +AI  F GI ++                I+    +      H
Sbjct: 501 TMLMFNKADWSL---FIGTAIFTFEGIGLL--------------IPIQ----ESMKHPNH 539

Query: 297 ISTFISMIFCMLM------GYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTT 350
               +S + C++       G   Y+ F    K  +L NFPQD       +L +   +L +
Sbjct: 540 FQPSLSAVMCIVAVVFISCGLLCYAAFGADVKTVVLLNFPQDSSYTLTVQLLYALAILLS 599

Query: 351 FPLEIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALF 410
            PL++F    ++  + +      +   P +   K +    + +++++   +   +L    
Sbjct: 600 TPLQLFPAIRILENWTFPSNASGK-HNPKVKWLKNYFRCAIVLLTSVLAWVGANDLDKFV 658

Query: 411 ELIGATTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIF-FGFMVMIVSSTQTI 465
            L+G+     + YI PP  +      +   R ++   L +  FG +VM  +S QTI
Sbjct: 659 SLVGSFACIPLIYIYPPMLHYKAFSLSGISRARLLLDLVVLSFGVVVMAYTSWQTI 714

>SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} similar
           to uniprot|P40501 Saccharomyces cerevisiae YIL088C AVT7
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 472

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 83/198 (41%), Gaps = 22/198 (11%)

Query: 204 PLSLQRNIAALSKASFLALXXXXXXXXXXXXQGPRVDMSLKGDKWSLT--DIF-ISSAIF 260
           PL L R++ +L  +S L L             G  V   +  D +  T  D+F +    +
Sbjct: 131 PLCLLRHLDSLKYSSILGLFALAYLVTLVI--GTFVYGVVLHDDYKYTRGDVFWVKVYDY 188

Query: 261 RGI----SVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSV 316
            G+    S+I FA  C  N   I   + + S+    ++ + S  I+    + +G +GY  
Sbjct: 189 NGLISTFSIIIFAYTCTMNIFSIINELTDNSVSNVTKVANSSIGIATFLILSVGITGYLT 248

Query: 317 FRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR---DVIAAFL---YGKK 370
           F     GNI+ N+  D +   + + C G  ++ +FPL     R   + +  +L   YG  
Sbjct: 249 FGSNVLGNIILNYDPDSIWTRVGKFCLGCMVVLSFPLMFHPCRLATNNMVHWLQVNYGHC 308

Query: 371 EEDET-------EAPPLS 381
           E  +T       EA P+S
Sbjct: 309 ETHQTANNDHIHEARPIS 326

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 34/58 (58%)

Query: 369 KKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP 426
           ++ ED + A P S RK + IT + +++   ++L   +   +  L GAT ++++++ LP
Sbjct: 362 REIEDNSSAIPFSERKFYAITAILLLALYGLALRVTSFALVLALAGATGSTSISFTLP 419

>KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2.295
           YIL088C
          Length = 479

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 54/104 (51%), Gaps = 4/104 (3%)

Query: 260 FRGI----SVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYS 315
           F+G+    S+I FA     N   I   +KN S++  + + + S  IS I  + +G +GY 
Sbjct: 187 FKGLLSTFSIIIFAYTGAMNLFSIINELKNNSMENVSSIINHSISISTILFLTVGIAGYL 246

Query: 316 VFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR 359
            F   T GNIL N+  D + ++IA+ C    ++ +FPL    LR
Sbjct: 247 TFGCNTLGNILLNYDADSVWVSIAKFCLAIMLVLSFPLLFHPLR 290

>KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.295
           YIL088C
          Length = 474

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 52/108 (48%)

Query: 252 DIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGY 311
           +I+    +    S+I FA V   N   I   + + ++   +++ + S  IS +  + +G 
Sbjct: 185 EIYSGKGLLSTFSIIIFAYVGAMNLFTIINELSDNNITNISKIINRSIAISTVAFLSVGI 244

Query: 312 SGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR 359
           +GY  F   T GNI+ N+  + + +NI +      +L +FPL    LR
Sbjct: 245 TGYLTFGSNTLGNIILNYDPNSIWVNIGKFSLASMLLLSFPLLFHPLR 292

>NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177
          Length = 705

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 101/244 (41%), Gaps = 39/244 (15%)

Query: 246 DKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISM 303
           ++W+L   F+ +AIF   GI +I            I      ++ +KF  +  +    + 
Sbjct: 474 ERWTL---FVGTAIFSFEGIGLI------------IPIQDSMKNPEKFPLVLGLVLITAT 518

Query: 304 IFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIA 363
           I  + +   GY  +       IL N PQ ++ +N+ +L +   ++ + PL++F    +I 
Sbjct: 519 ILFISIATIGYLSYGSSIDVVILLNLPQSNIFVNLIQLFYSLAIMLSTPLQMFPAIKIIE 578

Query: 364 AFLYGK------KEEDETEAPPLSTR-----------KLFIITTVCVVSTMSISLTTCNL 406
           + L+ K      K+ +   +  LS             K F+ + +  +  +   L   NL
Sbjct: 579 SKLFPKFIKVYAKDGNSPGSYELSLNSGKLNWKVKWLKNFVRSIIVTLVVLIAYLEVENL 638

