Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C061901.82ON1879187986200.0
ZYRO0F16676g1.82ON1994182643320.0
Smik_14.661.82ON1952108325660.0
YNL271C (BNI1)1.82ON1953108625400.0
KAFR0D039501.82ON1957105624510.0
NCAS0A005901.82ON194686822930.0
Skud_14.691.82ON194684622500.0
Suva_14.711.82ON194884322450.0
CAGL0J08206g1.82ON189882821760.0
Kpol_2000.661.82ON193083021520.0
NDAI0F042201.82ON202287321410.0
KNAG0F004701.82ON202884320100.0
TBLA0A054401.82ON217087120150.0
SAKL0C02618g1.82ON1988113019210.0
TPHA0B044901.82ON194081719140.0
Kwal_33.133921.82ON196857816980.0
KLTH0F02376g1.82ON1976106716380.0
AFR669W1.82ON191856016310.0
Ecym_10861.82ON209161215770.0
KLLA0C02321g1.82ON184254515470.0
CAGL0H06765g5.717ON12944947353e-78
SAKL0E15224g5.717ON13354157363e-78
NCAS0G001205.717ON13144737301e-77
TDEL0F055605.717ON12924766962e-73
Kpol_416.105.717ON14914706992e-73
AFR301C5.717ON16554207002e-73
AGL364Cna 1ON12604156872e-72
Ecym_5679na 1ON13063706863e-72
KNAG0L022505.717ON13674926775e-71
NDAI0F001605.717ON13494646695e-70
Ecym_40045.717ON14544146705e-70
ZYRO0B16654g5.717ON14244206688e-70
Kwal_55.196205.717ON13894926652e-69
KLTH0E00704g5.717ON13894146598e-69
KLLA0F10912g5.717ON12834716533e-68
Smik_9.95.717ON13744826454e-67
YIL159W (BNR1)5.717ON13754816374e-66
Skud_9.85.717ON13744856232e-64
TPHA0E001205.717ON16424706252e-64
KAFR0D021205.717ON13244746123e-63
Suva_9.265.717ON13754245972e-61
TBLA0E018105.717ON14514775938e-61
YLR189C (ATG26)1.69ON1198110811.2
Skud_12.2541.69ON1203110811.5
SAKL0F06446g3.444ON945136811.5
KLLA0D06402g1.297ON63180801.8
CAGL0C05247g3.157ON35769755.6
SAKL0F13398g7.431ON36995746.3
Suva_10.2851.69ON1198110756.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C06190
         (1879 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...  3325   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...  1673   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...   993   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...   983   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....   948   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...   887   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...   871   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...   869   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...   842   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...   833   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}           829   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     778   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   780   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...   744   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   741   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...   658   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...   635   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...   632   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...   612   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   600   0.0  
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   287   3e-78
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   288   3e-78
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      285   1e-77
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   272   2e-73
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   273   2e-73
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   274   2e-73
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   269   2e-72
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   268   3e-72
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   265   5e-71
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     262   5e-70
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   262   5e-70
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   261   8e-70
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   260   2e-69
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   258   8e-69
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   256   3e-68
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   253   4e-67
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   249   4e-66
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   244   2e-64
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   245   2e-64
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   240   3e-63
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   234   2e-61
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   233   8e-61
YLR189C Chr12 complement(530797..534393) [3597 bp, 1198 aa] {ON}...    36   1.2  
Skud_12.254 Chr12 complement(477413..481024) [3612 bp, 1203 aa] ...    36   1.5  
SAKL0F06446g Chr6 (498840..501677) [2838 bp, 945 aa] {ON} simila...    36   1.5  
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    35   1.8  
CAGL0C05247g Chr3 (501476..502549) [1074 bp, 357 aa] {ON} highly...    33   5.6  
SAKL0F13398g Chr6 complement(1060920..1062029) [1110 bp, 369 aa]...    33   6.3  
Suva_10.285 Chr10 complement(503424..507020) [3597 bp, 1198 aa] ...    33   6.6  

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score = 3325 bits (8620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1657/1879 (88%), Positives = 1657/1879 (88%)

Query: 1    MLKGSHSKGSQGNGSDSRDSNTGSGLLSNLKRFAXXXXXXXXXXRIETSDIXXXXXXXXX 60
            MLKGSHSKGSQGNGSDSRDSNTGSGLLSNLKRFA          RIETSDI         
Sbjct: 1    MLKGSHSKGSQGNGSDSRDSNTGSGLLSNLKRFAGSSGSQSGSQRIETSDISSPRKVSVP 60

Query: 61   XXXXNANDLRPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQXXXXXXXXXXXXX 120
                NANDLRPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQ             
Sbjct: 61   SRVSNANDLRPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQSSTKYTYSRRSSS 120

Query: 121  HLSTPGVNSTLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIKLDMPSSHEVENLFED 180
            HLSTPGVNSTLTREPTNQ                AIFMTPDGKIKLDMPSSHEVENLFED
Sbjct: 121  HLSTPGVNSTLTREPTNQSLSSSSVLSQDSFSNLAIFMTPDGKIKLDMPSSHEVENLFED 180

Query: 181  MMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAKGVPAAHAAIXXXXXX 240
            MMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAKGVPAAHAAI      
Sbjct: 181  MMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAKGVPAAHAAISSSNSD 240

Query: 241  XXXXXXXXXXXXXXMTYESIQQAIKFNKTXXXXXXXXXXXXXXXLQQLSDKNSSTSTLTT 300
                          MTYESIQQAIKFNKT               LQQLSDKNSSTSTLTT
Sbjct: 241  SLPSSLKVSSPRSSMTYESIQQAIKFNKTNNGSSSGPASNNKSKLQQLSDKNSSTSTLTT 300

Query: 301  EKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIY 360
            EKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIY
Sbjct: 301  EKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIY 360

Query: 361  KTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRLATRKM 420
            KTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRLATRKM
Sbjct: 361  KTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRLATRKM 420

Query: 421  ATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQFKIVQ 480
            ATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQFKIVQ
Sbjct: 421  ATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQFKIVQ 480

Query: 481  SWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRI 540
            SWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRI
Sbjct: 481  SWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRI 540

Query: 541  LLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSA 600
            LLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSA
Sbjct: 541  LLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSA 600

Query: 601  SLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSVS 660
            SLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSVS
Sbjct: 601  SLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSVS 660

Query: 661  AVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGL 720
            AVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGL
Sbjct: 661  AVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGL 720

Query: 721  VGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXXXXXXXMLTILNSRPEG 780
            VGQLEKEVQQRDDILEKNQRVTLQLQD                      MLTILNSRPEG
Sbjct: 721  VGQLEKEVQQRDDILEKNQRVTLQLQDELEELKKKHLLEKHEHEVELRKMLTILNSRPEG 780

Query: 781  DLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKRFGITVQPNKRLKML 840
            DLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKRFGITVQPNKRLKML
Sbjct: 781  DLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKRFGITVQPNKRLKML 840

Query: 841  RLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKENELRAKELKANKLSELRK 900
            RLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKENELRAKELKANKLSELRK
Sbjct: 841  RLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKENELRAKELKANKLSELRK 900

Query: 901  ALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGIDLSTHFPIQDEP 960
            ALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGIDLSTHFPIQDEP
Sbjct: 901  ALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGIDLSTHFPIQDEP 960

Query: 961  QESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMKSELKNDKALRRHESPSKQDTD 1020
            QESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMKSELKNDKALRRHESPSKQDTD
Sbjct: 961  QESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMKSELKNDKALRRHESPSKQDTD 1020

Query: 1021 DDEIQDTGSMVNEDXXXXXXXXXXXXXXQKYGTGKNATNMLTNDILNSSERKGHSRQSFM 1080
            DDEIQDTGSMVNED              QKYGTGKNATNMLTNDILNSSERKGHSRQSFM
Sbjct: 1021 DDEIQDTGSMVNEDLQSSGTSSFLESLSQKYGTGKNATNMLTNDILNSSERKGHSRQSFM 1080

Query: 1081 ERMKKPSGVPAYLEELPLKVPKAPPLGVAETEDSSDNIAEDVEKESAEHDEQEENSGKPD 1140
            ERMKKPSGVPAYLEELPLKVPKAPPLGVAETEDSSDNIAEDVEKESAEHDEQEENSGKPD
Sbjct: 1081 ERMKKPSGVPAYLEELPLKVPKAPPLGVAETEDSSDNIAEDVEKESAEHDEQEENSGKPD 1140

Query: 1141 VASQKVPQESGKAGTXXXXXXXXXDMLKKGPETSTAXXXXXXXXXXXMFAQARNSGXXXX 1200
            VASQKVPQESGKAGT         DMLKKGPETSTA           MFAQARNSG    
Sbjct: 1141 VASQKVPQESGKAGTPHPVPPPMPDMLKKGPETSTAPPPPPPPPPPPMFAQARNSGPIPP 1200

Query: 1201 XXXXXXXSLTPSTSEAAKLSXXXXXXXLLGQKMAYRTAVXXXXXXXXXXXXXXXXRARKK 1260
                   SLTPSTSEAAKLS       LLGQKMAYRTAV                RARKK
Sbjct: 1201 PPPPPPPSLTPSTSEAAKLSPPPPPPPLLGQKMAYRTAVPSPLLPQSPSLFSSYPRARKK 1260

Query: 1261 LKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKREDLDK 1320
            LKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKREDLDK
Sbjct: 1261 LKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKREDLDK 1320

Query: 1321 ITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIEVSTNL 1380
            ITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIEVSTNL
Sbjct: 1321 ITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIEVSTNL 1380

Query: 1381 ARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRALRVITS 1440
            ARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRALRVITS
Sbjct: 1381 ARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRALRVITS 1440

Query: 1441 YEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLSTLQRL 1500
            YEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLSTLQRL
Sbjct: 1441 YEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLSTLQRL 1500

Query: 1501 TFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEFSQSIT 1560
            TFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEFSQSIT
Sbjct: 1501 TFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEFSQSIT 1560

Query: 1561 NVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESLMQRYG 1620
            NVERSIDIGNLNDSSKFH              EASKRVELLDEEVKLSIMEFESLMQRYG
Sbjct: 1561 NVERSIDIGNLNDSSKFHPLDKVLVKVLPVLPEASKRVELLDEEVKLSIMEFESLMQRYG 1620

Query: 1621 EDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXXXXXXX 1680
            ED                 INEYKRAQAQNLKAEEEERLYQTHKKMV             
Sbjct: 1621 EDSADKFAKNSFFKKFADFINEYKRAQAQNLKAEEEERLYQTHKKMVEEQQKRAEEKERS 1680

Query: 1681 XNATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLNDSEAVSDVL 1740
             NATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLNDSEAVSDVL
Sbjct: 1681 ENATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLNDSEAVSDVL 1740

Query: 1741 DSIQQEDDSMIYSPEKQEGITNPTGDSSQSPSKGAANNQQDEEEITDRAKALLMGLRGGE 1800
            DSIQQEDDSMIYSPEKQEGITNPTGDSSQSPSKGAANNQQDEEEITDRAKALLMGLRGGE
Sbjct: 1741 DSIQQEDDSMIYSPEKQEGITNPTGDSSQSPSKGAANNQQDEEEITDRAKALLMGLRGGE 1800

Query: 1801 SPSKRNNVLNGHKEKLRARRRKTNTDMSPEGSFLFNEEVRGTISSADTDYSNEQQSNSEA 1860
            SPSKRNNVLNGHKEKLRARRRKTNTDMSPEGSFLFNEEVRGTISSADTDYSNEQQSNSEA
Sbjct: 1801 SPSKRNNVLNGHKEKLRARRRKTNTDMSPEGSFLFNEEVRGTISSADTDYSNEQQSNSEA 1860

Query: 1861 NTLTKSIRSTLTEENDDPE 1879
            NTLTKSIRSTLTEENDDPE
Sbjct: 1861 NTLTKSIRSTLTEENDDPE 1879

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score = 1673 bits (4332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 935/1826 (51%), Positives = 1180/1826 (64%), Gaps = 91/1826 (4%)

Query: 45   RIETSDIXXXXXXXXXXXXXNANDLRPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSP 104
            RIET DI             NANDLRPLN     +  +       + S  S  +   R+ 
Sbjct: 55   RIETGDISSPKKVSVPSRVTNANDLRPLNHHYNHHHNHHHSRTPSQQSTGSKYTYPKRTS 114

Query: 105  SVQXXXXXXXXXXXXXHLSTPGVNSTLTREPTNQXXXXXXXXXXXXXXXXAI-----FMT 159
            S                +  P     L+R+ TN                 ++     FM 
Sbjct: 115  SSITGGNPSLPSSSATPIPAPVTPGQLSRQQTNHSHANSQSSAASVLSQGSLTNLGRFMR 174

Query: 160  PDGKIKLDMPSS-HEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQND 218
            PDGK++LDMP   HEVE+LFED+MYKRNI+Q L P+KQ+EL +YD+DKKWLIV+QDL +D
Sbjct: 175  PDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDIDKKWLIVRQDLSSD 234

Query: 219  FKKLLAKGVPAAHAAIXXXXXXXXXXXXXXXXXXXXMTYESIQQAIKFNKTXXXXXXXXX 278
             KK++AK   +A  A                         S   +I+  KT         
Sbjct: 235  LKKMMAKSSSSATQASANTTDLSLTNTISSHDY-------SDATSIRHMKTNASSKSLNS 287

Query: 279  XXXXXXLQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDW 338
                  L   ++ NSS +T+ TEKINRPP +YVK+IIAD LT +E+NDLWVTLRTEQLDW
Sbjct: 288  N-----LYSNANANSSNTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDW 342

Query: 339  VDGFLEHQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSR 398
            VD FLEHQGHIAMANVL  S+YKT  E  L+   LE+E ++F+CFRVL +L QGLYE ++
Sbjct: 343  VDAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTK 402

Query: 399  HNIMAETVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLH 458
            H IMAETVA  LFS+RL TRKMATEIFVCMLEKKNK RF+ +L ALDKKF IGENLHM+ 
Sbjct: 403  HAIMAETVAYALFSIRLPTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQ 462

Query: 459  YMKNSPQHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEY 518
            ++KNSPQ F H  RDSQFKIVQ+WL  +E +L+GRGKMGSLVGASE+ +A+GGEN+ILEY
Sbjct: 463  FVKNSPQQFIHLKRDSQFKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEY 522

Query: 519  SQWTMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKL 578
            SQWTMVFINH C GTDV+NQR+LLRTRLENAG LRIMN+FKLLDYDK+   +E YEN KL
Sbjct: 523  SQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKL 582

Query: 579  DDLNSVLETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQ 638
            DD+N++LE+    + ++M D   +L+ ++DYCKGTE+EK   SL+KHLFLS+S++ +D  
Sbjct: 583  DDINNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRG 642

Query: 639  DPTKLSKQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKK 698
            DP+KL+KQL+LMDSLV NVSVSAVDE SS+N+AIQRLYD+MQTDEVARRAILESR LTK+
Sbjct: 643  DPSKLAKQLKLMDSLVANVSVSAVDEESSVNVAIQRLYDAMQTDEVARRAILESRQLTKE 702

Query: 699  LEEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXX 758
            LEE QAERDFL QKL+ TG+G+VG+LE+E++QRDDIL KNQRV   LQ            
Sbjct: 703  LEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVNRHLQAELEELKKKHLL 762

Query: 759  XXXXXXXXXXXMLTILNSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKK 818
                       MLTILN+RP+ +   K +  +K+  G LDPD++++IQ+ALQDGL +T+K
Sbjct: 763  EKHEHEVELRKMLTILNARPDDENLAKSTKVTKSVNG-LDPDRQTSIQKALQDGLQRTRK 821

Query: 819  DLSVDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNY 878
            DLSVDSKRFGITVQPNKRL+MLR++ME IEQEARELEMTNFA+H +  L+ PV   +   
Sbjct: 822  DLSVDSKRFGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGTGTK-- 879

Query: 879  VRKENELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLND 938
                     K+    KLSELRK L+DIQKE+N V+KFNVEERV ELF QK+L AL RL +
Sbjct: 880  ---------KKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQKRLKALKRLKE 930

Query: 939  LENMYKEYGIDLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKEL--I 996
            LE  YK +GID + +  ++ +  +   ++   +G    D +  Q K+DE+DRI+ EL  +
Sbjct: 931  LETTYKGFGIDFNANALLESKGGDIHWNDDEIDGQ---DLQGAQEKMDEMDRIANELTAM 987

Query: 997  EMKSELKNDKALRRHESPSKQDTDDDEIQ-------DTGSMVNEDXXXXXXXXXXXXXXQ 1049
            +MK E++N +   +H   S  ++  ++         DT S  ++               Q
Sbjct: 988  KMKVEIQNQQ---QHTDSSSTESSSEDDDGATGSRTDTASEFSQKSFGSGAGSFLEALSQ 1044

Query: 1050 KYGTGKNATNMLTNDILNSSERK-GHSRQSFMERMKKPSGVPAYLEELPLKVPKAPPLGV 1108
            KYG G+N T  ++N      +RK  + R SF  RMKK +  P Y +EL  KV KAP L  
Sbjct: 1045 KYGAGQNTT--ISNSPFPGVDRKSSNHRTSFANRMKKSNATP-YFDELTRKVAKAPSLND 1101

Query: 1109 AETEDSSDNIAEDVEKESAEHDEQEEN---------SGKPDVASQKVPQESGKAGTXXXX 1159
              +  S++   +D    ++    Q  N         +  P+      P            
Sbjct: 1102 PSSPGSNEPGDDDTLPATSPTVPQSINDTVSKDKNSTSSPEAPPTLDPGSVHSDERAPPP 1161

Query: 1160 XXXXXDML--KKGPETSTA---XXXXXXXXXXXMFAQARNSGXXXXXXXXXXXSLTPSTS 1214
                  ML  +K P+  T               +F QA   G           +L  S S
Sbjct: 1162 PPPLPSMLFGEKAPQHGTGAPAPPPPPPPPPLPIFNQASVKGSTAIPPPPLPPALGGSNS 1221

Query: 1215 EAAKLSXXXXXXXLLGQKMAYRTAVXXXXXXXXXXXXXXXXRARKKLKQLHWEKLDATDN 1274
                           GQK  YR+ +                  +K LKQLHWEKLDAT++
Sbjct: 1222 PTPS-PTPPPPPLFAGQKKMYRSDMSNYLEETPTFRDNYPQPHKK-LKQLHWEKLDATED 1279

Query: 1275 SIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKREDLDKITFLSRDVSQQFGI 1334
            SIWSSG AEKFAGDLYEKGVL  LEKAFAAREIK+LATKK+EDL KITFLS D SQQFGI
Sbjct: 1280 SIWSSGVAEKFAGDLYEKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGI 1339

Query: 1335 NLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGV 1394
            NLHMYS +SV +LV KILKC+RDFM TPSV+EFLSK EI EVS NLARN+SPYSTDWDG+
Sbjct: 1340 NLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGI 1399

Query: 1395 SKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRALRVITSYEREYSELVTKLRK 1454
              +EDAK PEKDP +LQRADQ+YLQLI+NLQ YWGSRMRA++VITSY++EY ELVTKLRK
Sbjct: 1400 KSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRK 1459

Query: 1455 VDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLSTLQRLTFIKDANNSMTFLN 1514
            VDKAV  I KS NL N+FNVILAVGN+MND+AK+AQGFKLSTLQRLTFIKD NNSMTFLN
Sbjct: 1460 VDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLN 1519

Query: 1515 YVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEFSQSITNVERSIDIGNLNDS 1574
            YVEKI+R NYPSFNDFL++L+PVL+V KISI+QL++DC E+ Q++TNVERSI+IGNL+DS
Sbjct: 1520 YVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDS 1579

Query: 1575 SKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESLMQRYGEDXXXXXXXXXXXX 1634
            SKFH              EA K+ +LLD+EV+LSIMEFE+LMQ+YGED            
Sbjct: 1580 SKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGDKFAKNSFFK 1639

Query: 1635 XXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXXXXXX----XXNATEEDASE 1690
                 + EYK+AQ QNLK EEEER+Y+ HKKMV                  N  E+ A +
Sbjct: 1640 KFADFVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQRREQTPSKNRDYVVNEDEDIADD 1699

Query: 1691 ENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLNDSEAVSDVLDSIQQEDDSM 1750
            +++DRRAMMDKLL+QLKNAGP  +DP SARKRA++R+K+  D +A + ++  +   +DS+
Sbjct: 1700 DDQDRRAMMDKLLDQLKNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSI 1759

Query: 1751 IYSPEKQEGITNPTGDSSQSPSKGAANNQQ----------------------DEEEITDR 1788
            +YSP   +  +    ++S +  KG+  N +                      +EEEI+D+
Sbjct: 1760 VYSPNASQDQSANAEEASPTVHKGSNKNNKPVLSDLESPIKASRNADRNNENEEEEISDK 1819

Query: 1789 AKALLMGLRGGESPSKRNNVLNGHKE 1814
            AK LLM L G  +P++R  +LNGHKE
Sbjct: 1820 AKNLLMELSGNGAPTRREELLNGHKE 1845

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/1083 (51%), Positives = 713/1083 (65%), Gaps = 55/1083 (5%)

Query: 66   ANDLRPLNKKSTMNTQNLSHYMNGKSSAE-SLSSNHSRSPSVQXXXXXXXXXXXXXHLST 124
            + + RPLNKKST+NTQNLS YMNGK SA+  +SS H+RS S+Q               ++
Sbjct: 80   STEARPLNKKSTLNTQNLSQYMNGKISADVPVSSQHARSHSMQSKYSYSKR-------NS 132

Query: 125  PGVNSTLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIKLDMPS-SHEVENLFEDMMY 183
               ++ LTR+ T Q                + F TPDGKI L+MPS  +EVE LFED+MY
Sbjct: 133  SQASNKLTRQHTGQSHSVSSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMY 192

Query: 184  KRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKK---------------------- 221
            KRNI Q+LS DKQ+ LM Y  +KKWLIVKQDLQN+ KK                      
Sbjct: 193  KRNIFQSLSGDKQEALMSYSTEKKWLIVKQDLQNELKKLRANTTSSSTASRTSIASDHHP 252

Query: 222  -LLAKGVPAAHAAIXXXXXXXXXXXXXXXXXXXXMTYESIQQAIKFNKTXXXXXXXXXXX 280
             L A    ++  ++                     T  S+  +   +K            
Sbjct: 253  ILTANSSLSSPKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKSKKLMGGSLKKQPS 312

Query: 281  XXXXLQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVD 340
                 +  S+ N+S STL  ++ NRPPIHYV+RI+ADKLT +EM DLWVTLRTEQLDWVD
Sbjct: 313  LNNIYRGGSENNTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVD 372

Query: 341  GFLEHQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHN 400
             F++HQGHIAMANVL  SIYKT P   L+ +LLEKE++FF+CFRVLS+L+QGLYE S H 
Sbjct: 373  AFIDHQGHIAMANVLMNSIYKTAPRDSLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHR 432

Query: 401  IMAETVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYM 460
            +M +TVA GLFS RLATRKMATEIFVCMLEKKNK RFEAVL ALDKKF+IG+NLHM+   
Sbjct: 433  LMTDTVAEGLFSTRLATRKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNF 492

Query: 461  KNSPQHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQ 520
            K  PQ+FSH T +S  KI+Q+WLFAVEQ+L+GRGKMGSLVGAS++FK  GGENAILEY Q
Sbjct: 493  KKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQ 552

Query: 521  WTMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDD 580
            WTMVFINH C+ +D INQR+LLRT+LEN G LRIMN+ KLLDYDKVM+ +E Y+N KLDD
Sbjct: 553  WTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVMDQIELYDNNKLDD 612

Query: 581  LNSVLETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDP 640
             N  LE    A ++D+ D  SLLK L+D CKGTE+EKLL SLV+HLFLS+S+L+E+NQ+P
Sbjct: 613  FNVRLEANNKAFNVDLQDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNP 672

Query: 641  TKLSKQLRLMDSLVTNVSVSAV-DESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKL 699
            +KL+KQL++MDSLVT+VS+++  DE S++NMAIQRLYD+MQTDEVARRAILESR LTKKL
Sbjct: 673  SKLTKQLKVMDSLVTSVSIASTSDEESNMNMAIQRLYDAMQTDEVARRAILESRALTKKL 732

Query: 700  EEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXX 759
            EE QAERD LS+KLSK  +GLVGQLE E+  RD IL KNQRV  QL+             
Sbjct: 733  EEIQAERDSLSEKLSKAEHGLVGQLEDELHGRDRILAKNQRVMQQLEAELEELKKKHLLE 792

Query: 760  XXXXXXXXXXMLTILNSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKD 819
                      MLTILNSRPE + S    +  K     L+  +K+ IQ+ LQDGL + KKD
Sbjct: 793  KHQQEVELRKMLTILNSRPEENSSINEGIRGKNSS--LNSSEKANIQKVLQDGLSRAKKD 850

Query: 820  LSVDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYV 879
               DSK+FG+T+QPNKRLKMLR+QME+IE EAR+LEMTNFA+  K  L+ P++++     
Sbjct: 851  YKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDHLEPPIQIKKPKLK 910

Query: 880  RKENEL-----RAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALD 934
            + +++      R +E+  NKL++LR+ALA+IQ ESN +SKFNVEERVNELF +KK  AL 
Sbjct: 911  KIKHKDKKLISRPQEVDMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALK 970

Query: 935  RLNDLENMYKEYGIDLSTHFPIQDEPQESAESEKNAEGP--STLDPRAYQAKLDEIDRIS 992
            RL +LE  YK +GID +    I + P++++ +E+  +G   S+LDPR YQ KLDEI+RI+
Sbjct: 971  RLKELETKYKGFGIDFNVE-EIMESPKKNSANERKEDGANYSSLDPRTYQNKLDEINRIT 1029

Query: 993  KELIEMKSELKNDKALRRHESPSKQDTDDDEI-------QDTGSMVNEDXXXXXXXXXXX 1045
             +L++++++ K D       S S    + +++       Q+  S  +E            
Sbjct: 1030 DQLLDLQAQTKQDDGGVSSLSSSSSSAEGEDVYQDAFPAQEVRSENSELSVESGSGSFLD 1089

Query: 1046 XXXQKYGTGKNATNMLTNDILNSSERKGH----SRQSFMERMKKPSGVPA-YLEELPLKV 1100
               QKYGTG+N T  +     +     GH      ++FM +++K +   A YLEEL  KV
Sbjct: 1090 ALSQKYGTGQNNTVSVGLRDSDYVSVIGHMPSKVEKTFMNKLRKSTASSAPYLEELTQKV 1149

Query: 1101 PKA 1103
             K 
Sbjct: 1150 NKV 1152

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/588 (63%), Positives = 453/588 (77%), Gaps = 20/588 (3%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R  KKLKQLHWEKLD+TDNSIW +GKAEKFA DLYEKGVL DLEKAFAAREIKSLATK++
Sbjct: 1352 RPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRK 1411

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            EDL KITFLSRD+SQQFGINLHMYS LSV +LV KIL C+RDF+ TPSV+EFLSKPEIIE
Sbjct: 1412 EDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCDRDFLQTPSVVEFLSKPEIIE 1471

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS NLARNY+PYSTDW+GV  ++DAK PEKDP +LQRADQ+YLQL+ NL+ YWGSRMRAL
Sbjct: 1472 VSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQIYLQLMVNLESYWGSRMRAL 1531

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
             V+TSYE+EY+EL+TKLRKVDKAV  +Q+S NLRNVFNVILAVGN+MND++KQAQGFKLS
Sbjct: 1532 IVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKLS 1591

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD NNSMTFLNYVEKI+R NYPSFNDFL++L+PVLDVVK+SIEQL++DC++F
Sbjct: 1592 TLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDCRDF 1651

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
            SQSI NVERS++IGNL+DSSKFH              EA K+ +LL++EVKL+IMEFESL
Sbjct: 1652 SQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEARKKGDLLEDEVKLTIMEFESL 1711

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            M  YGED                 INEYK+AQ+QNL AEEEER+Y+ HKK+V        
Sbjct: 1712 MHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEEEERIYEKHKKIVEEQQKRAQ 1771

Query: 1676 XXXXXXNATEEDASEEN-----EDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKML 1730
                    +   +SE N     EDRRA+MDKLLEQLKNAGP K+DP SARKRA++RK+ L
Sbjct: 1772 EREKQKENSNSSSSEGNEEDEAEDRRAVMDKLLEQLKNAGPGKSDPSSARKRALVRKRYL 1831

Query: 1731 NDSEAVSDVLDSIQQEDDSMIYSPEKQE-------GITNPTGDSSQS--------PSKGA 1775
            +D +    +L+ +  E+ S++YSPE  +          +PT  +++         PS   
Sbjct: 1832 SDKDNSQQLLNDLDNEEGSILYSPEALDPDADAVIHAESPTPLTTRGTLNIPEDLPSPSK 1891

Query: 1776 ANNQQDEEEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLRARRRKT 1823
            A+  +D+EEI+DRAK LL  LRG ++P K+N++L+ H EKLRAR+ +T
Sbjct: 1892 ASTLEDQEEISDRAKMLLKELRGSDTPVKQNSILDEHLEKLRARKERT 1939

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score =  983 bits (2540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1086 (50%), Positives = 710/1086 (65%), Gaps = 61/1086 (5%)

Query: 70   RPLNKKSTMNTQNLSHYMNGKSSAE-SLSSNHSRSPSVQXXXXXXXXXXXXXHLSTPGVN 128
            RPLNKKST+NTQNLS YMNGK S +  +SS H+RS S+Q               ++   +
Sbjct: 83   RPLNKKSTLNTQNLSQYMNGKLSGDVPVSSQHARSHSMQSKYSYSKR-------NSSQAS 135

Query: 129  STLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIKLDMPS-SHEVENLFEDMMYKRNI 187
            + LTR+ T Q                + F TPDGKI L+MPS  +EVE LFED+MYKRNI
Sbjct: 136  NKLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIYLEMPSDPYEVEVLFEDIMYKRNI 195

Query: 188  LQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKK-----------------------LLA 224
             Q+LS DKQ+ LM Y ++KKWLIVKQDLQN+ KK                       L A
Sbjct: 196  FQSLSEDKQEALMGYSIEKKWLIVKQDLQNELKKMRANTTSSSTASRTSMASDHHPILTA 255

Query: 225  KGVPAAHAAIXXXXXXXXXXXXXXXXXXXXMTYESIQQAIKFNKTXXXXXXXXXXXXXXX 284
                ++  ++                     T  S+  +    K                
Sbjct: 256  NSSLSSPKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKGKKLVSGSLKKQPSLNNI 315

Query: 285  LQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLE 344
             +  ++ N+S STL  ++ NRPPIHYV+RI+ADKLT +EM DLWVTLRTEQLDWVD F++
Sbjct: 316  YRGGAENNTSASTLPGDRTNRPPIHYVQRILADKLTSDEMKDLWVTLRTEQLDWVDAFID 375

Query: 345  HQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAE 404
            HQGHIAMANVL  SIYKT P   L+ +LLEKE++FF+CFRVLS+L+QGLYE S H +M +
Sbjct: 376  HQGHIAMANVLMNSIYKTAPRENLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTD 435

Query: 405  TVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSP 464
            TVA GLFS +LATRKMATEIFVCMLEKKNK RFEAVL +LDKKF+IG+NLHM+   K  P
Sbjct: 436  TVAEGLFSTKLATRKMATEIFVCMLEKKNKSRFEAVLTSLDKKFRIGQNLHMIQNFKKMP 495

Query: 465  QHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMV 524
            Q+FSH T +S  KI+Q+WLFAVEQ+L+GRGKMGSLVGAS++FK  GGENAILEY QWTMV
Sbjct: 496  QYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMV 555

Query: 525  FINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSV 584
            FINH C+ +D INQR+LLRT+LEN G LRIMN+ KLLDYDKV++ +E Y+N KLDD N  
Sbjct: 556  FINHLCSCSDNINQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVK 615

Query: 585  LETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLS 644
            LE    A ++D++D  SLLK L+D CKGTE+EKLL SLV+HLFLS+S+L+E+NQ+ +KL+
Sbjct: 616  LEANNKAFNVDLHDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLT 675

Query: 645  KQLRLMDSLVTNVSVSAV-DESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQ 703
            KQL+LMDSLVTNVSV++  DE +++NMAIQRLYD+MQTDEVARRAILESR LTKKLEE Q
Sbjct: 676  KQLKLMDSLVTNVSVASTSDEETNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQ 735

Query: 704  AERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXX 763
            AERD LS+KLSK  +GLVGQLE E+ +RD IL KNQRV  QL+                 
Sbjct: 736  AERDSLSEKLSKAEHGLVGQLEDELHERDRILAKNQRVMQQLEAELEELKKKHLLEKHQQ 795

Query: 764  XXXXXXMLTILNSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVD 823
                  MLTILNSRPE   ++     ++     L+  +K+ IQ+ LQDGL + KKD   D
Sbjct: 796  EVELRKMLTILNSRPEESFNKNEG--TRGMNSSLNSSEKANIQKVLQDGLSRAKKDYKDD 853

Query: 824  SKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKEN 883
            SK+FG+T+QPNKRLKMLR+QME+IE EAR+LEMTNFA+  K  L+ P+ ++     + +N
Sbjct: 854  SKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDRLEPPIHIKKPKVKKMKN 913

Query: 884  E-----LRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLND 938
            +     ++ +E   NKL++LR+ALA+IQ ESN +SKFNVEERVNELF +KK  AL RL +
Sbjct: 914  KDRKPLVKPQEADVNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKE 973

Query: 939  LENMYKEYGIDLSTHFPIQDEPQES---AESEKNAEGPSTLDPRAYQAKLDEIDRISKEL 995
            LE  YK +GID +    I D P+++    E+E++A   S LDP+ YQ KLDEI+RI+ +L
Sbjct: 974  LETKYKGFGIDFNVD-EIMDSPKKNTGDVETEEDANYAS-LDPKTYQKKLDEINRITDQL 1031

Query: 996  IEMKSELKNDKALRRHESPSKQDT-----------DDDEIQDTGSMVNEDXXXXXXXXXX 1044
            ++++++ +++  +          +           D    Q+  S  +E           
Sbjct: 1032 LDIQTQTEHEIQVEEDGESDLSSSSSDDESEEIYQDASPTQELRSEHSELSSGSGPGSFL 1091

Query: 1045 XXXXQKYGTGKNATNMLTNDILNSSERKG--HSR--QSFMERMKKPSGVPA-YLEELPLK 1099
                QKYGTG+N T        N+    G  HS+  ++FM R++K +   A YLEEL  K
Sbjct: 1092 DALSQKYGTGQNVTASAAFGENNNGSGIGPLHSKVEKTFMNRLRKSTVSSAPYLEELTQK 1151

Query: 1100 VPKAPP 1105
            V K  P
Sbjct: 1152 VNKVEP 1157

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/591 (63%), Positives = 449/591 (75%), Gaps = 26/591 (4%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R  KKLKQLHWEKLD TDNSIW +GKAEKFA DLYEKGVL DLEKAFAAREIKSLA+K++
Sbjct: 1353 RPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSLASKRK 1412

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            EDL KITFLSRD+SQQFGINLHMYS LSV +LV KIL C+RDF+ TPSV+EFLSK EIIE
Sbjct: 1413 EDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCDRDFLQTPSVVEFLSKSEIIE 1472

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS NLARNY+PYSTDW+GV  +EDAK PEKDP +LQRADQ+YLQL+ NL+ YWGSRMRAL
Sbjct: 1473 VSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQIYLQLMVNLESYWGSRMRAL 1532

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
             V+TSYEREY+EL+ KLRKVDKAV+ +Q+S NLRNVFNVILAVGN+MND++KQAQGFKLS
Sbjct: 1533 TVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKLS 1592

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD  NSMTFLNYVEKIVR NYPSFNDFL +L+PVLDVVK+SIEQL++DCK+F
Sbjct: 1593 TLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEPVLDVVKVSIEQLVNDCKDF 1652

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
            SQSI NVERS++IGNL+DSSKFH              EA K+ +LL++EVKL+IMEFESL
Sbjct: 1653 SQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDLLEDEVKLTIMEFESL 1712

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            M  YGED                 INEYK+AQAQNL AEEEERLY  HKK+V        
Sbjct: 1713 MHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEEERLYIKHKKIVEEQQKRAQ 1772

Query: 1676 XXXXXXNATEEDASEEN-----EDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKML 1730
                    +   +SE N     EDRRA+MDKLLEQLKNAGP K+DP SARKRA++RKK L
Sbjct: 1773 EKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLKNAGPAKSDPSSARKRALVRKKYL 1832

Query: 1731 NDSEAVSDVLDSIQQEDDSMIYSPEKQE------------------GITNPTGDSSQSPS 1772
            ++ +    +L+ +  E+ S++YSPE  +                  G+ N T +   SPS
Sbjct: 1833 SEKDNAPQLLNDLDTEEGSILYSPEAMDPTADTVIHAESPTPLATRGVMN-TSEDLPSPS 1891

Query: 1773 KGAANNQQDEEEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLRARRRKT 1823
            K +A   +D+EEI+DRA+ LL  LRG ++P K+N++L+ H EKLRAR+ ++
Sbjct: 1892 KTSA--LEDQEEISDRARMLLKELRGSDTPVKQNSILDEHLEKLRARKERS 1940

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1056 (49%), Positives = 692/1056 (65%), Gaps = 33/1056 (3%)

Query: 70   RPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQXXXXXXXXXXXXXHLSTPGVNS 129
            +PLNKKST+NTQNLS YM+   S+ + S++ S+  S +              +ST     
Sbjct: 83   KPLNKKSTLNTQNLSQYMDHARSSSTNSASASKYSSSRRSST---------QVSTSESLR 133

Query: 130  TLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIKLDMP-SSHEVENLFEDMMYKRNIL 188
             L+R+ T Q                + F+TPDGK  L+MP    E+ENLFE++MYKRNIL
Sbjct: 134  RLSRQHTGQSSSASIHSQNSSYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNIL 193

Query: 189  QNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLA-KGVPAAHAAIXXXXXXXXXXXXX 247
            QNLS +KQ+ELM+YDV KKWLIVKQD+QN+FK++ A K  P   + +             
Sbjct: 194  QNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYSPTTTT 253

Query: 248  XXXXXXXMTYESIQQ----AIKFNKTXXXXXXXXXXXXXXXLQQLSDKNSSTSTLTTEKI 303
                               ++  N+                L QL++ N+STSTL+++K 
Sbjct: 254  TNNNNNNNNSNYNNTSPMASVASNEYYPMTSPQTKKPTSHELYQLTESNASTSTLSSDKT 313

Query: 304  NRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYKTD 363
            NRPP  YV++IIADKL+ +EM DLWVTLRTEQLDWVD FLE+QGHIAMAN+L   IYKT 
Sbjct: 314  NRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANILMKQIYKTT 373

Query: 364  PETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRLATRKMATE 423
            P+  LS  LLEKE++FF+CF+VLS+L+QG+YE S+H +M +T+A GLFS RL TRKMA E
Sbjct: 374  PKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLFSTRLGTRKMAIE 433

Query: 424  IFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQFKIVQSWL 483
            IFVCMLEK+NK RFEA+LN+LD+ F+IG N HM   +K  PQ+F H T DS  K++Q+WL
Sbjct: 434  IFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLTPDSHLKVLQAWL 493

Query: 484  FAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRILLR 543
            F++E +++GRGKMGSLVGAS D K SGGENAILEY  WTMVF+N  CN + +I QR+LLR
Sbjct: 494  FSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTIIQQRMLLR 553

Query: 544  TRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSASLL 603
            T+LEN+G LRIMN+ KLL+Y+KV++ +E+YEN KLDD N +LE+    S++++ D  SLL
Sbjct: 554  TKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVNLQDPVSLL 613

Query: 604  KKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSVSAV- 662
              L+  CKGTE+EKLL SL++HLFLS+SRL+E+  DPTKLSKQL+LMDSLVTNVS S+  
Sbjct: 614  NNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLVTNVSSSSTA 673

Query: 663  DESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVG 722
            DE S++NMAIQRLYDSMQTDEVARRAILESRTLTKKLEE QAE+D L +KLSK  NGLVG
Sbjct: 674  DEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLSKAENGLVG 733

Query: 723  QLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXXXXXXXMLTILNSRPEGDL 782
            QLE ++ +RD IL KNQRVT QLQ                       MLTILN+R   + 
Sbjct: 734  QLENDLNERDQILAKNQRVTQQLQSELEELKKKHLLEKHEHEVELRKMLTILNTRSSTND 793

Query: 783  SRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKRFGITVQPNKRLKMLRL 842
              K     K     L+  K   IQ+ LQDGL++ K D ++D+K+FG+TVQPNKRLKMLR+
Sbjct: 794  GAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFGMTVQPNKRLKMLRM 853

Query: 843  QMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRK--------ENELRAKELKANK 894
            QMEDIE EAR+LEMTNF +  +  L+ PV+V    +  K        + E   ++ + NK
Sbjct: 854  QMEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKHRHKKHKIEKINQQESNDQKSRINK 913

Query: 895  LSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGIDLSTHF 954
            L++LR+ALA+IQ ESN +SKFN+EERVNELF +KKL AL RL +LE  YK++GI+     
Sbjct: 914  LNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELETKYKDFGINFEMKD 973

Query: 955  PIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMK--SELKNDKALRRHE 1012
             ++++P +  +     E   +LDP+ Y+ KLD+IDR++++L+ ++   EL+ + +     
Sbjct: 974  FLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQLLNLQKTQELREESSSSYSS 1033

Query: 1013 SPSKQDTDDDEIQDTGSMVNEDXXXXXXXXXXXXXXQKYGTGKNATNMLTNDILNSSERK 1072
            S S ++ DDDEI    S  +                +KYGTG+    M       +S   
Sbjct: 1034 SESDEENDDDEIFVASS--SSKPAGSGTRSFLETLSEKYGTGQKNVAMTATP---NSRIV 1088

Query: 1073 GHSRQSFMERMKKPSGVPAYLEELPLKVPKAPPLGV 1108
              S + F++RM++ S    +L+EL  KV  AP L V
Sbjct: 1089 TQSEKQFLDRMRRSSTAAPFLQELTEKV--APALSV 1122

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/590 (63%), Positives = 456/590 (77%), Gaps = 15/590 (2%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R++KK+KQLHWEK++ TDNSIW++GKAE+FA DL+EKGV  +LEKAFAARE+KSLA+K++
Sbjct: 1305 RSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSLASKRK 1364

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            +DLDKITFLSRD+SQQFGINLHMYS LSVE+LVTKILKC+RDF+ TPSV+EFLSKPEI E
Sbjct: 1365 DDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSKPEITE 1424

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS NLARNYSPY+TDW+G+  +EDAK PEKDP +LQRADQ+YLQL+ NLQPYW SRMRAL
Sbjct: 1425 VSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWASRMRAL 1484

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
            ++IT+YE+EY+EL+ KLRKVDKAV  +Q+S NLRNVFNVILAVGNYMND++KQAQGFKLS
Sbjct: 1485 KIITTYEKEYNELLLKLRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKLS 1544

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD+ NSMTFLNYVEKI+R NYPSFN FL++L+PVL+VVKISIEQL +DCKEF
Sbjct: 1545 TLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLANDCKEF 1604

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
             QS+TNVERSI+IGNL+DSSKFH              +  K+ +LL++EV L++MEF+ L
Sbjct: 1605 FQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDGL 1664

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMV--XXXXXX 1673
            MQ YGED                 INEY++AQ QN+K EEEE  Y+ HK+MV        
Sbjct: 1665 MQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVEEEEEAYERHKRMVEEQQRKAE 1724

Query: 1674 XXXXXXXXNATE-EDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLND 1732
                    N  E ED  +E  DRR  MDKLLEQLKN GP +ADP SARKRA+ RKKML D
Sbjct: 1725 RKEAKNQNNIDENEDDDQERTDRRGTMDKLLEQLKNVGPSRADPSSARKRALARKKMLTD 1784

Query: 1733 SEAVSDVLDSIQQEDDSMIYSPEKQEGITNPTGDSSQ----------SPSKGAANNQQDE 1782
             E   +++  ++ E DS+IYSP+ +   + P G +            SPSKG  ++   E
Sbjct: 1785 KEGTVNMMHDLETESDSIIYSPDNKAIGSTPFGANGASSHKQNSNELSPSKGFRDDLS-E 1843

Query: 1783 EEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLRARRRKTNTDMSPEGS 1832
            EEI++RAK LLMGLRG  SPSKRN++L+ HKEKLRARRR+TN D+ P GS
Sbjct: 1844 EEISERAKTLLMGLRGTASPSKRNSMLDEHKEKLRARRRRTNNDL-PSGS 1892