Query: 407 GALFELIGATTASTMAYILPPYTNLVLSKEANTFRQKVP-----HYLCIFFGFMVMIVSS 461
             +  +IG+     + YI PP  +L       +  QKV       YL + FG + M  +S
Sbjct: 639 DKVVSIIGSLACIPLVYIYPPLLHLRSHSIPFSVNQKVKWRVLFDYLLVGFGTVSMFYTS 698

Query: 462 TQTI 465
            Q+I
Sbjct: 699 YQSI 702

>Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 4/104 (3%)

Query: 260 FRGI----SVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYS 315
           F+G+    S+I FA     N   +   +K+ S+     + + S  +S    +++G SGY 
Sbjct: 187 FKGLLSTFSIIIFAYTGSMNLFPMINELKDNSMGNITLVINNSISLSTALFLIVGLSGYL 246

Query: 316 VFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR 359
            F + T GN++ N+  + + I I + C G  ++ +FPL    LR
Sbjct: 247 TFGNSTLGNLILNYDPNSVWIIIGKFCLGSMLILSFPLLFQPLR 290

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/55 (23%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 372 EDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP 426
           ++E  AP + +R  ++IT + ++S  +++L+  +   +  L+GAT ++++++ +P
Sbjct: 381 DNEHHAPFVRSR-FYLITALLLISMYTLALSVESFALVLSLVGATGSTSISFTIP 434

>KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 72/324 (22%), Positives = 131/324 (40%), Gaps = 59/324 (18%)

Query: 185 NFFFRRNVVIT---IVTLFISYPLSLQRNIAALSKASFLA---LXXXXXXXXXXXXQGPR 238
           N F+   V I     + L +  PLS  RNIA LS +S +A   +            +   
Sbjct: 409 NVFYWPGVTIVHLLALQLVVFIPLSFIRNIAKLSFSSLVANFLVMGGIVIVIGFTAKHLF 468

Query: 239 VDMSLK----------GDKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNR 286
            D++ K             W+L   F+ +AIF   GI +I            I      +
Sbjct: 469 FDLNCKPAEGIVTGFNSQSWTL---FVGTAIFAFEGIGLI------------IPIQSSMK 513

Query: 287 SLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFN 346
             +KF  +  +    + +  + +   GY  +  +T+  IL N PQD +++N+ +  +   
Sbjct: 514 HPEKFPLVMALVIITATVLFVSVATLGYLSYGAETQTVILLNLPQDSILVNLIQFFYSSA 573

Query: 347 MLTTFPLEIFVLRDVIAAFLYGK------KEEDET--EAPPLSTR--------KLFIITT 390
           +L + PL++F    +I   ++ K      K  D T  +  P S +        K F+ + 
Sbjct: 574 ILLSTPLQLFPAIAIIENKVFPKFTKIYVKRSDHTKIQYKPNSGKLDWRIKWLKNFVRSL 633

Query: 391 VCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNL------VLSKEANTFRQKV 444
           +     ++      +L A   ++G+     + YI PP  +L        + E + +R K 
Sbjct: 634 IVSSVVIAAYFGANHLDAFVAIVGSLACIPLVYIYPPMLHLRSCSKPRFAGEKSVWR-KW 692

Query: 445 P---HYLCIFFGFMVMIVSSTQTI 465
           P    Y+ + FG + M+ +S Q+I
Sbjct: 693 PILLDYVLVVFGAIGMVYTSYQSI 716

>ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 608

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 91/421 (21%), Positives = 151/421 (35%), Gaps = 43/421 (10%)

Query: 65  RDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVI 124
           +   +K+T   A + +  S +G GV+  P A  N                      L++ 
Sbjct: 208 KKQQRKATTFKAILLLLKSFVGTGVLFLPRAFHNGGWAFSTGCLLFCAIASSLAFVLLIK 267

Query: 125 NLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSS 184
                G   Y D  +   G K    +L S  L                +  F ++ F+  
Sbjct: 268 TKDKVGVSGYGDLGKALYGPKVEFSILFSIALSQLGFSAAYTVFTATNLKVFFENAFN-- 325

Query: 185 NFFFRRNVVIT---IVTLFISYPLSLQRNIAALSKASFLA--------LXXXXXXXXXXX 233
             F   +V ++   I+   I  PLSL RNI  LS  + +A        L           
Sbjct: 326 --FPADSVPLSAYIILQALIFIPLSLTRNITKLSGTALIADLFILLGLLYVYYYPALYIA 383

Query: 234 XQGPRVDMSL--KGDKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQ 289
             G   D  L      WSL   FI +AIF   GI ++                I+  S++
Sbjct: 384 KHGIATDSVLFFNRSDWSL---FIGTAIFTFEGIGLL--------------IPIQ-ESMK 425

Query: 290 K----FARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGF 345
           K    +  L  + + ++ IF    G   Y  F  K +  +L NFPQD +     +L +  
Sbjct: 426 KPEHFYPSLGFVMSIVTFIFVS-SGLLCYLAFGAKVETVVLLNFPQDSIATISVQLIYSL 484

Query: 346 NMLTTFPLEIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCN 405
            +L + PL++F    +   + +      +     +   K +  T V + + +   +   +
Sbjct: 485 AILLSTPLQLFPAIRIFETWTFPSNASGKHNH-RVKWLKNYFRTGVVIFTALLAWVGAND 543