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/868 (53%), Positives = 612/868 (70%), Gaps = 45/868 (5%)

Query: 285  LQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLE 344
            + +LS +N+S+S+++ +K NRPPIHYVKRIIAD +T  EM DLWVTLRTEQ+DWVD F+E
Sbjct: 294  MYKLSMRNTSSSSMS-DKTNRPPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIE 352

Query: 345  HQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAE 404
            HQGHIAMAN+L  S+YKT  +   +  LLEKE+AFF+CFRVLS+L+QGL E +RH IM++
Sbjct: 353  HQGHIAMANILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQ 412

Query: 405  TVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSP 464
            TVA GLFS+ L+TR+MATEIFVCMLEKKN  RF+ +LNALD+KFKIG N HM   +K  P
Sbjct: 413  TVARGLFSITLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFP 472

Query: 465  QHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMV 524
             +F+H T DSQ K+ Q+WLFAVE +L+GRGKMGSLVGAS+DFK SGGENAILEY QW+M+
Sbjct: 473  DYFTHLTLDSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMI 532

Query: 525  FINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSV 584
            FINH C+ +  INQR+LLRT+LEN G LRIMN+ K LDYDKV+E ++ YEN KLDDLN++
Sbjct: 533  FINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTL 592

Query: 585  LETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLS 644
            LE+    ++I++ D  S+L+ L+D CKGTE+EKLL SL++HLFLS+S+ +E+ +DP KLS
Sbjct: 593  LESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLS 652

Query: 645  KQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQA 704
            +QL+L+DSLVTNVSVS+ D+ +S+NMAIQRLYD+MQTDEVARR+ILESRTLTKKLEE QA
Sbjct: 653  RQLKLLDSLVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQA 712

Query: 705  ERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXX 764
            ERD LSQKL    +GLVGQL+ E+ QRD IL KNQRV  QLQ                  
Sbjct: 713  ERDLLSQKLKNAEHGLVGQLQDELAQRDRILSKNQRVMEQLQGELEELKKKHLLEKHEQE 772

Query: 765  XXXXXMLTILNSRPEGDLSRKGSVHSKAQ-PGILDPDKKSTIQQALQDGLLKTKKDLSVD 823
                 MLTILN+RPE       S  +KA+ P  LDP KK +IQQALQDGL +TKKD SVD
Sbjct: 773  VELRKMLTILNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVD 832

Query: 824  SKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKEN 883
            ++ FG+T+QPNKRLK+LR+QMEDIE EARELEMTNF ++ K  L+AP K++    V  + 
Sbjct: 833  ARNFGMTIQPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRKLEAPSKIKKPKKVATKK 892

Query: 884  ELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMY 943
            E+   +   NKL++LR+ LA+IQ ESN +SKFNV+ERVNELF QK+++AL RL DLE  Y
Sbjct: 893  EI---DPSINKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKY 949

Query: 944  KEYGIDLSTHFPIQDEPQESAESEKNAEGP-----STLDPRAYQAKLDEIDRISKELIEM 998
            K++GID +      DE  +SA  ++N         S+LDP+AYQ KLDE++R++ EL+ +
Sbjct: 950  KDFGIDFNI-----DELVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRV 1004

Query: 999  KSELK-NDKALRRHESPSKQDTDDD-------------EIQDTGSMVNEDXXXXXXXXXX 1044
            K+++  +D  L      +   ++               E QDT S  N            
Sbjct: 1005 KNKVNASDNNLSSRRPSASSSSESASSSSDSDDGESLIERQDTQS--NFSGTSAGPGSFL 1062

Query: 1045 XXXXQKYGTGKNATNMLTNDILNSSERKGHSRQS---FMERMKKPSGVPAYLEELPLKVP 1101
                QKY TG+ +          +S R   +R     F+ R+K+ +  P +L+EL  KV 
Sbjct: 1063 EALTQKYATGQKS----------ASPRDQSTRMKDNIFINRIKQTNVAPPFLDELTDKVA 1112

Query: 1102 KAPPLGVAETE-DSSDNIAEDVEKESAE 1128
            +APP+  +  E D+++ I E  ++E+ E
Sbjct: 1113 EAPPVEASLAEPDNNNTINESSKEETGE 1140

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/592 (65%), Positives = 462/592 (78%), Gaps = 23/592 (3%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R +KKLKQLHWEKLDATDNSIW + KAEKFA DLYEKGVL DLEKAFAAREIKSLA+KK+
Sbjct: 1293 RPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEKAFAAREIKSLASKKK 1352

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            EDLDKI+FLSRD+SQQFGINLHMY+ L V+++V KILKC+RDF+ TPSV+EFLSKPEI+E
Sbjct: 1353 EDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSKPEIVE 1412

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS NLARNY+PYSTDW+GV  VEDAK+PEKDP ELQRADQLYLQLI NLQ YWGSRMRAL
Sbjct: 1413 VSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGSRMRAL 1472

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
             VIT++++EY+EL+TKLRKVDKAV+ +Q+S NL+NVFNVILAVGNYMND++KQAQGFKL+
Sbjct: 1473 TVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQGFKLA 1532

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD+ NSMTFLNYVEKIVR NYPSFNDFL +L+PVLDVVKISIEQL+SDCKEF
Sbjct: 1533 TLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVSDCKEF 1592

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
            SQSI NVERS++ GNL+DSSKFH              +A K+ ELL +EVKL+IMEF  L
Sbjct: 1593 SQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIMEFLRL 1652

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            MQ YGED                 I EYK+AQ QN+KAEEEE++Y+ HKKMV        
Sbjct: 1653 MQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQNIKAEEEEQVYERHKKMVEDQQKKLQ 1712

Query: 1676 XXXXXXNAT---EEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLND 1732
                  N +   EE + +++ DRRAMMDKLL+QLKNAGP K DP SARKRA++RKK++ +
Sbjct: 1713 EQENGSNGSENGEEGSGDDSGDRRAMMDKLLDQLKNAGPSKTDPSSARKRALVRKKLMTE 1772

Query: 1733 SEAVSDVLDSIQQEDDSMIYSPEKQEGITNPTG-----DSSQ------------SPSKGA 1775
            S A   +L  I+ EDDS+IYSPE +    NP       D S+            SPS+ +
Sbjct: 1773 STA---LLKDIETEDDSIIYSPEGKNPFVNPVDLDTPHDESEMDVSSSPIQRSLSPSRNS 1829

Query: 1776 ANNQQDEEEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLRARRRKTNTDM 1827
                 D++E+TDRAKALLM LRG  +PSKRN++L+ HKEKLRARRRKTN+D+
Sbjct: 1830 TLLSDDQDEVTDRAKALLMELRGSNTPSKRNSLLDEHKEKLRARRRKTNSDL 1881

 Score =  119 bits (299), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 95/162 (58%), Gaps = 9/162 (5%)

Query: 65  NANDLRPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQXXXXXXXXXXXXXHLST 124
           + N L+PLNKK+++NTQNLS Y+N K S +     H+RS SVQ                 
Sbjct: 66  HTNSLKPLNKKTSLNTQNLSQYINDKHSPQ-----HTRSASVQSSSKYSYSRRSSSQTLG 120

Query: 125 PGVNSTLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIKLDMP-SSHEVENLFEDMMY 183
             +N  + R+ TNQ                  F+ PDGKI L+MP   +EVE LFED+M 
Sbjct: 121 STLNQ-IARQHTNQSSASILSQGSFTNLSK--FIAPDGKINLEMPRDPNEVEVLFEDIML 177

Query: 184 KRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAK 225
           KRNILQ+L  DKQ ELM YD++KKWLIVKQDLQN+ KK+  K
Sbjct: 178 KRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLK 219

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/846 (56%), Positives = 599/846 (70%), Gaps = 37/846 (4%)

Query: 289  SDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGH 348
            S+ N S STL  ++ NRPPIHYV+RI+ADKLT +EM DLWVTLRTEQLDWVD F+EHQGH
Sbjct: 319  SENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGH 378

Query: 349  IAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVAN 408
            IAMANVL  S+YKT P   L+ +LLEKE++FF+CFRVLS+L+QGLYE S H +M +TVA 
Sbjct: 379  IAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAE 438

Query: 409  GLFSVRLATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSPQHFS 468
            GLFS +LAT+KMATEIFVCMLEKKNK RFEAVL ALDKKF+IG+NLHM+   K  PQ+FS
Sbjct: 439  GLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFS 498

Query: 469  HFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINH 528
            H T +S  KI+Q+WLFAVEQ+L+GRGKMGSLVGAS+DFK  GGENAILEY QWTMVFINH
Sbjct: 499  HLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINH 558

Query: 529  FCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETG 588
             C+ +D INQR+LLRT+LEN G LRIMN+ KLLDYDKV++ ++ Y+N KLDD N  LE  
Sbjct: 559  LCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEAN 618

Query: 589  AHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLR 648
              A ++D+ D  SLLK L+  CKGTE+EKLL SLV+HLFLS+S+L+E+NQ+ +KL+KQL+
Sbjct: 619  NEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLK 678

Query: 649  LMDSLVTNVSV-SAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERD 707
            LMDSLVTNVS+ SA DE S++NMAIQRLYD+MQTDEVARRAILESR LTKKLEE QAERD
Sbjct: 679  LMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERD 738

Query: 708  FLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXXXXX 767
             LS+KLSK  +GLVGQLE E+ +RD IL KNQRV  QL+                     
Sbjct: 739  SLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMQQLESELEELKKKHLLEKHQQEVEL 798

Query: 768  XXMLTILNSRPE--GDLSRKGSVHSKAQPGILDP----DKKSTIQQALQDGLLKTKKDLS 821
              MLTILNSRPE   D++ +G+ +       +DP     +K+ IQ+ LQDGL + KKD  
Sbjct: 799  RKMLTILNSRPEESSDIN-EGTRN-------IDPSLNFSEKANIQKVLQDGLSRAKKDYK 850

Query: 822  VDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRK 881
             DSK+FG+T+QPNKRLKMLR+QME+IE EAR+LEMTNFA+  K  L+ P++++     + 
Sbjct: 851  DDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIKKPKLKKN 910

Query: 882  ENEL-----RAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRL 936
            +++      RA+E   NKL++LR+ALADIQ ESN +SKFNVEERVNELF +KK  AL RL
Sbjct: 911  KHKDKNFLARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRL 970

Query: 937  NDLENMYKEYGIDLSTHFPIQDEPQESAESEKNAEGP-STLDPRAYQAKLDEIDRISKEL 995
             +LE  YK +GID +    ++   + S   E+  +   S+LDP+AYQ KLDEI+RI+ EL
Sbjct: 971  KELETKYKGFGIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRITDEL 1030

Query: 996  IEM----KSELKNDKALRRHESPSKQDTDDDEIQDTGSMVNEDXXXXXXXXXXX------ 1045
            +++    K E K ++  +   S S  D DDDE+    S  +E                  
Sbjct: 1031 LDLQTQTKQETKEEENGKSSFSSSSSDADDDEVYQDASPTHEIRSENSELSAGSGPGSFL 1090

Query: 1046 -XXXQKYGTGKNATNMLTNDILNSSERKGHS----RQSFMERMKKPSGVPA-YLEELPLK 1099
                QKYGTG+N T              GH+     ++FM R+K+ +   A YLEEL  K
Sbjct: 1091 DALSQKYGTGQNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQK 1150

Query: 1100 VPKAPP 1105
            V K  P
Sbjct: 1151 VNKVEP 1156

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/604 (61%), Positives = 448/604 (74%), Gaps = 26/604 (4%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R  KKLKQLHWEKLD+TDNSIW SGKAEKFA DLYEKGVL DLEKAFAAREIKSLATK++
Sbjct: 1346 RPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRK 1405

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            EDL KITFLSRD+SQQFGINLHMYS LSV +LV K+L C+RDF+ TPSV+EFLSK EIIE
Sbjct: 1406 EDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTEIIE 1465

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS NLARNY+PYSTDW+GV  ++DAK PEKDP +LQRADQ+YLQL+ NL+ YWGSRMRAL
Sbjct: 1466 VSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGSRMRAL 1525

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
             V+TSYEREY+EL+ KLRKVDKAV  +Q S NLRNVFNVILAVGN+MND++KQAQGFKLS
Sbjct: 1526 TVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFKLS 1585

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD  NSMTFLNYVEKI+R NYP+FNDFL++L+PVLDVVK+SIEQL++DCK+F
Sbjct: 1586 TLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVNDCKDF 1645

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
            SQSI NVERS++IGNL+DSSKFH              EA ++ +LL +EVKL+IMEFESL
Sbjct: 1646 SQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIMEFESL 1705

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            MQ YGED                 INEYK+AQAQNL  EEEERLY+ HKK+V        
Sbjct: 1706 MQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAGEEEERLYEKHKKLVEEQQKKAQ 1765

Query: 1676 XXX-----XXXNATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKML 1730
                        + E +  +E EDRR +MDKLLEQLKNAGP K DP SARKRA++RKK L
Sbjct: 1766 EKEKQKERSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRALVRKKYL 1825

Query: 1731 NDSEAVSDVLDSIQQEDDSMIYSPE------------------KQEGITNPTGDSSQSPS 1772
            +D ++   +L+ +  E+ S++YSPE                     G+ N T +   SPS
Sbjct: 1826 SDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAESPTPLATRGLMN-TPEDLPSPS 1884

Query: 1773 KGAANNQQDEEEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLRARRRKTNTDMSPEGS 1832
            K  A   +D+EEI+DRA+ LL  LRG E   K+N+ L+ H EKLRAR+ + +++ +    
Sbjct: 1885 KAPA--LEDQEEISDRARMLLKELRGSEISVKQNSTLDEHLEKLRARKERASSETNTGNK 1942

Query: 1833 FLFN 1836
              FN
Sbjct: 1943 LSFN 1946

 Score =  143 bits (360), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 81/157 (51%), Positives = 100/157 (63%), Gaps = 9/157 (5%)

Query: 70  RPLNKKSTMNTQNLSHYMNGKSSAE-SLSSNHSRSPSVQXXXXXXXXXXXXXHLSTPGVN 128
           RPLNKKST+NTQNLS YM+GK SA+  +SS H+RS SVQ               ++   +
Sbjct: 82  RPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKR-------NSSQAS 134

Query: 129 STLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIKLDMPS-SHEVENLFEDMMYKRNI 187
           + LTR+ T Q                + F TPDGKI L+MPS  +EVE LFED+MYKRNI
Sbjct: 135 NKLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNI 194

Query: 188 LQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLA 224
            Q+LS DKQ+ LM Y  +KKWLIVKQDLQN+ KK+ A
Sbjct: 195 FQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRA 231

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/843 (56%), Positives = 598/843 (70%), Gaps = 26/843 (3%)

Query: 292  NSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAM 351
            N+S STL  ++ NRPPIHYV+RI+ADKLT +EM DLWVTLRTEQLDWVD F++HQGHIAM
Sbjct: 326  NTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAM 385

Query: 352  ANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLF 411
            ANVL  SIYKT P   L+ +LLEKE++FF+CFRVLS+L+QGLYE S H +M +TVA GLF
Sbjct: 386  ANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLF 445

Query: 412  SVRLATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSPQHFSHFT 471
            S +L TRKMATEIFVCMLEKKNK RFEAVL ALDKKF+IG+NLHM+   K  PQ+FSH T
Sbjct: 446  STKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLT 505

Query: 472  RDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCN 531
             +S  KI+Q+WLFAVEQ+L+GRGKMGSLVGAS++FK  GGENAILEY QWTMVFINH C+
Sbjct: 506  LESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCS 565

Query: 532  GTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHA 591
             +D +NQR+LLRT+LEN G LRIMN+ KLLDYDKV++ +E Y+N KLDD N  LE    A
Sbjct: 566  CSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEASNKA 625

Query: 592  SDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMD 651
             ++D+ D  SLLK L++ CKGT++EKLL SLV+HLFLS+S+L+E+NQ+P+KLSKQL+LMD
Sbjct: 626  FNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLKLMD 685

Query: 652  SLVTNVSV-SAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLS 710
            SLVTNVSV S  DE S++NMAIQRLYD+MQTDEVARRAILESRTLTKKLEE QAERD LS
Sbjct: 686  SLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERDSLS 745

Query: 711  QKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXXXXXXXM 770
            +KL K  +GLVGQLE E+  RD IL KNQRV  QL+                       M
Sbjct: 746  EKLGKAEHGLVGQLENELHGRDRILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKM 805

Query: 771  LTILNSRPE--GDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKRFG 828
            LTILNSRPE   DLS KG+      P  L+  +K+ IQ+ LQDGL + KKD   DSK+FG
Sbjct: 806  LTILNSRPEESSDLS-KGT--KDINPS-LNSSEKANIQKVLQDGLSRAKKDYKDDSKKFG 861

Query: 829  ITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKENELRAK 888
            +T+QPNKRLKMLR+QME+IE EAR+LEMTNFA+  K  L+ P++++      K+++++  
Sbjct: 862  MTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIEIKKPKIKHKKHKIKKS 921

Query: 889  ELKA-----NKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMY 943
             +K      NKL++LR+ALA+IQ ESN +SKFNVEERVNELF +KK  AL RL +LE  Y
Sbjct: 922  SVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKY 981

Query: 944  KEYGIDLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMKSELK 1003
            K +GID +    I+   + S + E +A  PS LDP+AYQ+KLDEI+RI+ EL+++++++K
Sbjct: 982  KGFGIDFNVEEFIETPKKFSVDEENDAAYPS-LDPKAYQSKLDEINRITDELLDLQTQVK 1040

Query: 1004 NDKALRRHESPSKQDT-----------DDDEIQDTGSMVNEDXXXXXXXXXXXXXXQKYG 1052
             +      E      +           D    Q+     +E               QKYG
Sbjct: 1041 QETEEDEDEETKSSSSSSDADDDEIYQDASPSQERRGEYSELSAGSGPGSFLDALSQKYG 1100

Query: 1053 TGKNAT-NMLTNDILNSSERKGHSRQSFMERMKKPSGVPA-YLEELPLKVPKAPPLGVAE 1110
            TG+N T +    D   S     +  +SF+ R++K +   A YLEEL  KV K  P    +
Sbjct: 1101 TGQNVTASAGLRDNRGSGHMPSNVEKSFINRLRKSTASSAPYLEELTQKVNKVEPFKQNK 1160

Query: 1111 TED 1113
             ED
Sbjct: 1161 DED 1163

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/587 (63%), Positives = 454/587 (77%), Gaps = 18/587 (3%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R  KKLKQLHWEK+D+TDNSIW SGKAEKFA DLYEKGVL DLEKAFAAREIKSLATK++
Sbjct: 1350 RPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRK 1409

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            EDL K+TFLSRD+SQQFGINLHMYS LSV +LV KILKC+RDF+ TPSV+EFLSKPEI E
Sbjct: 1410 EDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSKPEITE 1469

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS NLARNY+PYSTDW+G+  +EDAK PEKDP +LQRADQ+YLQL+ NL+ YWGSRMRAL
Sbjct: 1470 VSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGSRMRAL 1529

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
             V+TSYE+EY+EL+ KLRKVD+AV  +Q+S NLRNVFNVILAVGN+MND++KQAQGFKLS
Sbjct: 1530 TVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQGFKLS 1589

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD NNSMTFLNYVEKI+R NYPSFNDFL++L+PVLDVVK+SIEQL++DCK+F
Sbjct: 1590 TLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVNDCKDF 1649

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
            SQSI NVERS++IGNL+DSSKFH              EA ++ +LL++EVKL+IMEFESL
Sbjct: 1650 SQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIMEFESL 1709

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            MQ YGED                 +NEYKRAQ+QNL AEEEERLY+ HKKMV        
Sbjct: 1710 MQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQQKRAQ 1769

Query: 1676 XXXXXXNAT---EEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLND 1732
                    +   E +  EE EDRRA+MDKLLEQLKNAGP K+DP SARKRA++RKK ++D
Sbjct: 1770 DKEKHREHSALPEGNEEEETEDRRAVMDKLLEQLKNAGPAKSDPSSARKRALVRKKYISD 1829

Query: 1733 SEAVSDVLDSIQQEDDSMIYSPEKQEGITN-------PTGDSSQS--------PSKGAAN 1777
             +  + VL+ +  E+ S++YSPE     T+       PT  +++         PS   A+
Sbjct: 1830 KDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTPLATRGFMNTPEDLPSPSKAS 1889

Query: 1778 NQQDEEEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLRARRRKTN 1824
              +D+EEITDRA+ LL  LRG ++P K+N++L+ H EKLRAR+ + N
Sbjct: 1890 ALEDQEEITDRARMLLKELRGSDAPVKQNSILDEHLEKLRARKERAN 1936

 Score =  144 bits (363), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/157 (51%), Positives = 100/157 (63%), Gaps = 9/157 (5%)

Query: 70  RPLNKKSTMNTQNLSHYMNGKSSAES-LSSNHSRSPSVQXXXXXXXXXXXXXHLSTPGVN 128
           RPLNKK+T+NTQNLS YMNGK S ++  SS H+RS SVQ               ++   +
Sbjct: 83  RPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKR-------TSSQAS 135

Query: 129 STLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIKLDMPS-SHEVENLFEDMMYKRNI 187
           + LTR+ T Q                + F TPDGKI L+MPS  +EVE LFED+MYKRNI
Sbjct: 136 NKLTRQHTGQSHSATSLLSLGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNI 195

Query: 188 LQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLA 224
            Q+LS DKQ+ELM Y  +KKWLIVKQDLQN+ KK+ A
Sbjct: 196 FQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKIRA 232

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/828 (54%), Positives = 592/828 (71%), Gaps = 36/828 (4%)

Query: 285  LQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLE 344
            L  ++++N+S+ST+ ++K NRPPIHYVK+I+ DKL+ +EM DLWVTLRTEQLDWVD FLE
Sbjct: 304  LYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLE 363

Query: 345  HQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAE 404
            +QGHIAMAN+L  SIYKT P+  +S  LL+KE+AFF+CFRVL+VL+QGL+E + H++M +
Sbjct: 364  NQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTD 423

Query: 405  TVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSP 464
            T+A GLFS RLATRKMATEIFV +LEKKNK RFE+VL++LDK F IG+N HM    K  P
Sbjct: 424  TIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYKKLP 483

Query: 465  QHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMV 524
            Q+F+H T +S  K++Q+WLFAVEQ+L+GRGKMGSLVGASED+K +GGENAILEY QWTMV
Sbjct: 484  QYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMV 543

Query: 525  FINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSV 584
            FINH C+ ++ INQR LLR +LEN G LRIMN+ KLLDY+KV++ +E YEN KLDD N++
Sbjct: 544  FINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNAL 603

Query: 585  LETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLS 644
            LE+     ++D+ D  SL+K L D CKGTE+EK L SLV+H+FL TS+L+++ QDP K++
Sbjct: 604  LESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVT 663

Query: 645  KQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQA 704
            KQL+LMDSLVTNVSV++ +E S++NMAIQRLYDSMQTDEVARRAILESRTLTKKLEE +A
Sbjct: 664  KQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEA 723

Query: 705  ERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXX 764
            ERD L +KLSK  +GLVGQLE EV++RD IL KNQRV  QL+                  
Sbjct: 724  ERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMKQLESELEELKKKHLLEKHEQE 783

Query: 765  XXXXXMLTILNSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDS 824
                 MLTILNSRP     +K  +      G ++  +K  +Q+ALQ GL K KKD   DS
Sbjct: 784  VELRKMLTILNSRPAKTKEQKKKI------GSIEASEKEDLQRALQSGLQKAKKDFKDDS 837

Query: 825  KRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKENE 884
            K+FG+T+QPN+RLK+LR+QME IE EAR+LEMTNFA++ K  L+ P  V+  +  +  +E
Sbjct: 838  KKFGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQKKS--KPISE 895

Query: 885  LRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYK 944
            L  KE +  KL+ELR  L  IQ ESN VSKFNV+ERVNELF  KK +AL RL +LE  YK
Sbjct: 896  LN-KEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLKELETKYK 954

Query: 945  EYGIDLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMKSELKN 1004
             +GID    F ++D   ES +S  + EG S+LDP+ YQ KLDEI +IS+EL++ K+EL+ 
Sbjct: 955  GFGID----FKVEDFTHESTDS--SNEGYSSLDPKVYQDKLDEITKISEELLQQKNELET 1008

Query: 1005 DKALRRHESPSKQD------------TDDDEIQDTGSMVNEDXXXXXXXXXXXXXXQKYG 1052
             +      +   +             T++ +I  T S V++               QKYG
Sbjct: 1009 TQTSSSESNSDSESSSDSDDSMEDALTNNKDINGTSSNVSD----LASGSFLDTLTQKYG 1064

Query: 1053 TGKNATNMLTNDILNSSERKGHSRQSFMERMKKPSGVPAYLEELPLKV 1100
            TG+     + + + + S R   + +SF++RMK+ S VP+Y+EEL  K+
Sbjct: 1065 TGQ--AEPIQSPVGHYSNR---NEKSFVDRMKRNSRVPSYVEELSKKM 1107

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/609 (60%), Positives = 445/609 (73%), Gaps = 40/609 (6%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R +KKLKQLHWEK+++TDNSIW S KAEKFA DLYEKGVL +LEKAFAAREIKSLAT+K+
Sbjct: 1260 RPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSLATRKK 1319

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            EDL KI+FLS D+SQQFGINLHMYS L+V + V K+LKCERDFM+TPSV+EFLSK EI+E
Sbjct: 1320 EDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEIVE 1379

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VSTNLARNY+PYSTDW+G+ K+EDAK+PEKDP ELQRADQ+YLQL+ NLQ YW SRMRA+
Sbjct: 1380 VSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASRMRAI 1439

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
            R+ITSYEREY+EL+ KL +VDKAV  +Q S NL+N+FNVILAVGN+MNDSAKQA+GFKLS
Sbjct: 1440 RMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKLS 1499

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKDA+NSMTFLNYVEKIVR NYP FN+FL +L+PVL+VVK+SIEQL++DC +F
Sbjct: 1500 TLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDCNDF 1559

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
             Q I NVERSI+IGNL+DSSKFH              EA K+ ELL +E+KL+IMEFE +
Sbjct: 1560 VQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEFEQI 1619

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            MQ YGED                 I EYK+AQAQN+K EEEE  Y+ HKKMV        
Sbjct: 1620 MQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQRK-- 1677

Query: 1676 XXXXXXNATEEDASEENED---------------RRAMMDKLLEQLKNAGPVKADPLSAR 1720
                     +EDAS+ NE+               RRA+MDKLLEQLKNAG VK DP SAR
Sbjct: 1678 --------AQEDASKLNENSSQTGNSDEEEESEDRRAVMDKLLEQLKNAGQVKTDPTSAR 1729

Query: 1721 KRAMIRKKMLNDSEAVSDVLDSIQQEDDSMIYSPEKQEGI------TNPTGDSSQSPSKG 1774
            KRA++RKK+ +  E+ S  L  +Q   DS+IYSP+ +E I       +PT  + +    G
Sbjct: 1730 KRALLRKKIHSSEESESSPLAEMQVGGDSLIYSPDAKEQIELEIHMASPTPKTKEDGKLG 1789

Query: 1775 AANNQQDE---------EEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLRARRRKTNT 1825
               N   E         EEI DRAK LLM LRG ++   RN  L+ HKE+LRARR++T++
Sbjct: 1790 TGENSNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHKERLRARRKRTDS 1849

Query: 1826 DMSPEGSFL 1834
            +  P  + L
Sbjct: 1850 NKIPSSNRL 1858

 Score =  140 bits (352), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 98/160 (61%), Gaps = 5/160 (3%)

Query: 70  RPLNKKSTMNTQNLSHYMN-GKSSAESLSSNHSRSPSVQXXXXXXXXXXXXXHLS-TPGV 127
           RPLNKKST+N+QNLS Y+N GK+ +    SNH R+ S Q              +S  P  
Sbjct: 75  RPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSS 134

Query: 128 --NSTLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIKLDMPSS-HEVENLFEDMMYK 184
             N  LTR  TN                 + FMTPDGKI L MPS  +EVE+LFED+MYK
Sbjct: 135 MGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYK 194

Query: 185 RNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLA 224
           RNILQ+L  +KQ ELM Y ++KKWLIVKQDLQN+FK++ A
Sbjct: 195 RNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKA 234

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/830 (53%), Positives = 570/830 (68%), Gaps = 34/830 (4%)

Query: 285  LQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLE 344
            + Q S+ N S S++ T++INRPPIHYVK+IIAD+LT  EMNDLWVTLRTEQLDWVD FLE
Sbjct: 308  IYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLE 367

Query: 345  HQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAE 404
            HQGHIAMANVL  +IYK  P + L+ +L EKEH+FF+CFRVLS+L+QGLYE ++H +M++
Sbjct: 368  HQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSD 427

Query: 405  TVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSP 464
            T+ANGLFS RLATRKMATE+ VCM+EK+N +RFE VL +LD+ F+  ENL+M+H  K  P
Sbjct: 428  TIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRYFRQEENLNMVHLSKTLP 487

Query: 465  QHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMV 524
              +   T ++++KI+Q+WL A++++L GRGKMGSLVGAS+D++ S GENAILEY  WTMV
Sbjct: 488  GEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYR-SAGENAILEYCLWTMV 546

Query: 525  FINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSV 584
            FINH C+ + ++NQRILLRT+LEN G LRIM + K LDY+K+ E +E Y+N KLDD N+V
Sbjct: 547  FINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTV 606

Query: 585  LETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLS 644
            LET +  S ++M +  SL++ L++ CKG+++EKLL SL++HL+LS+S+LM + +DPTKLS
Sbjct: 607  LETESKNSKVNMQNPNSLIENLWESCKGSDNEKLLLSLIQHLYLSSSKLMGEKEDPTKLS 666

Query: 645  KQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQA 704
            KQL+L+DSL+TNV+ S  DE S +N+AIQRLYDSMQTDEVARRAILESRTLTKKLEEA A
Sbjct: 667  KQLKLIDSLLTNVNGSMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHA 726

Query: 705  ERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXX 764
            ERD+LS KLS   NGLVGQLE +++QRD+ILEKNQRV  QL+                  
Sbjct: 727  ERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMKQLESELEDLKKKHLLEKHEHE 786

Query: 765  XXXXXMLTILNSRPEGDLSRKGSVHSKAQPGI------LDPDKKSTIQQALQDGLLKTKK 818
                 MLTILNSR           +    P +      LDP+KK  IQ+AL+  L KTKK
Sbjct: 787  VELRKMLTILNSR-----------NGTQNPDVDDVTITLDPNKKLDIQKALELELNKTKK 835

Query: 819  DLSVDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKV----- 873
            DLS DSKRFGITVQPNKRLKMLR+QMEDIE EAR+LEMTNFADH +  L+ PV V     
Sbjct: 836  DLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNLKKPVIVKKEKK 895

Query: 874  -ESSNYVRKENELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSA 932
                  +  E   +  E+K  KL +LRKALA IQ E+N +SKFNVE RVNE+F+ KKL A
Sbjct: 896  LRKKKKINTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDKKLKA 955

Query: 933  LDRLNDLENMYKEYGIDLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRIS 992
            L RL  LE  YK++ I      P  +          + +  STLDP   Q K++E+D IS
Sbjct: 956  LQRLKQLEAKYKDFEI------PFDELQDLDDRELDDEQQHSTLDPTYLQKKINELDEIS 1009

Query: 993  KELIEMKSELKNDKALRRHESPSKQDTDDDEIQDTGSMVNEDXXXXXXXXX-XXXXXQKY 1051
             EL  M  +   +      +S S  + D D      S+ N                 QKY
Sbjct: 1010 DELYLMNYDSDANNG-NTSDSSSSSEADGDGTDSMRSVSNAPSKGISEAGSFLESLSQKY 1068

Query: 1052 GTGKNATNMLTNDILNSSER-KGHSRQSFMERMKKPSGVPAYLEELPLKV 1100
            GTG+NA +  T+ I + +ER      +SFM R+K+ +    +LEEL  KV
Sbjct: 1069 GTGQNAISSPTS-ITSPNERIASQGEKSFMNRLKRQTMAAPFLEELTQKV 1117

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/672 (55%), Positives = 465/672 (69%), Gaps = 42/672 (6%)

Query: 1228 LLGQKMAYRTAVXXXXXXXXXXXXXXXXRARKKLKQLHWEKLDATDNSIWSSGKAEKFAG 1287
            ++G+K  Y++ V                R +KKLKQLHW+KLD+TD+SIWS G AE+FA 
Sbjct: 1246 MMGKKEPYKSVVDQPSLLQLTNSDRLP-RPQKKLKQLHWDKLDSTDSSIWSKGMAERFAD 1304

Query: 1288 DLYEKGVLEDLEKAFAAREIKSLATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEEL 1347
            DLYEKGVL +LEKAFAAREIKS+ T+K+EDL KI+FLS D+SQQFGINLHMY  L+V EL
Sbjct: 1305 DLYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPEL 1364

Query: 1348 VTKILKCERDFMDTPSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDP 1407
            + K+LKC+R+ ++TPSV+EFL+K EI+EVS NLARNY+PY+TDW+GV  ++  K   +  
Sbjct: 1365 IEKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQKFQRR-- 1422

Query: 1408 AELQRADQLYLQLIYN---LQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQK 1464
              +Q   +  ++ IYN   LQ YW SRMRAL+VITSYEREY+ELVTKLRKVDKAV  +Q+
Sbjct: 1423 --IQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQR 1480

Query: 1465 STNLRNVFNVILAVGNYMNDSAKQAQGFKLSTLQRLTFIKDANNSMTFLNYVEKIVRDNY 1524
            S NL+NVFNVILAVGNYMND++KQAQGFKLSTLQRLTFIKDA NSMTFLNYVEKIVRDNY
Sbjct: 1481 SENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNY 1540

Query: 1525 PSFNDFLEDLQPVLDVVKISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXX 1584
            PSFNDF++DL+PVLDVVK+S+EQLISDC EFSQSI NVERS++IGNL+DSSKFH      
Sbjct: 1541 PSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVL 1600

Query: 1585 XXXXXXXXEASKRVELLDEEVKLSIMEFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYK 1644
                    EA+K+  LL +EVKL+IMEFE+LM++YGED                 I EYK
Sbjct: 1601 TKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGDKFAKNSFFKKFADFITEYK 1660

Query: 1645 RAQAQNLKAEEEERLYQTHKKMVXXXXXXXXXXXXXXNATEEDASEENEDRRAMMDKLLE 1704
            +AQ+QNLK EEEER Y+ HK+M+                 E +  EE  DRRAMMDKLLE
Sbjct: 1661 KAQSQNLKQEEEERAYEKHKRMIEEQQHKQDLEEERSREVEGEPGEEQSDRRAMMDKLLE 1720

Query: 1705 QLKNAGPVKADPLSARKRAMIRKKMLNDSEAVSDVLDSIQQEDDSMIYSPE--KQEGITN 1762
            +LKNAGP KADP SARKRA++RKK+L D E  + +L  I   DDS++YSP    QEG  +
Sbjct: 1721 KLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGPND 1780

Query: 1763 -------PTGDS-----SQSPSK-GAANNQQDEEEITDRAKALLMGLRGGESPSKRNNVL 1809
                   P+G S     S SP+K   A+   ++E I+DRAKALL+ LRG E+  KRN+ L
Sbjct: 1781 IHLASPTPSGKSDLVLASVSPTKESTADGIAEDEFISDRAKALLLELRGSEN-MKRNSQL 1839

Query: 1810 NGHKEKLRAR--RRKTNTDMSPEGSFLFNEEVRGTISSADTDYSNEQQSNSEANTLTKSI 1867
               KEKL+AR  RR+T T+        F +E                +S+S + + +K  
Sbjct: 1840 EEQKEKLKARRSRRRTQTESISSNKLFFTDE----------------ESHSTSPSESKGT 1883

Query: 1868 RSTLTEENDDPE 1879
               +T  N++PE
Sbjct: 1884 EYEMTTANEEPE 1895

 Score =  125 bits (315), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 96/168 (57%), Gaps = 12/168 (7%)

Query: 66  ANDLRPLNKKSTMNTQNLSHYMNG----KSSAESLSSN---HSRSPSVQXXXXXXXXXXX 118
           + +LRPLNKKST+NTQNLS Y++G    + +   L +N   H+R+ S Q           
Sbjct: 59  STELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYSYSRRS 118

Query: 119 XXHLSTPGVNSTLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIKLDMP-SSHEVENL 177
               ST      L+R+ T Q                  ++  DGKI L+MP   HEVE L
Sbjct: 119 ----STATGPIKLSRQQTTQSLGSSSVLSQGSYTNLLKYIDSDGKINLEMPRDPHEVEAL 174

Query: 178 FEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAK 225
           FED+MYKRNI Q L  DKQKELM YDV KKW +VKQDLQN+ KKL++K
Sbjct: 175 FEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSK 222

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/873 (51%), Positives = 591/873 (67%), Gaps = 51/873 (5%)

Query: 297  TLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLT 356
            T  T+K NR PI YVK+II+D LT  EM DLWVTLRTEQLDWVD F+EHQGHIAMANVL 
Sbjct: 328  TTLTDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLM 387

Query: 357  TSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRLA 416
             SIYKT P   L+  LLEKE++FF+CFRVLS+L+QGL E ++H +MA+T+A GLFS  L+
Sbjct: 388  KSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLS 447

Query: 417  TRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQF 476
            TRKMATEIFVCML KKN  RF+ +LN LD+KFKIG+NLHM H +K   ++F   T DS  
Sbjct: 448  TRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNL 507

Query: 477  KIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVI 536
            K+ ++WLFAVE SL+GRGKMGS VGAS+D+K SGGENA LEY QW+M+FINH C  +D I
Sbjct: 508  KVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNI 567

Query: 537  NQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDM 596
            NQR+LLR +LE  G +RIMNQ K L Y+KV+E ++ YEN KLDD+N +LE     ++I++
Sbjct: 568  NQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINL 627

Query: 597  NDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTN 656
            +D  SL+K L+D CKGTE+EKLL SLV+HLFLS+S+L+ED QD T+LSKQL+LMDSLVTN
Sbjct: 628  HDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTN 687

Query: 657  VSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKT 716
            VSV++ D+ S++NMAIQRLYD+MQTDEVARR+ILESRTLTKKLEE+QAE D LSQKL   
Sbjct: 688  VSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNA 747

Query: 717  GNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXXXXXXXMLTILNS 776
             +GLVGQL+ E++QRD +  KNQR+T QLQ                       MLTILN+
Sbjct: 748  EHGLVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKHEQEVELRKMLTILNA 807

Query: 777  RPE-GDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKRFGITVQPNK 835
            R + G++ +K S   K  PG  +  KK  IQ+ LQ+GL +TKKD ++DSK FG+TVQPNK
Sbjct: 808  RSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNK 867

Query: 836  RLKMLRLQMEDIEQEARELEMTNFADHNKAVLQ-APVKVESSNYVRKENELRAKELKANK 894
            RLK LR+QMEDIE EARELEMTNFA+  K  L+ AP   +     + +NE + ++ K  K
Sbjct: 868  RLKALRMQMEDIENEARELEMTNFAEFEKKKLEPAPKIKKLKQKKQNKNEKKEEDDKIKK 927

Query: 895  LSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGIDLSTHF 954
            L+ELR+ LA+IQ ESN +SKFNVEERVNELF +K+ +AL RL +LE  YK++GI+    F
Sbjct: 928  LNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGIN----F 983

Query: 955  PIQDEPQESAESEKNAEGP---STLDPRAYQAKLDEIDRISKELIEMKSELKNDKALRRH 1011
             I D  +++   + + +     S+LDP AYQ KLDE++RI+++L++ +++L N+K L+  
Sbjct: 984  NIDDISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQLLDAQAKL-NEKNLKDS 1042

Query: 1012 ESPS-----------------------KQDTDDDEIQDTGSMVNEDXXXXXXXXXXXXXX 1048
             + S                       +++ DD + +D  S ++                
Sbjct: 1043 SNKSTFSESSSSSSSSSSSSSSSSSSDEEEIDDIKSRDRQSEISAQSTSSAAGSFLEALS 1102

Query: 1049 QKYGTGKNATNMLTNDILNSSERKGHSRQSFMERMKKPSGVPAYLEELPLKVPKAPPLGV 1108
            QKY  G+N  +    D          S+  F+ R++K +  P +LEEL  KV   P  G+
Sbjct: 1103 QKYAMGQNNPSSPQRD-----RPVKASQYDFINRVRKNNITPQFLEELSGKVV-PPSSGL 1156

Query: 1109 AET------------EDSSDNIAEDVEKESAEH 1129
            + T            E +++N+ E+  +   EH
Sbjct: 1157 STTTKVVDVTSGGKSETATENVLENTTEPVTEH 1189

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/583 (60%), Positives = 436/583 (74%), Gaps = 27/583 (4%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R  KKLKQLHWEK++ATDNSIW + KAE+FA DLYEKGVL +LE AFAAREIKSLA+K++
Sbjct: 1351 RPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSLASKQK 1410

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            +DL KITFLS DVSQQFGINLHMY+ L V +L+TKILKC+RDF+ TPSV+EFLS+PEI++
Sbjct: 1411 KDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRPEIVD 1470

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS NLARNY+PY  DW+G+  VEDAK PEK+P ELQRADQ+YLQL+ NLQ YWGSRMRAL
Sbjct: 1471 VSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGSRMRAL 1530

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
            +VIT++E+EY+EL+TKLRKVD+AV+ +Q+S NL+NVF VILAVGNYMND++KQAQGFKL+
Sbjct: 1531 KVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQGFKLA 1590

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD+ N+MTFLNYVEKIVR NYP+FN FL +L+PVLDVVKISIEQL+ DCKEF
Sbjct: 1591 TLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVDDCKEF 1650

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
            SQSI NVERSI+IGNL+DSSKFH              +A K+ ELL +EVKL+IMEF  L
Sbjct: 1651 SQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIMEFLRL 1710

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            MQ YGED                 I EYK+AQ QNL+ EEEE++Y+ HKKMV        
Sbjct: 1711 MQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQNLRLEEEEKVYERHKKMVEEQQRKAQ 1770

Query: 1676 XXXXXXNATEEDASEENE----DRRAMMDKLLEQLKNAGPV-KADPLSARKRAMIRKKML 1730
                    +  D ++++E    D RA+MD LLEQLKN  P  K DP SARKRA++RKK++
Sbjct: 1771 EAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRALVRKKLM 1830

Query: 1731 NDSEAVSDVLDSIQQEDDSMIYSP-----------------EKQEGITNPTGDSSQSPSK 1773
               E+ S++L  I  EDDS+IYSP                 E +  +++PT  +S SP K
Sbjct: 1831 --GESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMANTTLESELDVSSPTRHNS-SPIK 1887

Query: 1774 G--AANNQQDEEEITDRAKALLMGLRGGESPSKRNNVLNGHKE 1814
               + N  ++EEEI +RA+ALL+ L G  SP+KR+++LN HKE
Sbjct: 1888 NEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLLNEHKE 1930

 Score =  124 bits (310), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 89/243 (36%), Positives = 125/243 (51%), Gaps = 17/243 (6%)

Query: 1   MLKGSHSK--GSQGNGSDSRDSNTGSGLLSNLKRFAXXXXXXXXXXRIETSDIXXXXXXX 58
           ML+ S +K   +Q  G+ +  + +GS L  NLKRFA             TS+        
Sbjct: 1   MLRNSSNKHNANQEQGTKNNATTSGSNLFQNLKRFATNSTGSSNNTSPRTSNSSEPSQVK 60

Query: 59  -------XXXXXXNANDLRPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQXXXX 111
                        ++N+++PL K +T+NTQNLS Y+N K+  +     HSRS S+Q    
Sbjct: 61  RESIPQGSTSSLHSSNEIKPLIKNTTLNTQNLSQYINSKNIPD-----HSRSQSIQSSSK 115

Query: 112 XXXXXXXXXHLSTPGVNS-TLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIKLDMPS 170
                      + P V    L R+ TNQ                  FMT DGK+ L+MP+
Sbjct: 116 YSYSSRRASSQTNPSVTGYKLDRQYTNQSSAVSVLSQGSYSNLSK-FMTHDGKLNLEMPT 174

Query: 171 -SHEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAKGVPA 229
              E+E L++++M KRNILQ+L   KQ ELM YD+ KKWLIVKQDLQN++KK  +KG  A
Sbjct: 175 DPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSKGAKA 234

Query: 230 AHA 232
           +H+
Sbjct: 235 SHS 237

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/843 (49%), Positives = 570/843 (67%), Gaps = 52/843 (6%)