Query: 406 LGALFELIGATTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTI 465
           L     L+G+     + YI PP  +L  S    +    +   L  FFG  VM  +S Q I
Sbjct: 544 LDKFVSLVGSFACIPLIYIYPPLLHLKSSDTQTSKFIILGDLLIFFFGVGVMAYTSYQNI 603

Query: 466 I 466
           +
Sbjct: 604 V 604

>ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL088C
          Length = 468

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%)

Query: 264 SVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKG 323
           S+I FA     N   I   + + S++   R+ + S   S    +L+G +GY  F      
Sbjct: 194 SIIVFAFTGSMNMFSIINELGDNSMRNIQRIVYYSIAASTALFILVGMAGYLTFGSNVAQ 253

Query: 324 NILNNFPQDDLVINIARLCFGFNMLTTFPL 353
           N++ NF  D +   +  L  G  +L +FPL
Sbjct: 254 NVILNFDPDAVSTQVGSLALGLMVLLSFPL 283

>Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar to
           Ashbya gossypii ACR051C
          Length = 627

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 76/165 (46%), Gaps = 15/165 (9%)

Query: 314 YSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIF-----VLRDVIAAFLYG 368
           YS F  + +  IL NFP+D ++ +  +  +   ++ + PL++F     +   +I++ + G
Sbjct: 470 YSAFGSRVETVILLNFPKDSVLSSSVQFLYAMAIMLSTPLQLFPAIRILEHGIISSSVSG 529

Query: 369 KKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTC-NLGALFELIGATTASTMAYILPP 427
           K +     A     +  F +  V V  T+SI+     +L     LIG+     + YI PP
Sbjct: 530 KHDPRVKWA-----KNWFRVLVVFV--TVSIAWVGADDLDKFVSLIGSFACVPLIYIYPP 582

Query: 428 YTNLVLSKEANTFRQKV--PHYLCIFFGFMVMIVSSTQTIIEVVK 470
             + +L K              L ++FG + M  +S+QT+ + ++
Sbjct: 583 LLHYMLFKGTGRVSNAALFLDQLVVWFGVIGMFYTSSQTVKQWLQ 627

>KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.177
           YNL101W
          Length = 714

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 78/391 (19%), Positives = 147/391 (37%), Gaps = 52/391 (13%)

Query: 71  STMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTLAG 130
           ++ R AF+ +  S +G GV+  P A  N                  W   ++V       
Sbjct: 299 TSTRKAFLLLLKSFVGTGVLFLPDAFHNGGLAFSIIVLTLVGLYSYWCYYILVQTKVKVK 358

Query: 131 KKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFFRR 190
             ++ D      G+  + ++L++  +                +  FLQ+IFH  +F    
Sbjct: 359 ACSFGDIGSQLYGKWMKSVILVAIFVSQLGFSAAYMIFTAKNLGAFLQNIFHLKDFNLG- 417

Query: 191 NVVITIVTLFISYPLSLQRNIAALSKASFLA-------------LXXXXXXXXXXXXQGP 237
              I I+ L    PLS  RNI+ LS  S +A                             
Sbjct: 418 --YIMIIQLIFFVPLSFIRNISKLSLPSLIANVFIMLGLLIILIFASKHLFLDLGVHPAA 475

Query: 238 RVDMSLKGDKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFARLT 295
            V+  +   +W+L   F+ +AIF   GI +I            I      +  +KF+ + 
Sbjct: 476 GVEYGIDPRRWTL---FVGTAIFSFEGIGLI------------IPVQDSMKRPEKFSLVL 520

Query: 296 HISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEI 355
            +    + I  + +   GY  +  + +  +L N PQ +L +N+ +  +   ++ + PL++
Sbjct: 521 KLVMITTTIIFITIATVGYLAYGSEIQTVVLLNLPQGNLFVNLIQFLYSLAIMLSTPLQL 580

Query: 356 FVLRDVIAA---FLYGKK-------EEDE-TEAPPLSTR--------KLFIITTVCVVST 396
           F    ++     + Y KK       E +E T+    S +        K  + +T+ V + 
Sbjct: 581 FPAIKILEGKVFYRYNKKVSRQLSGEANESTKGGSYSGKSNMKIKWLKNLLRSTIVVGAI 640

Query: 397 MSISLTTCNLGALFELIGATTASTMAYILPP 427
           +   L   +L  +  +IG+     + +ILPP
Sbjct: 641 LIAYLGMDSLDKVVSIIGSFCCLPLVFILPP 671

>TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.177
           YNL101W
          Length = 715

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/323 (21%), Positives = 129/323 (39%), Gaps = 55/323 (17%)

Query: 183 SSNFFFRRNVVIT---IVTLFISYPLSLQRNIAALSKASFLA---LXXXXXXXXXXXXQG 236
           + N F   +V I+   I+ L +  PLS  RN++ LS  S LA   +            + 
Sbjct: 405 TKNVFLVSDVPISYFMIIQLIVFIPLSFIRNVSKLSLPSLLANFFVMAGLAIVLFFSTKH 464

Query: 237 PRVDMSLKG----------DKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIK 284
             +D+ ++            +WS+   F+ +AIF   GI +I            I     
Sbjct: 465 LVIDLGMRAADGVIVGFNQSRWSM---FVGTAIFAFEGIGLI------------IPVQDS 509