Query: 293  SSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMA 352
            SS+STL ++K NR PIHYVK+IIAD+L+ +E+NDLWVTLRTEQLDWVD FL++QGHIAMA
Sbjct: 404  SSSSTLASDKTNRLPIHYVKKIIADQLSQDELNDLWVTLRTEQLDWVDAFLDNQGHIAMA 463

Query: 353  NVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLFS 412
            NVL  S+YKT P   LS  LL+KE ++F+CF+VLS+L QGL E + H ++ +T+A GLFS
Sbjct: 464  NVLMKSLYKTSPNVSLSGPLLDKEQSYFKCFKVLSMLAQGLREFTDHRLITDTIARGLFS 523

Query: 413  VRLATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSPQHFSHFTR 472
             RL TRKMATEIFVCMLE KN+ RF+AV+ +LD+ F+IG N HM++ ++  P +F H   
Sbjct: 524  SRLPTRKMATEIFVCMLETKNQTRFDAVITSLDQNFQIGSNAHMVNNLQKMPDYFIHLNL 583

Query: 473  DSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNG 532
             S  K+VQ+WLFA++Q+L+GRGKMGSLVGAS++FK   GEN++LEY QWT+VF+N FC  
Sbjct: 584  QSTLKVVQAWLFAIDQTLDGRGKMGSLVGASDEFKRIDGENSVLEYCQWTLVFVNKFCQS 643

Query: 533  TDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHAS 592
            ++ +NQR+LLRT+LENAG LRIMN+ KLLDY+K+ + +E YE  KLDD NS+LE+    +
Sbjct: 644  SNNLNQRMLLRTKLENAGFLRIMNKMKLLDYEKIRDQIEFYEAGKLDDFNSLLESQNKHA 703

Query: 593  DIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDS 652
            +IDM +  SLL+ L+D C+GT+SE LL SLV+HLFLS++RL+++N+DPT+L+KQL+L+DS
Sbjct: 704  NIDMQNPLSLLQNLWDACRGTDSENLLVSLVQHLFLSSTRLIQNNKDPTQLAKQLKLIDS 763

Query: 653  LVTNV--SVSAV-DESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFL 709
            LVTNV  SVSAV DE ++++M IQRL+DSMQTDEVARRAI+ESRTLTKK+EE QAE+D L
Sbjct: 764  LVTNVGSSVSAVADEETTMSMTIQRLFDSMQTDEVARRAIIESRTLTKKMEELQAEKDRL 823

Query: 710  SQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXXXXXXX 769
              KLSK   GLVG+L++++++RD IL KNQRV  QL++                      
Sbjct: 824  GDKLSKAEGGLVGELQRDIRERDAILAKNQRVNKQLENELEELKRKTLMEKHEHEVELRK 883

Query: 770  MLTILNSRPEGDLSRKGSV-----HSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDS 824
            MLTI+NS+   +L++  S      H       L  +++S IQ+ LQDGL +TKKD + D+
Sbjct: 884  MLTIINSKASPNLAQNPSASVLKSHDPKNKESLLSEQQSKIQKVLQDGLTRTKKDFTNDA 943

Query: 825  KRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNK----AVLQA----------- 869
            K+FG+TVQPNKRL++LR+++EDIE EAR+LEMTNFAD  K     +L             
Sbjct: 944  KKFGMTVQPNKRLQLLRMKVEDIENEARQLEMTNFADIEKNATPVILTKGTKKKKSKKKL 1003

Query: 870  ----PVKVESSNYVRKENELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELF 925
                P K + +N  R EN+      K   L++LR AL  IQ ESN +SKFNVEE VNELF
Sbjct: 1004 KTAQPDKKQRANQ-RNENQ------KIEALNKLRMALTAIQSESNDISKFNVEEHVNELF 1056

Query: 926  KQKKLSALDRLNDLENMYKEYGIDLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQAKL 985
             ++K  AL RL DLE+ +      L+T+F I D    + ++    +   +LDPR    KL
Sbjct: 1057 TERKFKALQRLRDLESKFN----GLNTNFNIDDIIASTEKALTATDDGYSLDPRRADNKL 1112

Query: 986  DEIDRISKELIEMKSELKNDK--ALRRHESPSKQDTDDDEIQDTGSMVNEDXXXXXXXXX 1043
            DEI+R++ +L ++   +K  +   L+   S    D++  E  + GS V  D         
Sbjct: 1113 DEIERLTNDLSKLHDSMKEQEQATLQSDNSSESSDSESVESDNEGSTVQSDVSEPTVGSG 1172

Query: 1044 X--XXXXQKYGTGKNATNMLTNDILNSSERKGHSRQSFMERMKKPSGVPAYLEELPLKVP 1101
                   QKY TG+   N               ++++FM R+K+ SG P YL+EL  K+P
Sbjct: 1173 SFLASLSQKYETGQKQPNSPVT----------VNQKAFMTRLKRSSGAPLYLQELSKKIP 1222

Query: 1102 KAP 1104
            + P
Sbjct: 1223 QRP 1225

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/576 (62%), Positives = 440/576 (76%), Gaps = 22/576 (3%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R +KKLKQLHWEKLD+T+NSIWS+ KAEKFA DLYEKGVL +LEKAFAARE+KSL++KK 
Sbjct: 1378 RPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSNLEKAFAAREVKSLSSKKG 1437

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            +D  KITFL+RDVSQQFGINLHM+  LSVEELVTKILKC+R+ +++PSV+EFLSK E++E
Sbjct: 1438 DD-SKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDREVLNSPSVIEFLSKQEVVE 1496

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS NLARNYSPYSTDW+GV ++EDAK+PEKDP ELQRADQLY+ L+ NLQPYW SRMRAL
Sbjct: 1497 VSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQLYMSLMVNLQPYWSSRMRAL 1556

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
            +VIT+YEREY+EL+ KLRKVDKAV  +Q+S NL+NV NVILAVGNYMND++KQAQGFKL+
Sbjct: 1557 KVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVILAVGNYMNDTSKQAQGFKLA 1616

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD  NSMTFLNYVEKIVR NYP+FNDFL +LQPVLDVVKISI+QL+SDC+EF
Sbjct: 1617 TLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQPVLDVVKISIDQLVSDCQEF 1676

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
            S S+ NVERSI+IGNL+DSSKFH              EA K+ +LL +EVKL+++EF +L
Sbjct: 1677 SGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARKKADLLTDEVKLTMLEFNNL 1736

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            MQ YGED                 I EYK+AQ QN+ AEEEE+ Y+ HKK+V        
Sbjct: 1737 MQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEEEQQYERHKKIVEEQQRQGE 1796

Query: 1676 XXXXXXNATEEDAS---------EENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIR 1726
                   +   DA+         +E +DRRA+MDKLLEQLKNAG VKADP SARKRA+ R
Sbjct: 1797 EARKRLESASPDATNGEDTTAVDDETKDRRAIMDKLLEQLKNAGTVKADPSSARKRALAR 1856

Query: 1727 KKMLNDSEAVSDVLDSIQQEDDSMIYSPE-KQEGITNPTGDS--------SQSPSK--GA 1775
            +K+L D +A S +L  I  +DDS++YSP+ K++ + +  G S          +P+K   +
Sbjct: 1857 RKLLGDKDAASALLHDIDTDDDSLVYSPDTKRQSVGHLIGGSPTPGDKLLGSTPTKELSS 1916

Query: 1776 ANNQQDEEEITDRAKALLMGLRGGE-SPSKRNNVLN 1810
                QD+E++TDRAKALLM LRGG+ SP K+N  L+
Sbjct: 1917 PTAGQDDEDVTDRAKALLMELRGGQSSPMKKNAFLD 1952

 Score =  117 bits (292), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 91/161 (56%), Gaps = 5/161 (3%)

Query: 70  RPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQXXXXXXXXXXXXXHLSTPGVNS 129
           +PL+KK+TMN+QNLSHY +G S+  S       SP                + S    +S
Sbjct: 152 KPLSKKATMNSQNLSHYTSGVSATSSDGDGGMASPEYTHSRTQSGQTSRFSYTSPSRRSS 211

Query: 130 T---LTREPTNQXXXXXXXXXXXXXXXXAIFMTP-DGKIKLDMPS-SHEVENLFEDMMYK 184
           +   L +  T Q                  F++P DGK++L+MP    EVE L+ED+MYK
Sbjct: 212 SDAKLAKYHTAQSSQNSIASQGSLSTLYNRFISPEDGKLRLEMPDDPAEVELLYEDIMYK 271

Query: 185 RNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAK 225
           RNILQNL  DKQ ELM+YDV KKWLIVKQDLQN+ KKL  K
Sbjct: 272 RNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKLKTK 312

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/871 (49%), Positives = 570/871 (65%), Gaps = 48/871 (5%)

Query: 292  NSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAM 351
            N+  S L+ ++ NR P  Y+K I+ D+L+ +EMNDLWVTLRTEQL WV+ FLE QGHIAM
Sbjct: 407  NNKASALSPDRTNRLPNDYIKEILNDRLSVDEMNDLWVTLRTEQLTWVNTFLEDQGHIAM 466

Query: 352  ANVLTTSIYKTDP-ETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGL 410
            AN L  SIY+ +  +  LS  L++KE+ FF+CFRVLS+L+QGL E  +H +M +T+  GL
Sbjct: 467  ANSLMKSIYRINTMQNSLSTYLIDKEYNFFKCFRVLSMLSQGLTEFIKHKLMTDTLVQGL 526

Query: 411  FSVRLATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSPQ--HFS 468
            FS RLATRK+ATEIFV ML+K N      +L   DK F I ENL+M++ +KN P   H+ 
Sbjct: 527  FSTRLATRKIATEIFVLMLQKINDDGLNILLTTFDKTFSINENLNMVYLLKNVPDKYHYL 586

Query: 469  HFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINH 528
            + T  +Q K++ SWL+AVE +L+GRGKMGSLVGAS+DFK +GGENAILEY QWTMV IN 
Sbjct: 587  NSTNTTQIKVLVSWLYAVESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVLINR 646

Query: 529  FCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETG 588
             CN + +INQR+LLRT+LEN G +RIMN+ K LDY+K+ E +E YEN KLDDLN++LE  
Sbjct: 647  LCNASTIINQRVLLRTKLENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLLEQD 706

Query: 589  AHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLR 648
              +S +D+++  SLL  L + CK TE E+ L S+++HL+LS+S+L +D  DPTKLSKQL+
Sbjct: 707  TKSS-VDLDNPISLLSHLLEVCKDTEGEQSLTSIIQHLYLSSSKLFDDKDDPTKLSKQLK 765

Query: 649  LMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDF 708
            LMDSL+T+ ++S VD  S +NMAIQ LYDSM TD+VARRAILESR LTKKLEE QAERDF
Sbjct: 766  LMDSLMTDATLSTVDNESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQAERDF 825

Query: 709  LSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXXXXXX 768
            LS +LS+  NGLVG+LE E+ QRD IL KNQRVT QL+                      
Sbjct: 826  LSNRLSEAENGLVGKLENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHEVELR 885

Query: 769  XMLTILNSRPEGDLSRKGSVHSKAQPGILDPDK------KSTIQQALQDGLLKTKKDLSV 822
             MLTILNSRPE +L    S  S+ +    + +K      K  I++ALQDGL KTKKDLS+
Sbjct: 886  KMLTILNSRPETELDNTMSSISRTKRNKHEIEKLELLKRKKVIEKALQDGLQKTKKDLSL 945

Query: 823  DSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNY---- 878
            DSKRFGITVQPNKRL+ LRLQMEDIE EAR+LEMTNF D  +   +   K +S N     
Sbjct: 946  DSKRFGITVQPNKRLQALRLQMEDIENEARQLEMTNFTDPVRTPKKGQEKRDSHNKHPSL 1005

Query: 879  -----VRKENELRAKEL--KANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLS 931
                 + K+N+ R++E+  K  KL+ELRKALADIQ+E+N +S+FNVEE VNELF  KK+ 
Sbjct: 1006 KPGIPIAKKNKDRSEEMAKKQQKLAELRKALADIQQETNDISRFNVEEHVNELFNAKKIQ 1065

Query: 932  ALDRLNDLENMYKEYGIDLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRI 991
            A++RL +LE MY+ +G+D +    ++     + E + ++    TLDP  +  K+DE+D+ 
Sbjct: 1066 AMERLKELETMYQNFGVDFNMEEFLEKNNTSTKELDPDSPAYETLDPNLFIDKMDELDKF 1125

Query: 992  SKELIEMKSELKNDKALRRHE---SPSKQ----------DTDDDE----------IQDTG 1028
            S +L ++ S+L N  + +++    + S Q          D + DE          + D  
Sbjct: 1126 SMKLDQLTSDLNNTMSAKQNSLSTTNSNQISTPSSTSSSDFESDEENENTALSNNVNDNS 1185

Query: 1029 SMVNEDXXXXXXXXXXXXXXQKYGTGKNATNMLTNDILNSSERKGHSRQSFMERMKKPSG 1088
            S  +                QKYGTG+NA+  ++++  N S    +  + FM RMKK   
Sbjct: 1186 STFSHQSTTSGGSSFLESLSQKYGTGQNASGPMSSNTPNVSHY--NPERKFMSRMKKQHA 1243

Query: 1089 VPAYLEELPLKVPKAPPLGVAET--EDSSDN 1117
             P Y+ EL  KV     L   ET  ED++ N
Sbjct: 1244 TPNYIRELNQKVSVTHSLSEEETDYEDAAAN 1274

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/601 (58%), Positives = 437/601 (72%), Gaps = 33/601 (5%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R++KKLKQLHWEKLD TDNSIW +GKAE+FA DL+EKGVL+ LE AFAAREIKSLA+KK+
Sbjct: 1441 RSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLESAFAAREIKSLASKKK 1500

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            ED  KIT+LSRD+SQQFGINLHM+S L+V++L+ KI++C+R  ++TPSV++FLSK EI+E
Sbjct: 1501 EDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSILNTPSVIDFLSKQEIVE 1560

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS NLAR+Y+PYSTDW+GV  V+DAK PEKDP ELQRADQ+YLQL+ NLQ YWGSRM AL
Sbjct: 1561 VSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQIYLQLMVNLQSYWGSRMIAL 1620

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
            +V+TSYE+++ EL+ KLR+VD AV  IQKS NL+NVFNVILAVGN+MND++KQAQGFKL+
Sbjct: 1621 KVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVGNFMNDASKQAQGFKLA 1680

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD+ N+MTFLNYVE I+R NYP FNDFL +LQPVLDVVK+SIEQL+ DCKEF
Sbjct: 1681 TLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLDVVKVSIEQLVRDCKEF 1740

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
            SQ I NV RS++IG L+DSSKFH              EA+K+ +LL +EVKLSIMEFE+L
Sbjct: 1741 SQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKADLLSDEVKLSIMEFENL 1800

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            MQ +GED                 INEYKRAQ QNLK EEEER+Y+ HKK +        
Sbjct: 1801 MQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERIYENHKKRIEEQQKRLE 1860

Query: 1676 XXXXXXNA-----TEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKML 1730
                  ++     T+    EE+EDRR +MDKLLEQLKN GPVK DP SARKRAM+RKK+ 
Sbjct: 1861 DSKKKSHSDDTSNTDGTEEEEDEDRRDVMDKLLEQLKNVGPVKTDPTSARKRAMVRKKLQ 1920

Query: 1731 NDSEAVSDVLDSIQQEDDSMIYSPEKQEGITNPTGDSS-QSPSKGAANNQQD-------- 1781
            N+ E  S +L   +  +DS++YSP   +       +   QSP+ G  ++  D        
Sbjct: 1921 NEKETASQILKEFETGEDSIVYSPTDSKITPKKVSNEYLQSPTPGEKSSLADMTSTPNPT 1980

Query: 1782 -------------------EEEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLRARRRK 1822
                               ++EI DRAK+LL  LRG ++P+++N+VL   KEKLRARRR 
Sbjct: 1981 TITTTTDGKVTNDSSNDDLDQEIVDRAKSLLFELRGSQTPTRKNSVLEERKEKLRARRRN 2040

Query: 1823 T 1823
            T
Sbjct: 2041 T 2041

 Score =  105 bits (263), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (84%), Gaps = 1/71 (1%)

Query: 157 FMTPDGKIKLDMPSS-HEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDL 215
           FMTPDGK+ L+MP++  EVE L+ED+MYKRNILQNL  DKQ+ELM YDV KKWLIVKQDL
Sbjct: 198 FMTPDGKVNLEMPNNPAEVEALYEDIMYKRNILQNLPADKQRELMSYDVSKKWLIVKQDL 257

Query: 216 QNDFKKLLAKG 226
           Q++ KK+ +K 
Sbjct: 258 QSELKKMRSKN 268

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/1130 (40%), Positives = 640/1130 (56%), Gaps = 71/1130 (6%)

Query: 26   LLSNLKRFAXXXXXXXXXXRIETSDIXXXXXXXXXXXXXNANDLRPLNKKSTMNTQNLSH 85
            L SNLK+            +IE SDI              +   +PL+K++T+NTQNLS 
Sbjct: 27   LFSNLKKLTGSGNNANTSNKIEPSDISSPKIVSTPAVPEFSG--KPLSKQTTLNTQNLSS 84

Query: 86   YMNGKSSAESLSSNHSRSPSVQXXX----XXXXXXXXXXHLSTPGVNSTLTREPTNQXXX 141
            Y++  +       +H+RSPS                   + +  G    L+R+ TNQ   
Sbjct: 85   YVDMNTP------HHNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQSLS 138

Query: 142  XXXXXXXXXXXXXAIFMTPDGKIKLDMPSS-HEVENLFEDMMYKRNILQNLSPDKQKELM 200
                           FM  DGK+KLD PS+  E+E+LF ++M+KRN  Q+L    QKELM
Sbjct: 139  SASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELM 198

Query: 201  DYDVDKKWLIVKQDLQNDFKKLLAKGVPAAHAAIXXXXXXXXXXXXXXXXXXXXMTYESI 260
            +YD+DKKWL+VKQDLQ++ KKL  K       A                     +     
Sbjct: 199  NYDLDKKWLLVKQDLQSELKKLANKKNTHVAPAGAAGLAATISAATQGTSGAGGVGGVDG 258

Query: 261  QQAIKFNKTXXXXXXXXXXXXXXXLQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLT 320
             QA     +                 +  ++NSST+TL+ + ++  P +YV++II+DK++
Sbjct: 259  TQA----GSKGHNSTSSPILGGGGFYESGNQNSSTATLSQDPLHLSPDYYVRKIISDKIS 314

Query: 321  GNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFF 380
              ++ DLWV+LRTEQLDWV GFL+ QG +A+ANVL    +K  P+  L+ + L+KE AFF
Sbjct: 315  TKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFF 374

Query: 381  RCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAV 440
            +C + L  L +G  E  R  ++   + +GL S+R++TR++A+E+ V + +         V
Sbjct: 375  KCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQV 434

Query: 441  LNALDKKFKIGENLHMLHYMKNSPQ--------HFSHFTRDSQFKIVQSWLFAVEQSLEG 492
            +  LD++  +  N+H+   + ++ +        H    TRD   K  + WLF VE +L+G
Sbjct: 435  IGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDG 494

Query: 493  RGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRILLRTRLENAGGL 552
            RGKMGSLVGASEDFK++GGENAILEY   T++ +N  CN    +NQR LLR+R ++ G  
Sbjct: 495  RGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLS 554

Query: 553  RIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSASLLKKLFDYCKG 612
            RIM + +LL+YDK+ E +  +E+   DD N+++ + +   ++DM +  SLL+ L++  KG
Sbjct: 555  RIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKG 614

Query: 613  TESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSVSAVDESSSINMAI 672
            T +EK L SLV+HLF+++S++ ++  DPT+ SKQL+L+DSLV+NV++S++D  SS N AI
Sbjct: 615  TGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAI 674

Query: 673  QRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRD 732
            QRLYDSMQTDEVARRAI+E+R LT+K EE +AERD+L +KLSK   GLVGQL+ E+ QRD
Sbjct: 675  QRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRD 734

Query: 733  DILEKNQRVTLQLQDXXXXXXXXXXXXXXXXXXXXXXMLTILNSRPEGDLS---RKGSVH 789
             ILEKNQRVT QLQ                       +LTILNSRP+G  +    +    
Sbjct: 735  RILEKNQRVTEQLQADLEELKKKHLLEKHEHEVELRKLLTILNSRPQGSSAVQEEEAGTA 794

Query: 790  SKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKR----FGITVQPNKRLKMLRLQME 845
            S + PG+L  D+K  IQ+ALQD L +TKKDL+ +SKR     G T++PN+RLK+LR +ME
Sbjct: 795  SSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRME 854

Query: 846  DIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKENELRA-------KELKANKLSEL 898
            DIE EARELEMTNFAD  +  ++    V +          RA       KE +  KL EL
Sbjct: 855  DIENEARELEMTNFADIQRQTVEEQTVVPALPPPAVPVLDRAPKAKKQVKEDQVRKLREL 914

Query: 899  RKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGIDLSTHFP--- 955
            R+ LA +QKESN VSKFNVEER+NELF  KKLSALDRL +LE  YK +GID     P   
Sbjct: 915  RQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQAD-PELS 973

Query: 956  --IQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMKSELKNDKALRRHES 1013
              + D P E+  ++     PS LDP+    K++E+ +I  EL   K E++N        S
Sbjct: 974  AMLSDAPPENHHAKDGQAHPS-LDPKHLSRKIEEMSKIVDELTAFKKEIENGPPSSSSSS 1032

Query: 1014 PSKQDTDDDEIQ------DTGSMVNEDXXXXXXXXXXXXXXQKYGTGKNATNMLTNDILN 1067
              ++   DD          TGS +                 QKYGTG+NA    ++  + 
Sbjct: 1033 SDEELEQDDRASIHSGNASTGSFLE-------------TLSQKYGTGQNAGPTASSRAMV 1079

Query: 1068 SSER----KGHSRQSFMERMKKPSGVPAYLEELPLKV-PKAPPLGVAETE 1112
              E     +G+ R+SFMER+KK    P +L EL  KV PK P  G  E E
Sbjct: 1080 GRESNYPGRGYHRRSFMERVKKSDAAP-FLSELTQKVAPKTPIDGAYEIE 1128

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/678 (52%), Positives = 452/678 (66%), Gaps = 44/678 (6%)

Query: 1232 KMAYRTAVXXXXXXXXXXXXXXXXRARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYE 1291
            K  YR A                 R +KKLKQLHWEK++ T NSIW   KAEK+A DLYE
Sbjct: 1288 KAMYRAATPSPLLPQSPSLFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYE 1347

Query: 1292 KGVLEDLEKAFAAREIKSLATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKI 1351
            +GVL  LEKAFAAREIK LA +++EDL+K+TFLSRDVSQQFGINLHMY+ LSV+E+V KI
Sbjct: 1348 RGVLAQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKI 1407

Query: 1352 LKCERDFMDTPSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQ 1411
            L+C++DF+ + SV++FL KPEI+EVS NLARN++PYST+W+GVS V++AK+PEKDP ELQ
Sbjct: 1408 LRCDKDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQ 1467

Query: 1412 RADQLYLQLIYNLQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNV 1471
            RADQLYL+++ NLQ YW SRMRAL+VIT+YE+EYS+L+TKLR +DKAV+ IQ S NLR+V
Sbjct: 1468 RADQLYLEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSV 1527

Query: 1472 FNVILAVGNYMNDSAKQAQGFKLSTLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFL 1531
            F VILAVGNYMNDS+KQA GFKL+TLQRLTFIKD  NSMTFLNYVEKI+R+NY  FN FL
Sbjct: 1528 FEVILAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFL 1587

Query: 1532 EDLQPVLDVVKISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXX 1591
            ++L+PVLDVVKIS+EQL +DC+EFSQ+I NVERSI++GNL+DSSKFH             
Sbjct: 1588 QELEPVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVL 1647

Query: 1592 XEASKRVELLDEEVKLSIMEFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNL 1651
             EA KR +LL +EVKL++MEF+ LMQ +GED                 I EYK+AQA N+
Sbjct: 1648 PEARKRSDLLSDEVKLTLMEFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNI 1707

Query: 1652 KAEEEERLYQTHKKMVXXXXXXXXXXXXXXNATE----EDASEENEDRRAMMDKLLEQLK 1707
            K EEEER Y+  KKMV                 +    E  +  +   R +MDKLLE+LK
Sbjct: 1708 KMEEEERAYERRKKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLK 1767

Query: 1708 NAGPVKADPLSARKRAMIRKKMLNDSEAVSDVLDSIQQED-----DSMIYSPEKQEGITN 1762
            NAGP K+DP SARKRA+ RKK+L+   + +++LD+ + ++      S++YSPE      N
Sbjct: 1768 NAGPGKSDPSSARKRALARKKLLDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAAN 1827

Query: 1763 ------PTGDSS----------------QSPSKGAANNQQDEEEITDRAKALLMGLRGGE 1800
                  PT  +S                +SPSK A+   +D   + DRA+ LL  LRG E
Sbjct: 1828 AAHAESPTPKASRQGSVAGSGATATPLLESPSKQASAGPED---VADRARNLLKELRGPE 1884

Query: 1801 SPSKRNNVLNGHKEKLRARRRKTNTDMSPEGSFLFNEEVRGTISSADTDYSNEQQSNSEA 1860
            S  KR  +L  H+EK+RARRR+ N   S E   +F     G  S A TD           
Sbjct: 1885 S-EKRKPLLEDHREKMRARRRRVNEGASSENKLVF----VGGASEAPTD-----SHKGLP 1934

Query: 1861 NTLTKSIRSTLTEENDDP 1878
            N  T  I +T    +D+P
Sbjct: 1935 NDTTADIPATPVSADDEP 1952

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/817 (48%), Positives = 537/817 (65%), Gaps = 37/817 (4%)

Query: 299  TTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTS 358
            +++K N  PIHYV++I++D L+ NE+NDLWVTLRTEQLDWVD FLEHQGHIA+AN L   
Sbjct: 326  SSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRC 385

Query: 359  IYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRLATR 418
            IYKT P + LS +L+EKE+ FF+CFRVL++L QGLYE ++H +M +T+A GLFS R++TR
Sbjct: 386  IYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTR 445

Query: 419  KMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQFKI 478
            KMA EI V ++ KKN  RFE+V+ +LD+ F++ ENL+ML  +      FS  + D+QFKI
Sbjct: 446  KMALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKI 505

Query: 479  VQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQ 538
             Q+++ ++E +L GRGKMGS VGAS+DFK SGGENAILEY  W ++FIN  CN +D +NQ
Sbjct: 506  FQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQ 565

Query: 539  RILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDMND 598
            R++LRT+ EN GGLR+M + KL+DY+K+   VE YE+ KLDD NS+LE  + ++ I+M D
Sbjct: 566  RVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQD 625

Query: 599  SASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVS 658
              SL+  L++ CKGTE+EKLL SL++HLFLS+S+L++D ++P KLSKQL+LMDSL+TN++
Sbjct: 626  PTSLIGSLWEVCKGTENEKLLLSLMQHLFLSSSKLVDDKREPAKLSKQLKLMDSLMTNIT 685

Query: 659  VSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGN 718
             S VDE + +N+AIQRLYDSMQTD+VARRAILE+RTL+KKLEE  AE+++L +KLSK  N
Sbjct: 686  ASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAEN 745

Query: 719  GLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXXXXXXXMLTILNSRP 778
            GLVGQLE E++QRD+IL K+QRVT QLQ                       +LTI+N+  
Sbjct: 746  GLVGQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHEVELRKILTIVNTNT 805

Query: 779  EGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKRFGITVQPNKRLK 838
            + D S   S            DKK  IQ+AL+  L +TKKDL+ D K+FGI+VQPNKRL+
Sbjct: 806  DADASLNNS-----------SDKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLR 854

Query: 839  MLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKV---------------ESSNYVRKEN 883
            MLRLQMEDIE+EARELEMTNF++H K  L++P  +               +SS    + N
Sbjct: 855  MLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNKTKKETKKKSKKKSKSSKSKEENN 914

Query: 884  ELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMY 943
              RA  +K  KL ELR+ LA IQ E+N VSKFNV++RVNELFK+KK  AL+RL  LE  Y
Sbjct: 915  RKRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKY 974

Query: 944  KEYGIDLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMKSELK 1003
            K + ID    F   D  Q   +S  + E   +LDP     K+ +IDRI+ EL     +  
Sbjct: 975  KSFEID----FDPNDFKQAQLDSNASYE---SLDPNFVTKKITDIDRIADELDAFSGDGT 1027

Query: 1004 NDKALRRHESPSKQDTDDDEIQDTGSMVNEDXXXXXXXXXXXXXXQKYGTGKNATNMLTN 1063
            +  +        K   + + +   G                    +KYGT +N      +
Sbjct: 1028 SSYSSSSLSDSEKNYYESNAVPTIGPQ----KGLIDGSSFLESLSEKYGTAQNTEGTSLS 1083

Query: 1064 DILNSSERKGHSRQSFMERMKKPSGVPAYLEELPLKV 1100
             +   +       +SFM R K+      +LEEL  KV
Sbjct: 1084 PLSPQNRIASLGEKSFMNRFKRKPSSMQFLEELSQKV 1120

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/607 (57%), Positives = 435/607 (71%), Gaps = 46/607 (7%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R +KKLKQLHW+KLD ++ SIWSS  AE+FA DLYEKGVL +LEKAFAAREIKSLA KK+
Sbjct: 1265 RPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLEKAFAAREIKSLANKKK 1324

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            EDLDKI+FLSRD+SQQFGINLHM+  L+V+ELV KILKC RD M+TPSV+EFLSKPEI +
Sbjct: 1325 EDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKPEITD 1384

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS NLARNY+PY TDW+GV  VEDAK+PEK    LQRADQ+Y+QL+ NLQ YW SRMRA+
Sbjct: 1385 VSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPSRMRAI 1444

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
            +VITSYE+EY+ELVTKLR++D AV+ IQKS NL N+FNVILAVGNYMNDS+KQAQGFKL+
Sbjct: 1445 KVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQGFKLN 1504

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD+ NSMTFLNYVEKI+R+NYP FN F+E+L+PVLDVVKIS+EQL++DC EF
Sbjct: 1505 TLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVNDCNEF 1564

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
            +QSI NVERS++IGNL+DSSKFH              EA+K+ +LL +EVKL+ MEFE+L
Sbjct: 1565 TQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFMEFEAL 1624

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            MQ++GED                 INEYK+A+AQNLKAEEE R Y+ HK+MV        
Sbjct: 1625 MQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMVEEQQRKAK 1684

Query: 1676 XXXX---XXNATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLND 1732
                       ++ +++E   D R  MDKLL QLKNAGP ++DP SARKRA++RKK+L++
Sbjct: 1685 EQEKNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARSDPSSARKRAVMRKKLLSE 1744

Query: 1733 SEAVSDVLDSIQQEDDSMIYSPEKQEGITNPTGDSS---QSPSK---------------- 1773
             ++ S +LD +   D S+IYSP   + +    G+     +SP+                 
Sbjct: 1745 KDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMILKSPTPKSKDNLETDNNSDKSR 1804

Query: 1774 ------------------------GAANNQQDEEEITDRAKALLMGLRGGESPSKRNNVL 1809
                                    G +N   ++E ITDRAKALLM LRG ++PSK+N+ L
Sbjct: 1805 NDTLTVDDVEQNTDTNAETDITDDGNSNGDGEDEVITDRAKALLMELRGSQTPSKKNSHL 1864

Query: 1810 NGHKEKL 1816
            +  +EKL
Sbjct: 1865 DDQREKL 1871

 Score =  139 bits (349), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/247 (36%), Positives = 131/247 (53%), Gaps = 30/247 (12%)

Query: 1   MLKGSHSKGSQGNGSDSRDSNTGSGLLSNLKRFAXXXXXXXXXXRIETSDIXXXXXXXXX 60
           ML+GS+SK S  + S  +D++ GSGLL NLK+             I  SDI         
Sbjct: 1   MLRGSNSKSSSSSSSVGKDNSVGSGLLHNLKKLTNSSSTTSQNNAINKSDISSPKSQLLT 60

Query: 61  XXXXNANDLRPLNKKSTMNTQNLSHYMNGK-----SSAESL------------------- 96
               + +DL+PLNK++++N QNLS Y+NGK     S +  L                   
Sbjct: 61  NKL-SMDDLKPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGS 119

Query: 97  SSNHSRSPSVQXXXXXXXXXXXXXHLSTPGVNSTLTREPTNQXXXXXXXXXXXXXXXXAI 156
           S NH+RS SVQ               +     + L+R+ TN                 + 
Sbjct: 120 SPNHNRSASVQSSAKYSYSRRSSNSTAA----TRLSRQSTNFSGSTPSVFSQGSYANLSK 175

Query: 157 FMTPDGKIKLDMPS-SHEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDL 215
           +M  +G++ LDMP+ +HE+E+LFE++MYKRNILQ LSPDKQ+++M+YD  KKW+IVKQDL
Sbjct: 176 YMDSNGRLNLDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDL 235

Query: 216 QNDFKKL 222
           QN+ K++
Sbjct: 236 QNELKRI 242

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/578 (57%), Positives = 426/578 (73%), Gaps = 13/578 (2%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R  KKLKQLHWEK+D  ++SIW + KAE+FA DLYEKG+L  LEKAFAAREIKSL ++K+
Sbjct: 1320 RPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGILSRLEKAFAAREIKSLTSRKK 1379

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            +D DK+TFLSRDVSQQFGINLHMYS LSVEE+VTKILKC++DF+ TPSV+EFLSK EI+E
Sbjct: 1380 KDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCDKDFLTTPSVIEFLSKQEIVE 1439

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS NLARN++PY+TDW+G++ V+DAK PEKDP+ELQRAD+LYL+L  NLQ YW SRMRAL
Sbjct: 1440 VSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADRLYLELFVNLQGYWSSRMRAL 1499

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
            +VITSYE+EYS+L+ KLR +DKA   IQ+S NLRNV +VILAVGN+MNDS+KQAQGF+L+
Sbjct: 1500 KVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRLA 1559

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD  NSMTFLNYVEKIVR+ YP FN FL++L+PV+  VKISIEQ+  DCKEF
Sbjct: 1560 TLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELEPVVAAVKISIEQVSQDCKEF 1619

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
            SQS+ NVERS+DIGNL+DSSKFH              EA K+ +LL +E+KL+++EF++L
Sbjct: 1620 SQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEARKKGDLLMDEMKLTLLEFDNL 1679

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            M+ +GED                 + EYK+AQ  N+K EEEE+ Y+  KKMV        
Sbjct: 1680 MKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEEEEKAYERRKKMVEEQQRRAR 1739

Query: 1676 XXXXXXNATEEDASEEN--EDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLNDS 1733
                  N+ + +A +       R +MD+LLE+LKNAGP K+DP SARKRA+ R+K+L  S
Sbjct: 1740 ESNEQENSVDGNADDNTAASGDRDVMDRLLEKLKNAGPGKSDPSSARKRAIARRKLLQGS 1799

Query: 1734 EAVSDVLDSIQ---QEDDSMIYSPEKQEGITN-----PTGDSSQSPSKGAANNQQDEE-- 1783
             + S +LD+ +    E  S++YSPE Q  ++N     PT D  +   +  A+  Q  E  
Sbjct: 1800 SSNSTILDNFEIEKPEGKSLVYSPE-QVTLSNSVDHSPTPDVRKREGQSTASEVQTSESS 1858

Query: 1784 EITDRAKALLMGLRGGESPSKRNNVLNGHKEKLRARRR 1821
            ++TDRA+ LL+ LRG ESPS+R +  +    KLRARR+
Sbjct: 1859 DLTDRARNLLIELRGPESPSRRASSKDQRISKLRARRK 1896

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/1133 (36%), Positives = 621/1133 (54%), Gaps = 79/1133 (6%)

Query: 13   NGSDSRDSNTGSGLLSNLKRFA--XXXXXXXXXXRIETSDIXXXXXXXXXXXXXNANDLR 70
            N S S  S  G G+ SNLKR              +++ SDI              ++  +
Sbjct: 15   NRSASNGSGNG-GIFSNLKRLTGNANNSSSQTLQKVDISDISSPKKINLPDTGEFSH--K 71

Query: 71   PLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQXXXXXXXXXXXXXHLSTPGVNST 130
            PL+K+ST+N  NLS Y +  S+    SS  S S   +               + P  ++ 
Sbjct: 72   PLSKQSTLNIANLSAYTDVASTHNRSSSAASNSSPTKYSYSRRASQWSSNGGTAP--STK 129

Query: 131  LTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIKLDMP-SSHEVENLFEDMMYKRNILQ 189
            L+R+ TNQ                + F+ PDG I+L+ P    E+E LFE+++YKRN+ Q
Sbjct: 130  LSRQQTNQSISSASIFSQGSFSNLSKFVGPDGSIRLEKPRDPREIEELFEEVLYKRNVYQ 189

Query: 190  NLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLL-----AKGVPAAHAAIXXXXXXXXXX 244
            +L P  QKEL +YD++KKWL+V+QDLQ++ KK +     +K   AA   I          
Sbjct: 190  SLPPSAQKELNNYDLEKKWLMVRQDLQSEVKKFMNNKSVSKSPAAASTGISLIAPESPST 249

Query: 245  XXXXXXXXXXMTYESIQQAIKFNKTXXXXXXXXXXXXXXXLQQLSDKNSSTSTLTTEKIN 304
                       +  SI +++                        ++  SST+TL+ +  +
Sbjct: 250  GHFA-------SNSSINESL----AGSSRSRAQNPGTSDQFYGSNNGTSSTTTLSQDPSH 298

Query: 305  RPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYKTDP 364
              P +YV++II + ++   +NDLWV+LRTEQLDWV GFLE QG +A+ANV+  + Y+  P
Sbjct: 299  LSPDYYVRKIICNNISAKRLNDLWVSLRTEQLDWVVGFLEAQGQVAIANVILKTCYRESP 358

Query: 365  ETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVAN---GLFSVRLATRKMA 421
            +  L  ++L+KE A+F+C +    L +G  E    N     ++    GL S+R+ATR++A
Sbjct: 359  DNLLGDEVLDKEFAYFKCLKTSLNLKEGADEAVLSNSAKIIISAIIEGLLSLRVATRRIA 418

Query: 422  TEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYM---------KNSPQH--FSHF 470
            +E+ V + +      F  V+NALD++ +  +N+H+   +         KNS +    +  
Sbjct: 419  SELLVSLSQWALPHGFTHVMNALDQESRFCDNVHLQARLLSQTSNKEIKNSLRSSLLADN 478

Query: 471  TRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFC 530
              D   +  + W+  VE +L+GRGKMGSLVGASEDF+ SGGENAI+EY+  T++ +NH C
Sbjct: 479  NGDRIMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLVNHLC 538

Query: 531  NGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAH 590
                 + QR +LR RL+NAG  RI+N+ K L+Y+KV E +  +E+   DD +++   G +
Sbjct: 539  QTPVDVKQRTILRARLKNAGLPRILNKMKRLNYEKVDEQLAIFEDSTTDDFDTLYSQGPN 598

Query: 591  ASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRL-MEDNQDPTKLSKQLRL 649
               I+M D  S+ + L+D CKGTE+E+ L SL+++L +ST  L     +DP + +KQL+L
Sbjct: 599  GELINMQDPVSMTQNLWDLCKGTEAEEHLMSLLQNLLISTGELGGTSKEDPAQRTKQLKL 658

Query: 650  MDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFL 709
            +D+LV+NVS+++VD  SS N AIQRLYD+MQTDE+ARRAILE+R   K+ EE +AER+ L
Sbjct: 659  IDALVSNVSMASVDLQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAERNNL 718

Query: 710  SQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXXXXXXX 769
             +KLS    GLVGQL++E++QRD ILEK+QRVT QLQ                       
Sbjct: 719  KEKLSNAEGGLVGQLQEELKQRDHILEKSQRVTAQLQHELDESKKKLILAKHQHEVELRK 778

Query: 770  MLTILNSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKRFGI 829
             LT LNS+  GD+          QP  L P++   IQ+ALQ  L KT K+++V+S R G+
Sbjct: 779  TLTALNSKG-GDIQL---TEDGGQPKPLKPERMLAIQRALQIKLEKTSKEITVESSRLGV 834

Query: 830  TVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNK-AVLQAPVKVESSNYVRKENELRAK 888
            +++PNKRL++LR +ME+IE +ARELEMTNF+++ + A  +  +  E ++    + ++   
Sbjct: 835  SLEPNKRLRLLRSRMEEIENQARELEMTNFSEYREDADKEIEMAHEGTHMYPSDVDVGTT 894

Query: 889  ELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGI 948
            +    KL +LR+ LA +Q ESN +SKFNVE R +E+F  +K+ ALDRL  LEN Y  +GI
Sbjct: 895  QDSNLKLEQLRRKLASLQNESNDISKFNVEGRFHEMFSDQKIQALDRLKKLENDYSGFGI 954

Query: 949  DLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMKSELKNDKA- 1007
            +    +   + P    E  ++     TLDP+     +DE            S+L+ D+A 
Sbjct: 955  N----YDPAESPSLKQEQGQDVNKSRTLDPKGPNNSVDE------------SQLETDRAN 998

Query: 1008 LRRHESPSKQDTDDDEIQDTGSMVNEDXXXXXXXXXXXXXXQKYGTGK-NATNMLTNDIL 1066
                 SP+ +  +++++  T S   E               QKYG G+ N +N   N ++
Sbjct: 999  ASIDSSPASESLEEEDVHLTKSTTEE-----IGGSFLERLSQKYGKGQANLSNR--NSVV 1051

Query: 1067 ---NSSERKGHSRQSFMERMKKPSGVPAYLEELPLKVPKAPPLGVAETEDSSD 1116
               NS    G+ R+SFM R+KK   VP YLEEL  K       G A  E+ S+
Sbjct: 1052 GRENSYPGSGYHRKSFMNRVKKSDNVP-YLEELSGK------FGTATHENESE 1097

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/1067 (37%), Positives = 601/1067 (56%), Gaps = 40/1067 (3%)

Query: 70   RPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQXXXXXXXXXXXXXHLSTPGVNS 129
            +PL+K+ST+N  +LS Y +   +    +SN S     +             + +  G  S
Sbjct: 72   KPLSKQSTLNMASLSAYTDAVGAHNRSASNASVGSPTKYSYSRRASQWSNNNSAVSG--S 129

Query: 130  TLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIKLDMP-SSHEVENLFEDMMYKRNIL 188
             L+R+ TNQ                + F+ PDG ++L+ P    E+E LFE+++YKRN+ 
Sbjct: 130  KLSRQQTNQSMSSASIFSQGSFSNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVY 189

Query: 189  QNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAKGVPAAHAAIXXXXXXXXXXXXXX 248
            Q+L    Q+EL +YD++KKWL+V+QDLQ++ KK +     + +A+               
Sbjct: 190  QSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMN----SKNASKSSTVVGGSSSAVPD 245

Query: 249  XXXXXXMTYESIQQAIKFNKTXXXXXXXXXXXXXXXLQQLSDKNSSTSTLTTEKINRPPI 308
                   T  S      F                      +   SST+TL+ +  +  P 
Sbjct: 246  SPSASNFT-SSTSPNGSFTGLSRPKISTSSVNTSEQFYSSNLGTSSTTTLSQDPSHLSPD 304

Query: 309  HYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYKTDPETPL 368
            +YV++II + ++   +NDLWV+LRTEQLDWV GFLE QG +A+ANV+  + Y+  P+  L
Sbjct: 305  YYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDNLL 364

Query: 369  SYDLLEKEHAFFRCFRVLSVLTQGLYELSRHN---IMAETVANGLFSVRLATRKMATEIF 425
              ++L+KE A+F+C +    L +G  E    N   I+   +  GL S+R+ATR++A+E+ 
Sbjct: 365  GDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVASELL 424

Query: 426  VCMLEKKNKVRFEAVLNALDKKFKIGENLHM-----LHYMKNSPQHFSHFT------RDS 474
            + + +      F  V++ALD++ +  +N+H+            P+  S          D 
Sbjct: 425  ISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGDGDR 484

Query: 475  QFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTD 534
              +  + W+  VE +L+GRGKMGSLVGASEDF+ SGGENAI+EY+  T++ INH C    
Sbjct: 485  VMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPV 544

Query: 535  VINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDI 594
             + QR +LR RL+NAG  RI+N+ KLL+Y+KV E +  +++   DD +++    +    +
Sbjct: 545  DVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGV 604

Query: 595  DMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQ-DPTKLSKQLRLMDSL 653
            DM D  S+ + L++ CKGT++E+ L SL+++L +ST  L   N+ DPT+ +KQL+L+D+L
Sbjct: 605  DMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDAL 664