Query: 285 NRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFG 344
            R  +KF  +  +    S +  + +   GY  +    +  IL N PQ ++ +N+ +  + 
Sbjct: 510 MRHPEKFPMVLALVIGSSTVLFITIASIGYLAYGSAIETVILLNLPQKNVFVNLIQFFYS 569

Query: 345 FNMLTTFPLEIF-----VLRDVIAAF--LYGKKEEDETE------APPLSTRKLFIITTV 391
             ++ + PL++F     +   V   F  +Y KK++D T+      +  L+ +  ++  +V
Sbjct: 570 LAIMLSTPLQLFPAIKIIENKVFPKFTKIYVKKDDDTTDIQLRPNSGKLNWKVKWLKNSV 629

Query: 392 CVVSTMSISLTTC----NLGALFELIGATTASTMAYILPPYTNLVLSKEANTFRQKVPHY 447
             +    + L        L     +IG+     + Y+ PP  +L       +  QK P  
Sbjct: 630 RAIIVALVILMAYYGADKLDKFVSIIGSFACIPLVYMYPPMLHLQSYSRPRSAGQKFPWR 689

Query: 448 -----LCIFFGFMVMIVSSTQTI 465
                + I FG + M  +S Q+I
Sbjct: 690 SIVDCVLIVFGGVSMCYTSYQSI 712

>ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL146W
          Length = 678

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 116/281 (41%), Gaps = 36/281 (12%)

Query: 204 PLSLQRNIAALSKASFLA--------LXXXXXXXXXXXXQGPRVDMSLKGDKWSLTDIFI 255
           PL+L R I  LS  + LA        +             G   D  L  +  S T +F+
Sbjct: 414 PLALTRRITKLSATALLADLFILLGLVYVYYFSASQVVQHGAATDSMLAFNPSSWT-VFL 472

Query: 256 SSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFAR-LTHISTFISMIFCMLMGYS 312
            +AIF   G+ ++            I      RS +KF R L  +   ++ +F +  G  
Sbjct: 473 GTAIFTYEGVGLL------------IPIQESMRSPEKFRRCLLWVMVAVTAVF-ISFGML 519

Query: 313 GYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIF----VLRDVIAAFLYG 368
            Y+ F  K +  IL NFPQD  +    +L +   ++ + PL++F    +L +V+      
Sbjct: 520 CYAAFGAKVETVILLNFPQDSALGTGVQLLYAAAIMLSTPLQLFPAIRILENVVVTTSRS 579

Query: 369 KKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPY 428
            K   + +       K +    V V+  +  SL + +L     LIG+     + Y+ PP 
Sbjct: 580 GKYSTKVKWI-----KNWFRALVVVLMLVLASLGSNDLDKFVSLIGSFACIPLIYVYPPL 634

Query: 429 TNLVLSKEANTFRQ-KVPHYLCIF-FGFMVMIVSSTQTIIE 467
            + V+ +   T  Q  +   L +  FG  +M  ++ QT+++
Sbjct: 635 LHYVVFRGTGTVSQVALALDLAVMAFGLGIMGYTTVQTVVQ 675

>TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.252
           YKL146W
          Length = 613

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/154 (20%), Positives = 68/154 (44%), Gaps = 2/154 (1%)

Query: 314 YSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFLYGKKEED 373
           YS F  K +  +L NFPQD      A+L +   +L + PL++F    ++  + +   +  
Sbjct: 457 YSAFGSKVETVVLLNFPQDSPFTKSAQLLYVLAILLSTPLQLFPAIRILENWTF-PVDAS 515

Query: 374 ETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNLVL 433
               P +   K +  + + + +++       +L     L+G+     + YI PP  +   
Sbjct: 516 GKHNPHIKWLKNYFRSAIVIATSLIAWGGANDLDKFVSLVGSFACVPLIYIYPPALHFKA 575

Query: 434 SKEANTFR-QKVPHYLCIFFGFMVMIVSSTQTII 466
            K+ N  +   V   +    G ++M+ ++ Q+I+
Sbjct: 576 FKDKNASKISLVTDVVIASVGVIIMLYNTYQSIL 609

>Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON}
           (11352..13655) [2304 nt, 768 aa]
          Length = 767

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 80/428 (18%), Positives = 164/428 (38%), Gaps = 55/428 (12%)

Query: 76  AFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTLAGKKTYQ 135
           AF  +  S +G G++  P A  N                  W   +++ +  +    ++ 
Sbjct: 356 AFFLLLKSFIGTGILFLPRAFDNGGLIFSICMLLFFGIYSYWCYYILIRSKNITQVTSFG 415

Query: 136 DTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFFRRNVVIT 195
           D      GR  + ++L S  L                +  F++++F   +F  +    + 
Sbjct: 416 DIGYKLYGRWMKFVILFSLVLTQLGFAGAYVIFTAKNLKAFVENVFRVPDFDLK---YLM 472

Query: 196 IVTLFISYPLSLQRNIAALSKASFLA---LXXXXXXXXXXXXQGPRVDMSLKGDK----- 247
           I  LFI  PLS  RN++ LS  S +A   +            +    D++++ ++     
Sbjct: 473 IFQLFIFTPLSYVRNVSKLSFPSLVANFFIMSGLAIVIVFTMKHLFYDLNMRPEEGVIYG 532