Query: 654  VTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKL 713
            V+NVS+++VD  SS N AIQRLYD+MQTDE+ARRAILE+R   K+ EE +A+RD L +KL
Sbjct: 665  VSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKL 724

Query: 714  SKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXXXXXXXXXXXMLTI 773
            S    GLVGQL+ EV+QRD ILEK+QRV  QLQ                        LT 
Sbjct: 725  SNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKTLTA 784

Query: 774  LNSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKRFGITVQP 833
            +NS  EG  + +    S+  P  L P++K  IQ+ALQ  L KT K+++V+SKR G++++P
Sbjct: 785  MNSNFEGSHNMRDEKGSE-NPRPLRPERKLAIQKALQAKLEKTSKEINVESKRLGLSLEP 843

Query: 834  NKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAP-VKVESSNYVRKENELRAKELKA 892
            NKRLK+LR +MEDIE +ARELEMTNF+D+ K  ++ P V  E  +    E+E +A+++ A
Sbjct: 844  NKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSESEEKAQQISA 903

Query: 893  NKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGIDLST 952
             KL ELRK LA +Q+ESN +SKFNVE R +E+F  +K  ALDRL  LE  YK +GI+   
Sbjct: 904  LKLEELRKKLASLQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYKGFGINFDP 963

Query: 953  HFPI-QDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMK-SELKNDKALRR 1010
              P+ Q    +S  S+  A    TLDP+     ++E+  I   L   K +E  N+  LR 
Sbjct: 964  DSPLGQALAGKSVSSDDKAR---TLDPKEALNIVEEVSNILSGLDSSKAAEKSNETPLR- 1019

Query: 1011 HESPSKQDTDDDEIQD-TGSMVNEDXXXXXXXXXXXXXXQKYGTGKNAT---NMLTNDIL 1066
              + +  D+ +DE+ D  G  +  D              QKYG  +N+    +      +
Sbjct: 1020 --TATSSDSSEDEMDDKNGDKIAAD-STLPTSSFLESLSQKYGGAQNSLSNRHSFAGGEI 1076

Query: 1067 NSSERKGHSRQSFMERMKKPSGVPAYLEELPLKVPKAPPLGVAETED 1113
            N     G+ R+SFM R+K+   VP YL EL  K+  +  +  +E E+
Sbjct: 1077 NYPG-SGYHRKSFMNRVKRTGAVP-YLGELSGKIGSSSYIKPSEAEE 1121

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/597 (55%), Positives = 424/597 (71%), Gaps = 18/597 (3%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R  KKLKQLHWEK+D  ++SIW   KAEKFA DLYEKGVL  LEKAFAAREIKSLA++K+
Sbjct: 1337 RPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIKSLASRKK 1396

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            +D DK++FLSRDVSQQFGINLHMYS LSVEE+V+KIL+C+RDF+ TPSV++FLSK EI+E
Sbjct: 1397 KDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIVE 1456

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS NLARN++PY+ DW+GVS VE+AK PEKDP ELQRAD+LYL+L  NLQ YW SRMRAL
Sbjct: 1457 VSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMRAL 1516

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
            +VIT+YE++YS+LV KL  +DKA   IQ+S NLRNV +VILAVGN+MNDS+KQAQGF+L+
Sbjct: 1517 KVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRLA 1576

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD  NSMTFLNYVEKI+R+ YP FNDFL++L+PV+  VKISIEQ+  DC+EF
Sbjct: 1577 TLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCREF 1636

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
            SQS+ NVERS+DIGNL+D +KFH              EA K+ +LL +E+KL+++EF++L
Sbjct: 1637 SQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDNL 1696

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            M+ +GED                 + EYK+AQ  NLK EEEER Y+  KK+V        
Sbjct: 1697 MRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEEEERAYERRKKLVEDQLKRTR 1756

Query: 1676 XXXXXXNATEEDA-----SEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKML 1730
                    T +       +E NEDR  +MD+LLE+LKNAGP K+DP SARKRA+ RK++L
Sbjct: 1757 ESESKNKGTTDAGGDSVRNEVNEDRD-VMDRLLEKLKNAGPAKSDPSSARKRAVARKRLL 1815

Query: 1731 NDSEAVSDVLDSIQQEDD---SMIYSPEK-------QEGITNPTGDS--SQSPSKGAANN 1778
              S + S +LD+   ED    S++YSP+         E  T+PT +     S +   A++
Sbjct: 1816 QGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLNEADTSPTPERRVRDSNATSPASH 1875

Query: 1779 QQDEEEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLRARRRKTNTDMSPEGSFLF 1835
                 ++TDRA+ LL+ LRG ESP  + +  +    KLRARR+  ++    E    F
Sbjct: 1876 DTGSSDLTDRARNLLIELRGPESPGVKMSAQHQRLSKLRARRKNDSSSSGSENRLNF 1932

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/560 (57%), Positives = 399/560 (71%), Gaps = 15/560 (2%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R +KKLKQLHWEK+D  DNSIW + +AEKFA DLYEKGVL +LEKAFAAREIKS   +K+
Sbjct: 1372 RPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSFKGRKK 1431

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            ++ +KITFLSRD+SQQFGINLHMYS L V  +V+KILKC++DF+ T S +EFLSKPEI+E
Sbjct: 1432 DENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPEIVE 1491

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VSTN+AR+++PY+TDW+GVS VEDAKSPEKDP+ELQR+DQL+L LI NLQ YW SRMR L
Sbjct: 1492 VSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSRMRGL 1551

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
            ++IT+YE++Y++L+ KLR +DKAV  IQKS NLRNVF+VILAVGNYMND++KQAQGFKLS
Sbjct: 1552 KLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGFKLS 1611

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD  NSMTFLNYVE+IV  NYPSFN FL++L+PVL VVKISIEQL +DC EF
Sbjct: 1612 TLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLANDCNEF 1671

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
              ++TNVERS++IGNL+DSSKFH              EA K+  LL +EV+LS+MEFE+L
Sbjct: 1672 CSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLMEFENL 1731

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            M+ +GED                 I EYKRAQ  N K +EEER Y+  K M+        
Sbjct: 1732 MRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFNRKIDEEERAYERRKLMIQEQQRRAK 1791

Query: 1676 XXXXXXNATEE--DASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLNDS 1733
                    T     A   + D R +MDKLLE+LKNAGP K DP SARKRA+ RKK++   
Sbjct: 1792 LVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRALARKKLMGGR 1851

Query: 1734 EAVSDVLDSIQQEDDSMIYSPEKQEGITNPTGDSSQSPSKGAANNQQDEEEITDRAKALL 1793
            E  S +L+ +   DD    +P+ Q     P   +S SP    A          DRA+ LL
Sbjct: 1852 EG-SIILEGLDV-DDLQSAAPDVQPD--TPLRAASASPPPDPA---------ADRARHLL 1898

Query: 1794 MGLRGGESPSKRNNVLNGHK 1813
            + LR GE P  R ++L+ HK
Sbjct: 1899 LELRNGEHPESRKSMLDEHK 1918

 Score =  579 bits (1493), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 393/1049 (37%), Positives = 571/1049 (54%), Gaps = 110/1049 (10%)

Query: 6    HSK----GSQGNGSDSRDSNTGSGLLSNLKRFAXXXXXXXXXXRIETSDIXXXXXXXXXX 61
            HSK    G     + +   ++G GL SNL +            RI TSDI          
Sbjct: 10   HSKTQHAGQVAGATHANGGHSGGGLFSNLMKLTGSSGSQ----RIATSDISSPKKVTLPS 65

Query: 62   XXXNANDLRPLNKKSTMNTQNLSHYMNGKSSAESLSS-------------NHSRSPSVQX 108
               + +  +PLNK +T+N  NL       + A S S                S+  S + 
Sbjct: 66   NL-DLSGAKPLNKLNTINASNLPQVSGEVTQARSASGAALSSPSKYSYSKRSSQWASSKQ 124

Query: 109  XXXXXXXXXXXXHLSTPGV-----NSTLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGK 163
                        HL+   V     +S LTR+ TNQ                A  +  DG 
Sbjct: 125  ANHPEHDQQYPQHLNHLFVQPHPHHSALTRQMTNQSNYSASSYTSLSLLHKATDI--DGT 182

Query: 164  IKLDMPS-SHEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKL 222
            + L+ P    E+E L+++++ KRNI Q++S    +ELM Y +DKKWL+VKQDLQ ++KK+
Sbjct: 183  LTLEKPEDPQEIEELYQELLQKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKM 242

Query: 223  LAKGVPAAHAAIXXXXXXXXXXXXXXXXXXXXMTYESIQQAIKFNKTXXXXXXXXXXXXX 282
                 P++                         T ESI        +             
Sbjct: 243  KNSMPPSS-------------------------TVESIAS------SALAKSPGGSISSG 271

Query: 283  XXLQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGF 342
               + +S  ++    +  E  +  P HYV++II+D++T  E+NDLW++LRTE +DWV GF
Sbjct: 272  SITRSISQNSAKPMAVAYEPAHLSPDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGF 331

Query: 343  LEHQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIM 402
            ++ QG +A+AN L   + +   +    YD LEKE+A+++C RVL+ L +G+ E  +  ++
Sbjct: 332  IDAQGQVAIANRLLKFVQRESLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLV 391

Query: 403  AETVANGLFSVRLATRKMATEIFVCMLE----KKNKVRFEAV---LNALDKKFKIGENLH 455
              +V  GL S RL+TR++ATE  + ML     K      +A+   L ALD++ K   N+H
Sbjct: 392  ISSVVEGLLSSRLSTRRVATETLLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIH 451

Query: 456  MLHYMKNSPQHFSHFTRDSQFKIV----QSWLFAVEQSLEGRGKMGSLVGASEDFKASGG 511
            +   +  + +  S  T  + F +V    + WL+ +E +L+GRG+MGSLVGAS+D+K  GG
Sbjct: 452  LRGRLHETNKRKSLPTGRADFHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GG 509

Query: 512  ENAILEYSQWTMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVE 571
            EN +LEY  ++M+ +N  C+    + QR LLR+RL++ G  RI+ + +LL Y  +   V 
Sbjct: 510  ENTVLEYLLYSMILLNLLCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVR 569

Query: 572  AYENLKLDDLNSVLETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTS 631
             +E+  LDD N ++ +    S +DM D A+L +  +   +GTE+E  L SL++HL    S
Sbjct: 570  KFEDATLDDYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEAEGHLLSLLQHL-FLWS 628

Query: 632  RLMEDNQDPTKLSKQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILE 691
            R   + +DP +  KQL+L+D+LVTNV+ S++D  S  N AIQRLYD+MQTDEVARRAILE
Sbjct: 629  RAFAEYRDPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILE 688

Query: 692  SRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXX 751
            SR LTKK EE +AERD L+ KLS+  NGLVGQL+ EV+Q + ILEK+ RVT QL+     
Sbjct: 689  SRELTKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQLKGELHA 748

Query: 752  XXXXXXXXXXXXXXXXXXMLTILNSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQD 811
                              MLTILNS+P G+      V++ + P  L P+KK  IQ+ALQD
Sbjct: 749  LKKKHLLEKHEHEVELRKMLTILNSKPHGENGGSPEVNT-STPSPLKPEKKMAIQKALQD 807

Query: 812  GLLKTKKDLSVDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADH-------NK 864
             L +T+KDL+ DSKR      PN+RLKMLR +M+ IE+EAR LEMTNFAD        N+
Sbjct: 808  RLRQTEKDLTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFKKEPEEENE 867

Query: 865  AVLQAPVKVESSNYVRKENELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNEL 924
              L +P K++ S        LR +++K  +L+ LRK LA IQ+ESN VSKFNVEERVNEL
Sbjct: 868  PKLLSPPKIQRS--------LRGEQVK--ELAALRKRLAIIQQESNEVSKFNVEERVNEL 917

Query: 925  FKQKKLSALDRLNDLENMYKEYGIDLSTHFPIQDEPQ----ESAESEKNAEGPST----- 975
            F +KK  ALDRL DLEN YK +GID +      ++P+      A    + +GP+      
Sbjct: 918  FYEKKNKALDRLRDLENKYKGFGIDFN------EDPELMSLRLANGSVDLDGPTIDLESS 971

Query: 976  --LDPRAYQAKLDEIDRISKELIEMKSEL 1002
              LDP    AK++E+ +I   L ++K ++
Sbjct: 972  APLDPAHLDAKIEEMTKILDRLNKLKKDI 1000

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/612 (54%), Positives = 421/612 (68%), Gaps = 46/612 (7%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R +K+LKQLHWEK+D  DNSIW + +AEKFA DLYE+GVL +LEKAFAAREIKSL ++K+
Sbjct: 1405 RPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSLISRKK 1464

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
             D +K+TFLSRD+SQQFGINLHMYS L+V+++VTKILKC++DF++T S +EFLSK EI+E
Sbjct: 1465 -DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKHEIVE 1523

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            VS N+AR ++PY+TDW+GVS VE+AK PEKDP ELQRADQLYL LI NLQ YW SRMRAL
Sbjct: 1524 VSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNSRMRAL 1583

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
            ++IT+YE++Y++L+ KLR +DKAV  IQKS NLRNVF+VILAVGNYMNDS+KQAQGFKLS
Sbjct: 1584 KLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQGFKLS 1643

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD  NSMTFLNYVEKIVR NYP F+ FL++L+PVL VVKISIEQL +DC EF
Sbjct: 1644 TLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLANDCGEF 1703

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
              ++TNVERS++IGNL+DSSKFH              EA KR  LL +EV+LS+MEFESL
Sbjct: 1704 CSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLMEFESL 1763

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            M+ +GED                 I EYKRAQ  N K EEEER Y+  K M+        
Sbjct: 1764 MRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQQKRAR 1823

Query: 1676 XXXXXXNATEEDASEENE-------DRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKK 1728
                   +     S  +        D R +MD+LLE+LKNAGP KADP SARKRA+ RKK
Sbjct: 1824 KNIQIDTSFSRRGSSLSTSSISASGDDRDVMDRLLEKLKNAGPSKADPSSARKRALARKK 1883

Query: 1729 MLNDSEAVSDVLDSIQQE----------DD------SMIYSPEKQEGIT------NPTGD 1766
            +++  ++ S +LD +  E          DD      +++ SP    G T      NP  D
Sbjct: 1884 LMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEGLNPDHD 1943

Query: 1767 SSQSP---SKGAANNQQ------------DEEEITDRAKALLMGLRGGESPSK-RNNVLN 1810
               +P    KG+ ++              DE+ +T RA+ LL  LR  +  ++ R ++L+
Sbjct: 1944 LPSAPISAEKGSVSSALSHSSESPSKKILDEDAVTHRARNLLQELRSSDDHTEDRKSLLD 2003

Query: 1811 GHKEKLRARRRK 1822
             HKEK+R RR K
Sbjct: 2004 EHKEKVRQRRNK 2015

 Score =  593 bits (1530), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 411/1075 (38%), Positives = 583/1075 (54%), Gaps = 105/1075 (9%)

Query: 3    KGSHSKGSQGNGSDSRDSNTGSG-LLSNLKRFAXXXXXXXXXXRIETSDIXXXXXXXXXX 61
            KG HS  S G+G  +   N G G L SNL +            RI TSDI          
Sbjct: 12   KGQHSHFSNGHGGTNTPINGGGGGLFSNLMKLTGSSSALSQQ-RIATSDISSPKKVSIPS 70

Query: 62   XXXNANDLRPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQXXXXXXXXXXXXXH 121
               + +  +PL+K ST+NT +LS Y      A+ ++   SR+PS                
Sbjct: 71   SL-DLSTAKPLSKHSTLNTSSLSQY------ADEIA--QSRTPSGPVSLGSPSKYSYSKR 121

Query: 122  LST-PGVNS---------------TLTREPTNQXXXXXXXXXXXXXXXXAIFMTPDGKIK 165
             S   G NS               TL+R+PTNQ                      DG + 
Sbjct: 122  SSQWSGGNSNKQLLLLPQPQHSQHTLSRQPTNQSNNSDNSFSSVTLLQK--ITDSDGNLS 179

Query: 166  LDMPS-SHEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLA 224
            L+ P    E+E L+++++ KRNIL ++S    +ELM YD+DKKWL+VKQDLQ + K++  
Sbjct: 180  LEKPKYPQEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRM-K 238

Query: 225  KGVPAAHAAIXXXXXXXXXXXXXXXXXXXXMTYESIQQAIKFNKTXXXXXXXXXXXXXXX 284
              VP +  A                     M+  SI Q                      
Sbjct: 239  NNVPQSTVA-DPLSNSVHLKSPRGSFSSSNMSARSISQ--------------------NS 277

Query: 285  LQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLE 344
             +QL+        ++ +  +  P HYV++II+D++T  E+NDLWV+LRTE +DWV GF++
Sbjct: 278  AKQLA--------VSYDPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDWVIGFID 329

Query: 345  HQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAE 404
             QG +A+AN L     +   E+ L  DLLEKE A+++C RVL+ L +G+       ++  
Sbjct: 330  AQGQVAIANRLIKFAQRESLESLLDSDLLEKETAYYKCLRVLTNLREGMQAALSSKLVIS 389

Query: 405  TVANGLFSVRLATRKMATEIFVCMLE----KKNKVRFEA---VLNALDKKFKIGENLHML 457
             V  GL S+RL TR++ATE  + ML     K     F+A   VL+ALD++ K   ++H+ 
Sbjct: 390  AVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSSSIHLR 449

Query: 458  HYMKNSPQHFSHFTRDSQFKIV----QSWLFAVEQSLEGRGKMGSLVGASEDFKASGGEN 513
              +  + +  S  T  +   ++    + WL+ +E +L+GRG+MGSLVGASED+K   GEN
Sbjct: 450  GRLHETNKRRSLPTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYK--NGEN 507

Query: 514  AILEYSQWTMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAY 573
             +LEY  ++M+ IN  C+    ++QR LLR+RL++ G  R++ + +LL Y  +   V  +
Sbjct: 508  TVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKF 567

Query: 574  ENLKLDDLNSVLETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRL 633
            E+  LDD NS++ +    S +DM D  SL    +   KGTESE  L SL++HLFL +S+ 
Sbjct: 568  EDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKA 627

Query: 634  MEDNQDPTKLSKQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESR 693
              ++ DP + SKQL+L+D+LV+NV+ S++D  S  N AIQRLYD+MQTDEVARRAILESR
Sbjct: 628  FSESTDPAEGSKQLKLLDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESR 687

Query: 694  TLTKKLEEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXX 753
             LTKK EE +AERD L  KL++  +GLVGQL+ EVQQ   ILEK+ RVT QL+       
Sbjct: 688  ELTKKCEEMKAERDHLQTKLAQAQDGLVGQLQGEVQQLQRILEKSNRVTDQLKADLHDLK 747

Query: 754  XXXXXXXXXXXXXXXXMLTILNSRP---EGDLSRKGSVHSKAQPGILDPDKKSTIQQALQ 810
                            MLTILNS+P     D      +++K  P  L P+KK  IQ+ALQ
Sbjct: 748  KKHLLEKHEHEVELRKMLTILNSKPNDASNDAVSPDGINNKT-PSPLKPEKKMAIQKALQ 806

Query: 811  DGLLKTKKDLSVDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAV---- 866
            D L +T+KDL+ DS+RFG    PN+RLKMLR +M+DIE+EA  LEMTNFA+  K      
Sbjct: 807  DRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKETKVED 866

Query: 867  ---LQAPVKVESSNYVRKENELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNE 923
               LQ+P K+E +  VR E   + KEL A     LR+ LA IQ+ESN +SKFNVEERVNE
Sbjct: 867  LPRLQSPPKIERN--VRSE---KVKELAA-----LRQRLAVIQQESNEISKFNVEERVNE 916

Query: 924  LFKQKKLSALDRLNDLENMYKEYGIDLSTHFPIQDEPQESAESE------KNAEGPST-- 975
            LF +KK  ALDRL DLE  Y+ +GID +    +  E     + +       N+  P++  
Sbjct: 917  LFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGEASNSTAPNSLD 976

Query: 976  ---LDPRAYQAKLDEIDRISKELIEMKSELKNDKALRRHESPSKQDTDDDEIQDT 1027
               LDP    AK++E+ +I +EL  +K ++    A    +  +   TDD  I +T
Sbjct: 977  SCVLDPARLDAKIEEMTKILEELNRLKCQVDPTTANSGADISTSISTDDFNIDNT 1031

 Score = 33.5 bits (75), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 18/85 (21%)

Query: 1049 QKYGTGKN-------ATNMLTNDIL---NSSER-KGHSRQSFMERMKKPSGVP---AYLE 1094
            QKYGTG N       A  + ++      +SS+R  G+ R+SF+ RMKK S  P   ++++
Sbjct: 1117 QKYGTGTNLQPAEDGAKRLSSSSAFRAGDSSQRNSGYHRKSFVNRMKKNS-TPKSSSFVD 1175

Query: 1095 ELPLKVPKAPPLGVAETEDSSDNIA 1119
            E+  K+    P+ VA++ DS  N A
Sbjct: 1176 EVSQKM---TPVHVAQSPDSLQNTA 1197

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/545 (55%), Positives = 397/545 (72%), Gaps = 6/545 (1%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            R +KKLKQLHWEK+D   +SIW + +AEK A DL+E+GVL  LEKAFAARE KSL  K +
Sbjct: 1231 RPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVLSQLEKAFAARETKSLKGKSK 1290

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
            E  +KITFLSRDVSQQFGINLHM+S L V+++V K++KC+R+F+ TPSV+EFLSKP IIE
Sbjct: 1291 EANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCDREFLSTPSVIEFLSKPTIIE 1350

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            V+ NLAR ++PYSTDW+GV+ V+DAK PEKDP ELQRADQLY++ + NLQPYWGSRMRA+
Sbjct: 1351 VTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQLYVEFMINLQPYWGSRMRAI 1410

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
             +IT+YE++YS+LVTKLRK+D+AV  I++S +LR+VF+VILAVGNYMNDS+KQAQGFKLS
Sbjct: 1411 TMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVILAVGNYMNDSSKQAQGFKLS 1470

Query: 1496 TLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKEF 1555
            TLQRLTFIKD  NSMTFLNYVEKI+R+NYP ++ F+E+L+P+  V KISIEQL++DCKEF
Sbjct: 1471 TLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELEPIFSVTKISIEQLVTDCKEF 1530