Query: 248 -----WSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTF 300
                W+L   FI +AIF   GI +I            I      +  + F  +  +   
Sbjct: 533 FNSNGWTL---FIGTAIFAFEGIGLI------------IPIQDSMKHPEHFPLVLGLVIM 577

Query: 301 ISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRD 360
            + +  + +   GY  +    +  IL N P+ ++ +N+ +L +   ++ + PL++F    
Sbjct: 578 TATVLFVTIATIGYLAYGKLIETVILLNLPKSNIFVNLIQLFYSMAIMLSTPLQLFPAIK 637

Query: 361 VIAAFLYGK------KEEDETEAPPLST-----------RKLFIITTVCVVSTMSISLTT 403
           +I   ++ K      K +   E   L             RK F+ + + ++  +      
Sbjct: 638 IIENKVFPKFTKYYVKIDQTREGVRLRQNSGKLDWRVKWRKNFLRSVIVLIVILMAYYGY 697

Query: 404 CNLGALFELIGATTASTMAYILPPYTNL----VLSKEANTFRQKVP-HYLCIFFGFMVMI 458
            +L     +IG+     + Y+ PP  +L    + S E    + +V   Y+ I FG + M+
Sbjct: 698 DDLDRFVSIIGSFACIPLVYMYPPMLHLRSYSIPSSEGLKIKYRVILDYILIAFGGVSML 757

Query: 459 VSSTQTII 466
            +S Q+++
Sbjct: 758 YTSYQSLM 765

>CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101w
          Length = 733

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 121/313 (38%), Gaps = 51/313 (16%)

Query: 191 NVVIT---IVTLFISYPLSLQRNIAALSKASFLA----------LXXXXXXXXXXXXQGP 237
           NV IT   I  L +  PLS  R I+ LS  S  A          +             G 
Sbjct: 430 NVSITFLMISQLLLFIPLSFVRKISKLSLPSLFANVFILVGLVIVVFFSMKHLFYDLSGS 489

Query: 238 RVD---MSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARL 294
             D     +   +W+L   FI +AIF   S     LV     S        R  +KF  +
Sbjct: 490 PADGVIFGINNSRWTL---FIGTAIF---SFEGIGLVIPVQDSM-------RKPEKFPLV 536

Query: 295 THISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLE 354
             +    + +  +++   GY  +  +    IL N PQ ++++++ +L +   ++ + PL+
Sbjct: 537 LGLVIICTTVVFIIVATIGYLAYGSEVDTVILLNLPQKNILVSLIQLLYSIAIMLSTPLQ 596

Query: 355 IFVLRDVIAAFLY-------------GKKEEDETEAPPLSTR----KLFIITTVCVVSTM 397
           +F    +I + L+             G   E  T +   S +    K  + +++ ++   
Sbjct: 597 MFPAIRIIESGLFKQYDRWVNRSDREGHATEHNTSSGKSSWKVKWMKNAVRSSIVILVVA 656

Query: 398 SISLTTCNLGALFELIGATTASTMAYILPPY-----TNLVLSKEANTFRQKVPHYLCIFF 452
              +   NL     +IG+     + Y+ PP      T+L  S      R+ +   + I F
Sbjct: 657 IACVGADNLDKFLSIIGSFACIPLVYMYPPMLHLKSTSLPRSNGKIMSRRVIIDIVLIIF 716

Query: 453 GFMVMIVSSTQTI 465
           G + M+ +S Q+I
Sbjct: 717 GGISMVYTSYQSI 729

>SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 733

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 97/432 (22%), Positives = 157/432 (36%), Gaps = 63/432 (14%)

Query: 76  AFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTLAGKKTYQ 135
           AF+ M  S +G GV+  P A  N                  W    I+I   +A K +  
Sbjct: 321 AFLLMIKSFIGTGVLFLPNAFANGGLTFSVCMLSFFGIYSYWCY-YILIQSKVATKVSSF 379

Query: 136 DTVEFAL-GRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFFRRNVVI 194
             + F L G   + ++L S  L                +  FL ++F   +        +
Sbjct: 380 GDIGFRLYGTWMKFVILFSLVLTQLGFSGAYVVFTAKNLIAFLDNVFRWHDVPIE---YL 436

Query: 195 TIVTLFISYPLSLQRNIAALSKASFLA---------------LXXXXXXXXXXXXQGPRV 239
             + L I  PLS  RN++ LS  S +A               L            +G  V
Sbjct: 437 LFLQLAIFIPLSFIRNVSKLSLTSLIANFLVMAGLIIVVFFVLKHLILDLHFTPAEG--V 494

Query: 240 DMSLKGDKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHI 297
            M      WSL   FI +AIF   GI +I            I      +  +KF  +  +
Sbjct: 495 IMGFNSSSWSL---FIGTAIFAFEGIGLI------------IPVQDSMKHPEKFPLVLGL 539

Query: 298 STFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIF- 356
               + +  + +   GY  +   T+  IL N PQ +L +N+ +  +   +L + PL++F 
Sbjct: 540 VIGAATVLFVTIATLGYLSYGQNTETVILLNLPQGNLCVNLIQFFYSLAILLSTPLQLFP 599

Query: 357 ----VLRDVIAAF--LYGKK-EEDETEAPPLSTR-----KLFIITTVCVVSTMSISLT-- 402
               +   V   F  +Y KK    + E  P S +     K    +   V+ +  I L   
Sbjct: 600 AIAIIENKVFPRFTKIYVKKNNRTDVELRPNSGKLDWKVKWLKNSVRSVIVSFVILLAYY 659

Query: 403 -TCNLGALFELIGATTASTMAYILPPYTNLVLSKEAN-----TFRQKVP---HYLCIFFG 453
            + NL     ++G      + Y+ PP  +L    +        + +K P    YL I FG
Sbjct: 660 GSENLDKFVSIVGCFACIPLVYMYPPLLHLRSCSKPQCHGVTKWWKKWPIGLDYLLITFG 719

Query: 454 FMVMIVSSTQTI 465
            + MI +S Q +
Sbjct: 720 GVSMIYTSYQCV 731

>KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 601

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 58/131 (44%), Gaps = 4/131 (3%)

Query: 297 ISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIF 356
           +S  I+ I C L+ YS    F    +  IL NFP+   +    +L +   ++ + PL++F
Sbjct: 431 VSVSIAFILCGLLCYSA---FGSSVETVILLNFPRKSAMTASVQLLYALAIMLSTPLQLF 487

Query: 357 VLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGAT 416
            +  ++   ++ K    +   P +   K +    + + +T+   L   +L     ++G+ 
Sbjct: 488 PIIRILETSIFPKNASGKYN-PRVKWMKNYFRIGIVLANTLIAWLGANDLDKFVSIVGSF 546

Query: 417 TASTMAYILPP 427
               + YI PP
Sbjct: 547 ACIPLIYIYPP 557

>Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AER380C
          Length = 715

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 86/425 (20%), Positives = 155/425 (36%), Gaps = 60/425 (14%)

Query: 69  KKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLIVINLTL 128
           K ST + AF+ +  S +G GV+  P A  N                  W   ++V     
Sbjct: 297 KTSTFK-AFLLLIKSFVGTGVLFLPNAFSNGGLAFSIIMLFIFSGYSYWCYYILVRTKVS 355

Query: 129 AGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFHSSNFFF 188
            G  ++ D      G   + ++L S                   +  F+Q++FH  +   
Sbjct: 356 TGVSSFGDIGAMLYGPWMKYIILFSLVFAQLGFSSAYVVFTSKNLIAFIQNVFHYPDI-- 413

Query: 189 RRNVVITIVTLFISYPLSLQRNIAALSK----ASFLALXXXXXXXXXXXXQGPRVDMSLK 244
                + ++ L I  PLS  RN++ LS     A+FL +            +   VD+S K
Sbjct: 414 -PMAYMLLLQLIIFIPLSFVRNVSKLSLSSLLANFL-IICGLFIVVLYSAKHLIVDLSFK 471

Query: 245 GD----------KWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFA 292
            +          KW+L   F+ +AIF   GI +I            I         +KF 
Sbjct: 472 PEEGVIFLFNSKKWTL---FVGTAIFAYEGIGLI------------IPVQDSMAHPEKFP 516

Query: 293 RLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFP 352
            +       +    +L+G  GY  +    +  IL N PQ  L +N+ +  +   +L + P
Sbjct: 517 MVLGWVIITTTALFVLVGSLGYLAYGKYIQSVILLNLPQKSLSVNLIQFFYSMAILLSTP 576

Query: 353 LEIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLF---------------IITTVCVVSTM 397
           L++F    +I   ++ K  +   +   L +  L                ++ ++ V+  +
Sbjct: 577 LQLFPAIAIIENKIFPKFTKINVKPQGLPSYSLIPYSGRLNWKIKWTKNLVRSIIVIFII 636

Query: 398 SISLTTCNLGALF-ELIGATTASTMAYILPPYTNL--------VLSKEANTFRQKVPHYL 448
           +++    +   LF  +IG      + Y+ PP  +L        + +    T    +  Y 
Sbjct: 637 TLAYVGADDLDLFVSVIGCFACIPLVYMYPPLLHLRSCSKPQHIANPTYRTLFAVILDYF 696

Query: 449 CIFFG 453
            IFFG
Sbjct: 697 LIFFG 701

>KNAG0I01970 Chr9 complement(379931..382141) [2211 bp, 736 aa] {ON}
           Anc_2.177 YNL101W
          Length = 736

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 72/331 (21%), Positives = 130/331 (39%), Gaps = 59/331 (17%)

Query: 176 FLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLA---LXXXXXXXXXX 232
           F++++FH S+       +I +  L +  PLS  RNI+ LS  S +A   +          
Sbjct: 423 FVENVFHVSDINLP---MIMLFQLVVYVPLSFVRNISKLSLPSLVANFFIMAGLVIVLFF 479

Query: 233 XXQGPRVDMSLK----------GDKWSLTDIFISSAIF--RGIS-VISFALVCHHNTSFI 279
             +   +D  +K           ++WSL   FI +AIF   GI  +I       H   F 
Sbjct: 480 TAKQLFIDSGMKVAEGIIFGVNHERWSL---FIGTAIFAFEGIGLIIPVQDTMRHPEKFP 536

Query: 280 FFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIA 339
                   + K   LT    FIS+         GY  +    +  IL N PQ ++ + + 
Sbjct: 537 L-------VLKLVILTATCLFISVATI------GYLAYGSSVQTVILLNLPQGNVFVLLI 583

Query: 340 RLCFGFNMLTTFPLEIF-----VLRDVIAAF--LYGKKEEDET-------EAPPLSTRKL 385
           +L +   ++ + PL+++     +   V   F  +Y +  + +T        +  LS R  
Sbjct: 584 QLFYSMAIMLSTPLQLYPAIKIIENKVFPQFIKIYERDSQAQTTRVRYRPNSGKLSWRVK 643

Query: 386 FIITTV-CVVSTMSISLTTCN---LGALFELIGATTASTMAYILPPYTNLVLSKEANTFR 441
           ++   V   +  + +    C    L  +  +IG+     + Y++PP  +L      +T  
Sbjct: 644 WLKNLVRSAIVFLVVLFAYCGIDYLDKVVAVIGSLCCLPLVYVIPPMLHLKCCTRGSTKP 703

Query: 442 QKVPHYLCIF------FGFMVMIVSSTQTII 466
           Q     L  F      FG +  + +S Q+I+
Sbjct: 704 QGSMMLLATFDKLLIVFGTLATVYTSYQSIV 734

>TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.177
           YNL101W
          Length = 749

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 87/440 (19%), Positives = 168/440 (38%), Gaps = 57/440 (12%)

Query: 63  LLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCXXXXXXXXXXXXXXXVDWTLRLI 122
           +++    K+    AF+ +  S +G G++  P A                     W   ++
Sbjct: 331 MIQTAKGKTPTTKAFLLLLKSFIGTGILFLPNAFSKGGLLFSIGMLLFFGLYSYWCYFIL 390

Query: 123 VINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAXXXXXXXXXXXXDTIPHFLQSIFH 182
           + +  +    ++ D      GR  + ++L S  L                +  F+ ++F+
Sbjct: 391 IRSKQITKVSSFGDIGLILYGRWMKTIILCSLVLTQIGFSAAYVIFCAKNLRAFIINVFN 450

Query: 183 SSNFFFRRNV-VITIVTLFISYPLSLQRNIAALSKASFLA---LXXXXXXXXXXXXQGPR 238
             +F    N+  + I  L +  PLS  RN++ LS  S +A   +            +   
Sbjct: 451 FPDF----NISYLMIFQLIVFIPLSFVRNVSKLSLTSLMANFMIMGGLLIVLFFCIKHLF 506

Query: 239 VDMSLKG----------DKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNR 286
           +D+ +K           D WS   +FI +AIF   GI +I            I      +
Sbjct: 507 IDLQMKPEAGVIYGFNPDLWS---VFIGTAIFAFEGIGLI------------IPVQDSMK 551

Query: 287 SLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFN 346
             + F  +  +    + +  +L+G  GY  +    +  IL N  Q ++ +N+ +L +   
Sbjct: 552 HPEHFPFVLFLVILTATVLFILIGTIGYLAYGKYIETVILMNLSQSNVFVNLVQLFYSVA 611

Query: 347 MLTTFPLEIFVLRDVIAAFLYGK-KEEDETEAPPLST----------RK--LFIITTVCV 393
           +L + PL++F    +I   ++   +  D   +  LS           RK  L  I   CV
Sbjct: 612 ILLSTPLQLFPAIKIIENRMFTSFRSTDNGSSQFLSNSGKLNWRIKWRKNCLRSIIVSCV 671

Query: 394 VSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIF-- 451
           +  +   L   NL     LIG+     + Y+ PP  +L  S    + +Q   ++  IF  
Sbjct: 672 I--LIAYLGYNNLDKFVSLIGSFACIPLVYMYPPMLHLK-SYSIPSLKQHKFNFTVIFDF 728

Query: 452 ----FGFMVMIVSSTQTIIE 467
                G + M+ +S ++I++
Sbjct: 729 SLIVLGGISMLYTSYRSIMD 748

>Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ADL205C
          Length = 474

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 52/128 (40%), Gaps = 11/128 (8%)

Query: 264 SVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRDKTKG 323
           S+I  A     N   +   +K+ S     R+ + S  IS +  + +G  GY  F +    
Sbjct: 195 SIIILAYTGSMNMFSVINELKDNSTANAKRVVYYSVGISTLIFLSVGLGGYLTFGNNVLT 254

Query: 324 NILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLR----------DVIAAFLYGKKEED 373
           N++ N+ +  +   I     G  ++ +FPL     R          D+  A LY  + E 
Sbjct: 255 NVILNYDESAITTRIGTFSLGTMVILSFPLLFHPGRIAFNNMVHWLDITYA-LYIMRREQ 313

Query: 374 ETEAPPLS 381
           + E P L+
Sbjct: 314 KLEEPVLA 321

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/58 (20%), Positives = 34/58 (58%)

Query: 369 KKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILP 426
           ++ E ++ A PL   + +I+T + ++    ++L   +   +  L+G+T ++++++ LP
Sbjct: 364 EQMEHDSSAVPLDGSRFYIVTWILLLIMYVLALNVTSFALILALVGSTGSTSISFTLP 421

>TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON}
           Anc_2.177 YNL101W
          Length = 742

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 68/163 (41%), Gaps = 16/163 (9%)

Query: 307 MLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFL 366
           +L+G  GY  + +     IL N P D + +   +L +   ++ + PL+IF    +I  F+
Sbjct: 586 ILIGSMGYVTYGEDINTVILINLPNDKVTVQSIQLLYSIAIMLSIPLQIFPAIKIIENFI 645

Query: 367 --YGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCN------LGALFELIGATTA 418
             YG    D   +   +    ++    C+ S + + +   +      L     +IG+   
Sbjct: 646 INYGVSGGDYRRSGKYNVYYKWLKN--CLRSIIIVIIILISKEFINQLDKFVSIIGSVAC 703

Query: 419 STMAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSS 461
             + YI P   +L      N FR    +++ I  G  VM+ ++
Sbjct: 704 IPLVYIYPSLLHLRCG--GNKFR----NWVMILLGLAVMVFTT 740

>NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {ON}
           Anc_2.177
          Length = 710

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 51/249 (20%), Positives = 98/249 (39%), Gaps = 42/249 (16%)

Query: 243 LKGDKWSLTDIFISSAIF--RGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTF 300
           L  D+W++   FI +AIF   GI +I            I      ++ +KF  +      
Sbjct: 475 LNSDRWTM---FIGTAIFAFEGIGLI------------IPIQDSMKNPEKFPLVLGFVLI 519

Query: 301 ISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRD 360
            +    + +   GY  +   T+  IL N PQD + +   +L +   ++ + PL++F    
Sbjct: 520 AATFLFITIASIGYLSYGSSTEVVILLNLPQDSIFVISIQLFYSLAIMLSTPLQMFPAIK 579

Query: 361 VIAA---------FLYGKKEEDETEAPPLSTR--------KLFIITTVCVVSTMSISLTT 403
           +I           ++ G  +  + E    S +        K F+ + +     +      
Sbjct: 580 IIENKVFPRFTKIYVEGDGDRCDVEFRLNSGKANWKVKWLKNFVRSIIVSFVIIFAYYEV 639

Query: 404 CNLGALFELIGATTASTMAYILPPYTNLVLSK-------EANTFRQKVPHYLCIFFGFMV 456
            NL  +  LIG+     + YI PP  +L           + + ++  + H L + FG + 
Sbjct: 640 DNLDKVVSLIGSFACIPLVYIYPPLLHLRSRSRSQSPSGDPSKWKLVLDHILVV-FGGIS 698

Query: 457 MIVSSTQTI 465
           MI +S Q++
Sbjct: 699 MIYTSYQSM 707

>TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON}
           Anc_2.295 YIL088C
          Length = 497

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 49/108 (45%), Gaps = 13/108 (12%)

Query: 369 KKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPY 428
            +E    E P L   + + I+   ++S  SI+L   +   +  L+GAT ++++++ILP  
Sbjct: 389 SQESLRDECPAL---RFYTISAFLLISMFSIALNIKSFALVLSLVGATGSTSISFILPGL 445

Query: 429 TNLVLSKEANTFR--QKVPHYLC--------IFFGFMVMIVSSTQTII 466
              +L       R  Q     +C        + FG +VM +S   T++
Sbjct: 446 LGYILIGRDKISRCEQLSTSDICYKRLSLVLMVFGILVMFLSLYTTLV 493

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 8/91 (8%)

Query: 301 ISMIFCMLMGYSGYSVFRDKTKGNILNNFP-QDDLVINIARLCFGFNMLTTFPLEIFVLR 359
           IS I  +++   GY  F   T GNI+ N+   + L I + +L  G  ++ TFPL    LR
Sbjct: 236 ISTIIFLIISIFGYLTFGTLTLGNIMLNYNYSNSLYIILGKLALGIMVILTFPLLFHPLR 295

Query: 360 ----DVIAAFLY---GKKEEDETEAPPLSTR 383
               ++I   +    GKK        P+  R
Sbjct: 296 IACNNIIVWIILKYTGKKLHTTNVQTPIILR 326

>Ecym_1032 Chr1 (59499..61985) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii AFR722C
          Length = 828

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 38/81 (46%), Gaps = 16/81 (19%)

Query: 276 TSFIFFSIKNRSLQK----FARLTHISTFISMIFCMLMGYSGYSVFR---DKTK--GNIL 326
           T+  F+ IK+R L K       L H+    S+  C L    GY  FR   + TK   N++
Sbjct: 462 TNIDFYKIKDRVLNKEEYNATDLYHLRILNSLTACKLQYSIGYGAFRLQNETTKEFNNLI 521

Query: 327 NNFPQ----DDL---VINIAR 340
             FPQ    DD+   VIN+A 
Sbjct: 522 AKFPQANFGDDIKVSVINLAE 542

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.139    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,012,403
Number of extensions: 1402743
Number of successful extensions: 4334
Number of sequences better than 10.0: 107
Number of HSP's gapped: 4264
Number of HSP's successfully gapped: 144
Length of query: 479
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 366
Effective length of database: 40,524,141
Effective search space: 14831835606
Effective search space used: 14831835606
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)