Query: 1556 SQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFESL 1615
            SQS+ NVERSI+IGNL+D SKFH              EA K+ +LL +E+KLS++EFE+L
Sbjct: 1531 SQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEARKKADLLSDEIKLSLLEFENL 1590

Query: 1616 MQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXXX 1675
            M+++GED                 I E+K+A+  N+K EEEER Y+  KKM+        
Sbjct: 1591 MKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEEEERAYERRKKMIEDQQRKQQ 1650

Query: 1676 XXXXXXNATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLNDSEA 1735
                   A     S+E  D R  ++KLL++LKNA P K DP S RKRA+ RKK+L D ++
Sbjct: 1651 EADSKATAKNLSTSQEPSDDRDDIEKLLDKLKNAAPSKGDPSSTRKRALARKKLL-DGKS 1709

Query: 1736 VSDVLDSIQQEDDSMIYSPEKQEGITNPTGDSSQS--PSKGAANNQQDEEEITDRAKALL 1793
             + + D+I  +     +  + +    +PT   S S   ++  ++++QD     DRA+ LL
Sbjct: 1710 GASIFDNITADSTIEAFVEQNRTLTESPTAKKSASLPETESLSSSKQDP---ADRARNLL 1766

Query: 1794 MGLRG 1798
            + LRG
Sbjct: 1767 LELRG 1771

 Score =  548 bits (1411), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 328/847 (38%), Positives = 493/847 (58%), Gaps = 97/847 (11%)

Query: 306  PPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYK---- 361
            PP +YV++II+ K+   E+NDLWV+LRTE LDWV  FLE QG +A+AN++ TS+++    
Sbjct: 267  PPEYYVRQIISKKIKNKELNDLWVSLRTEPLDWVISFLEAQGQVAIANLIITSMHQDTTD 326

Query: 362  -----TDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRLA 416
                 TDP+       LE+E A F+C RVL  + + L E     ++   +  GL S ++ 
Sbjct: 327  NQNAVTDPQ------FLERETALFKCLRVLLNIRECLEEAVNSTLVTNALVEGLLSTKIP 380

Query: 417  TRKMATEIFVCMLEKKNKVR--------FEAVLNALDKKFKIGENLHMLHYM-------- 460
            TR++ATE  + ++ K    +        F  V+ +L+ +  + +N+HM            
Sbjct: 381  TRRLATETLIYLVTKDEDFKSRTAGLDCFSLVMESLNHETSLVQNIHMKAKFSTNDSTDP 440

Query: 461  KNSPQHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQ 520
            +++PQ +         KI+Q WL+ VEQ+L+GRGKMGSLVGAS++++ + GEN+I EY  
Sbjct: 441  ESNPQLYQ------VCKILQQWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLV 494

Query: 521  WTMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDD 580
             ++V I+  C   + + +R ++RT+L++ G  RI+ + +LLDY  +  ++  +E+  +DD
Sbjct: 495  DSIVLIDQLCLNNEDVKKRHMMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDD 554

Query: 581  LNSVLETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDP 640
             NS++++     ++DM+D  S+L+KL    KGTE+E  L S++++LFLS+++  +++ DP
Sbjct: 555  YNSLIDSQKFTENVDMDDPVSILQKLTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDDP 614

Query: 641  TKLSKQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLE 700
             K  +QL+L+DSL++NV+++ +D  S+ N+AIQRLYDSMQTDE+ARRAILESR LTKKLE
Sbjct: 615  GKNVQQLKLIDSLISNVAITTLDSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLE 674

Query: 701  EAQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDXXXXXXXXXXXXX 760
            E +AERD+L+ K+SK  NGLVGQL+KE+ +RD IL+K QRVT QLQ              
Sbjct: 675  EVKAERDYLNDKISKAENGLVGQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEK 734

Query: 761  XXXXXXXXXMLTILNSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDL 820
                     MLTI+NS+   DL    +V +  +P  L+P++K+ IQ  LQ  L KT++DL
Sbjct: 735  HEHEIELRKMLTIVNSKTSDDLESGSTVQNDPKP--LNPERKTAIQNVLQRSLQKTEQDL 792

Query: 821  SVDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVR 880
              +S+R G  V    RLK+LR +MEDIE +ARELEMTNFAD         VK + +   +
Sbjct: 793  LNESRRLGTAVGSKSRLKLLRSKMEDIENQARELEMTNFAD---------VKPKQNQKFK 843

Query: 881  KENELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLE 940
            ++     K  +A KL+ELRK LA IQ ESN ++KFN+E RVNELF+ KKL+ALDRL DLE
Sbjct: 844  EQ----VKGQQATKLAELRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRLKDLE 899

Query: 941  NMYKEYGIDLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMKS 1000
            N Y  + ID +      D+P+      +++ G  +LDP   Q K++E++ I  EL  +K 
Sbjct: 900  NKYNGFHIDFA------DDPELKELLTQSSNGGPSLDPTIVQRKVEEMNSIIDELNALKE 953

Query: 1001 ELKN----------------DKALRRHESPSKQDTDDDEIQDTGSMVNEDXXXXXXXXXX 1044
            E+KN                  +     S   Q +   +I   GS   E           
Sbjct: 954  EMKNRPKTGSSSSSSSSLSSASSSSEDGSSQSQASHGSDIVSNGSSFLE----------- 1002

Query: 1045 XXXXQKYGTGKNATNMLTNDILNSSER---KGHSRQSFMERMK----KPSG----VPAYL 1093
                QKY TG+          +    R    G+ R+SF+ R+K     P+     +P +L
Sbjct: 1003 -SLSQKYSTGQQTATSTNGGRVGRETRYPGSGYHRKSFLNRLKNTTVNPTATSEHLPPFL 1061

Query: 1094 EELPLKV 1100
             EL  KV
Sbjct: 1062 TELKSKV 1068

 Score = 94.4 bits (233), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 116/233 (49%), Gaps = 26/233 (11%)

Query: 1   MLKGSHSKGSQGN-GSDSRD-SNT-GSGLLSNLKRFAXXXXX-XXXXXRIETSDIXXXXX 56
           M +   S+G  GN  S SR  SN+ GS L SNLK+ A           +     I     
Sbjct: 1   MQRSQSSRGPTGNENSHSRSLSNSQGSSLFSNLKKLATGGNHGSSQPSQTRKELISSPKR 60

Query: 57  XXXXXXXXNANDL---RPLNKKSTMNTQNLSHY-MNGKSSAESLSSNHSRSPSVQXXXXX 112
                   +A  +   +PLNK S++NT NLSHY M+ ++++ S S++   SP+       
Sbjct: 61  VFTTASLESATPIGGSKPLNKISSLNTHNLSHYTMDPEANSRSQSASLLTSPT------- 113

Query: 113 XXXXXXXXHLSTPGVNSTLTREPTNQXXXXXXXXXXXXXXXXAI--FMTPDGKIKLDMP- 169
                     S    +S LTR  TN+                 +  F+T DG +KLD P 
Sbjct: 114 --------KYSYSRRSSQLTRSSTNKSIISSSAVSVSSNSTSILNRFLTNDGTLKLDRPE 165

Query: 170 SSHEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKL 222
           +  E+  LF D++ KRN+  ++S   QK++++Y ++KKWL+VKQDLQ++FK+L
Sbjct: 166 NPEEINGLFMDLLIKRNVFDSVSSQDQKDMLNYPIEKKWLMVKQDLQSEFKRL 218

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  287 bits (735), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 168/494 (34%), Positives = 277/494 (56%), Gaps = 38/494 (7%)

Query: 1260 KLKQLHWEKLDATDNSIWSSGKAEKFAG----DLYEKGVLEDLEKAF----AAREIKSLA 1311
            +LKQ+HWEK+D    ++W     E  +G     L ++GV   +EK F      ++ K LA
Sbjct: 821  RLKQIHWEKVDDVGGTLW-----EDVSGIPLDHLKDEGVFSQIEKYFKILEPVKKTKVLA 875

Query: 1312 TKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKP 1371
              + +   KI+FL+RD++QQFGINLHMYSQLSVEE VTK+LKCE D +   SVL F +K 
Sbjct: 876  ENENKP-TKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFFTKE 934

Query: 1372 EIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSR 1431
            ++ ++ + L R ++PYST++     + D  SPEKDP EL+RAD +YL+L YNL+ YW +R
Sbjct: 935  DLTQIPSGLERKFAPYSTNY-----LTD-DSPEKDPRELERADHIYLELFYNLRSYWSAR 988

Query: 1432 MRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQG 1491
               L V+T+YER+Y +L+ KL K+D+A+  +  ST ++ +  +I  +GNYMN  +    G
Sbjct: 989  SHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS--VTG 1046

Query: 1492 FKLSTLQRLTFIKDAN-NSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLIS 1550
             KL++L +L+F+K ++  +++FL++VE++VR+++P    F ED+  V D+ K+++E +  
Sbjct: 1047 IKLNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHVEL 1106

Query: 1551 DCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIM 1610
            +C+EF++ + +V  S+  G L+D +K H               A  + ELL  + +L+  
Sbjct: 1107 ECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELTKR 1166

Query: 1611 EFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXX 1670
                LM+ YGE+                    +K+   +N++ EE  RLY+  K ++   
Sbjct: 1167 SLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLLEQR 1226

Query: 1671 XXXXXXXXXXXNATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKML 1730
                            +  E ++D    +D L+ +L++A      PL  R+     K +L
Sbjct: 1227 NKKI------------EEQEHSDDEINAVDDLITKLRDAKKQHPAPLRRRRST---KAVL 1271

Query: 1731 NDSEAVSDVLDSIQ 1744
            N+  A   +L+  Q
Sbjct: 1272 NEKRAGEPLLERTQ 1285

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  288 bits (736), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 149/415 (35%), Positives = 253/415 (60%), Gaps = 13/415 (3%)

Query: 1258 RKKLKQLHWEKLDATDNSIWSSGKAEKFAGD-LYEKGVLEDLEKAFAAREI---KSLATK 1313
            R KL+Q+HW+ ++    + WS  +  K     L E GV E++E+ F  ++    K    K
Sbjct: 857  RIKLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAK 916

Query: 1314 KREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEI 1373
              ++L K++FLSRD++QQFGINLHM+S  +V ELV K+L CE + +   SVLEF +K ++
Sbjct: 917  TSQNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDL 976

Query: 1374 IEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMR 1433
              +S ++ +N+ PYST+      V   + P KD +EL+RAD+++L+L YNL+ YW +RMR
Sbjct: 977  TNISQSVKKNFEPYSTN------VLTGEGPTKDVSELERADRIFLELCYNLRSYWRARMR 1030

Query: 1434 ALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFK 1493
             L ++ +YE++Y +++ KL+K+D A   I+ S  L+ +  +I+ +GNYMN+  +QA+G K
Sbjct: 1031 CLLILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIK 1088

Query: 1494 LSTLQRLTFIK-DANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDC 1552
            LS+L +L F+K   NN+M+FL+Y+E+I+R  Y      ++DL  +  + K++++Q+  DC
Sbjct: 1089 LSSLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDC 1148

Query: 1553 KEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEF 1612
            +EF++ I N+ERS   G+L+ +  FH               A ++  LL ++ KL++ + 
Sbjct: 1149 REFNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDL 1208

Query: 1613 ESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMV 1667
            E LM   GE+                 ++ +K+A  +N++ EE ER+Y+  KK++
Sbjct: 1209 EKLMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLL 1263

 Score = 39.7 bits (91), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 53/82 (64%), Gaps = 4/82 (4%)

Query: 666 SSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLE 725
           S++  ++ ++ DS+Q+DE+ARRA+ E  +L + +++  AE + L ++   T   ++ QLE
Sbjct: 466 SALKTSLNQMMDSLQSDEIARRAMKELNSLQETVDQLTAEVESLKEERKVTKGEVIMQLE 525

Query: 726 ---KEVQQRDDILEK-NQRVTL 743
              + ++ +D+ L++ N+R+ L
Sbjct: 526 EARESLRDKDETLKQLNERIEL 547

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  285 bits (730), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 160/473 (33%), Positives = 265/473 (56%), Gaps = 23/473 (4%)

Query: 1259 KKLKQLHWEKLDATDNSIWSSGKA-EKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR-- 1315
            KK+KQ+HWEK++  +N+ W + +  E+   +L   G+ + +E  F  + +  +  KK+  
Sbjct: 818  KKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSVIMKKKKVV 877

Query: 1316 -EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEII 1374
                + I+FLSRD++QQFGINLH++ QLS +ELV+K+L+C+ D ++  SVLEF  K E+ 
Sbjct: 878  SSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLEFFCKEEMT 937

Query: 1375 EVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRA 1434
             ++ +L R+ +PYSTD+     V     P K+P ELQRAD+++L+L +NL+ YW  R + 
Sbjct: 938  HINPSLVRHLTPYSTDYMNPESV-----PTKNPDELQRADKIFLKLSFNLRSYWNERSQC 992

Query: 1435 LRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKL 1494
            L ++ +YE++Y +L+ KL+K+D A+  I  S   +N+  +I+ +GN+MN   +   G +L
Sbjct: 993  LLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--TRPVSGIRL 1050

Query: 1495 STLQRLTFIKDAN-NSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCK 1553
            S L +L FIK  N N+++FL+Y+E+++R +Y     F++DL  V ++ KIS++Q+   C+
Sbjct: 1051 SALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISMDQVALQCE 1110

Query: 1554 EFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFE 1613
            EF   I  +  +I  G L+D  K H               A  + ELL +  KLS  +FE
Sbjct: 1111 EFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHFKLSNNDFE 1170

Query: 1614 SLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXX 1673
             +M+ YGED                    +K+   +N++ EE ER+Y   KK++      
Sbjct: 1171 KVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERVYAQRKKIMEASTRK 1230

Query: 1674 XXXXXXXXNATEEDASEENED-RRAMMDKLLEQLKNAGPVKADPLSARKRAMI 1725
                      ++ D+  +N D     +D LL QL+     K +PL  RK   +
Sbjct: 1231 D---------SDVDSGTDNIDGENTAVDSLLAQLRGVDK-KPEPLRTRKSVKV 1273

 Score = 43.9 bits (102), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 113/238 (47%), Gaps = 37/238 (15%)

Query: 515 ILEYSQWTMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYE 574
           I +Y    +  IN    G      +  +   L+ +    ++   + +D + + E V+ ++
Sbjct: 339 ISDYFSSMLFLINSIVQGFQSFTTKKNILAELKRSEVYTLLYLLEDIDCNVIQEQVKLFK 398

Query: 575 NLKLDDLNSVLETGAHASDIDMNDS-ASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRL 633
               D   ++LE  +  S + ++    S+L++L +    T+ E  +NSL+  +  S ++ 
Sbjct: 399 ----DTEENILEVTSRESGVHIDSPYGSILQQLTNLTSNTQLEPQINSLLDLILKSVNK- 453

Query: 634 MEDNQDPTKLSKQLRLMDSLVTNVSVSAVDESSS---------INMAIQRLYDSMQTDEV 684
               +  ++ SK L+ M+S +      ++D S+             ++  L DS+Q+DE+
Sbjct: 454 ----KTYSESSKLLQFMESFLQ----YSLDNSNHNHYEHPETLFQESVNNLMDSLQSDEI 505

Query: 685 ARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVT 742
           A+RA+LE       L+E Q++ + LS +L+K  N       ++   + DIL++ ++VT
Sbjct: 506 AKRAMLE-------LDEKQSQMNILSNQLTKLRN-------EKTMDKSDILDQLKQVT 549

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  272 bits (696), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/476 (31%), Positives = 258/476 (54%), Gaps = 26/476 (5%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWS-SGKAEKFAGDLYEKGVLEDLEKAFAARE--IKSLAT 1312
            + ++ LKQ+HWEKL+  + ++W+   + ++   +L   G+   +E++F  +E  IK    
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKELKRGGIFSQIEESFKVKERTIKQTKN 857

Query: 1313 K-KREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKP 1371
            K KRE     +FL RDV+QQFGINLHM+SQ S E+ V K+L+C+ + +   + LEF ++ 
Sbjct: 858  KDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTRE 917

Query: 1372 EIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSR 1431
            +++ V+ +L R + PYSTD+      ED   P KDPAEL R D+++L+L YNLQ YW  R
Sbjct: 918  DLVNVTQSLRRAFDPYSTDYLS----EDG--PSKDPAELDRPDRIFLELCYNLQYYWYER 971

Query: 1432 MRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQG 1491
               L  +T+YER+Y + + +L+K+D  +  ++  T  +++  +I+ +GNYMN   + A+G
Sbjct: 972  SFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAEG 1029

Query: 1492 FKLSTLQRLTFIKDA-NNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLIS 1550
             KLS+L +L F+K + + + +FL+++E+I+R  YP    F +DL  V D+ KIS++ L  
Sbjct: 1030 IKLSSLNKLAFVKSSVDKNTSFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHLEQ 1089

Query: 1551 DCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIM 1610
            +C EF   I  V  ++  G L+D S+ H               A  + +LL ++ KL  +
Sbjct: 1090 ECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLINI 1149

Query: 1611 EFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXX 1670
            + + LM  +GED                    +K+   +N++ E+ +R+Y+  K M+   
Sbjct: 1150 DLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLESR 1209

Query: 1671 XXXXXXXXXXXNATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIR 1726
                          +EDA          +D LL +L+     +  P   R+R + R
Sbjct: 1210 QRTASNHNSDLQGEDEDA----------VDVLLAKLRGT---EEKPGLVRRRKITR 1252

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  273 bits (699), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 155/470 (32%), Positives = 258/470 (54%), Gaps = 27/470 (5%)

Query: 1259 KKLKQLHWEKLDATDNSIWSSG-KAEKFAGDLYEKGVLEDLEKAFAAREI---KSLATKK 1314
            K LKQ+HW+K++  DN+IW    +  +   +L    +   +E +F  +E+   KS   K 
Sbjct: 999  KNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKKSKTEKN 1058

Query: 1315 REDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEII 1374
            +E  +  +FLSRD++QQFGINLHMYS  + +E +  +L C  + +   SVLEF  K ++I
Sbjct: 1059 KEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFFCKEDLI 1118

Query: 1375 EVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRA 1434
             +  +++RNY+PYS D+         + P KD +EL+RAD+L+L+L YNL+ YW  R + 
Sbjct: 1119 NIPGSISRNYAPYSRDY------LSGEEPVKDSSELERADKLFLELCYNLRYYWADRSQC 1172

Query: 1435 LRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKL 1494
            L ++ +YER+Y +LV KL+K+D A+  +  S   R+   ++L +GNYMN   K  +G K+
Sbjct: 1173 LLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKTVEGVKI 1230

Query: 1495 STLQRLTFIK-DANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCK 1553
            S+L +L FIK  +NN+++FL+++EK++R  YP    F++DL  V D+ K+++E + ++C 
Sbjct: 1231 SSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEHIGTECD 1290

Query: 1554 EFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFE 1613
            EF   + +V  S+  G L+ S K H               A  + ELL ++  L+  +  
Sbjct: 1291 EFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNLTKHDVT 1350

Query: 1614 SLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXX 1673
             L+  YGED                 ++ +K+   +N++ EE ER+Y+  K M+      
Sbjct: 1351 KLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVYEQRKNML------ 1404

Query: 1674 XXXXXXXXNATEEDASEENEDRRA--MMDKLLEQLKNAGPVKADPLSARK 1721
                    +  E D   E +D+     +D LL +L+     K +PL  R+
Sbjct: 1405 -----ESQSKKEGDGINEEDDKSTSDAVDLLLSKLRGVEG-KPEPLRRRR 1448

 Score = 35.4 bits (80), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 42/74 (56%), Gaps = 4/74 (5%)

Query: 666 SSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLE 725
           S++  +I  L D +Q+DE+ARRA+ E ++L + ++  Q+E   L ++       L+ QL+
Sbjct: 505 STVQNSINELMDRLQSDEIARRAMNEMKSLEQIIDNLQSEISSLKEERQLDKGELIAQLK 564

Query: 726 KEVQQRDDILEKNQ 739
               Q    +EKN+
Sbjct: 565 SAHIQ----IEKNE 574

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  274 bits (700), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 145/420 (34%), Positives = 242/420 (57%), Gaps = 21/420 (5%)

Query: 1258 RKKLKQLHWEKLDATDNSIWSSGKAE-KFAGDLYEKGVLEDLEKAFAAREIKSLATKK-- 1314
            R KLKQ+HW+K++    ++W   +     + +L   G+ +++E+ F   EIK  +T    
Sbjct: 1163 RIKLKQIHWDKIENIKETVWCDEQQRVSKSSELESLGIFKEIEELF---EIKPASTNLAN 1219

Query: 1315 ------REDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFL 1368
                  +    +I+ LSR+++Q+FGINLH++S  +VEELV K+L C+ + M    VLEF 
Sbjct: 1220 ATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSCDSEVMKNQGVLEFF 1279

Query: 1369 SKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYW 1428
             K E   V  ++ R + PY T++         + PEKDPAEL+RAD++YL+L YNL+ YW
Sbjct: 1280 CKEEANNVPQSIQRLFGPYETNY------LTGERPEKDPAELERADRIYLELFYNLRSYW 1333

Query: 1429 GSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQ 1488
             +R   L VI+++ER+Y +++ KL+++D A   IQ S  L+ +F +I+ +GNYMN   K 
Sbjct: 1334 AARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFFIIVEIGNYMNQ--KP 1391

Query: 1489 AQGFKLSTLQRLTFIKDA-NNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQ 1547
             QG +LS+L +L F K   +N+++F++ +E+IVR  YPS +DF+E +  +  V  I ++ 
Sbjct: 1392 VQGIQLSSLNKLAFTKTIKDNNLSFIHVLERIVRTRYPSVHDFVEGINSITGVANIIVQH 1451

Query: 1548 LISDCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKL 1607
            +  +  EF   I N++RS+  G L+D SKFH              +A K+  LL ++  L
Sbjct: 1452 VQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKLAQAKKKARLLRDQCSL 1511

Query: 1608 SIMEFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMV 1667
            +I +FE LM  +GE+                 I  +++A  +N + EE +R Y+  ++++
Sbjct: 1512 TISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKENTEREELDRTYEKRRRLL 1571

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  269 bits (687), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 142/415 (34%), Positives = 239/415 (57%), Gaps = 29/415 (6%)

Query: 1258 RKKLKQLHWEKLDATDNSIW--------SSGKAEKFAGDLYEKGVLEDLEKAF-----AA 1304
            R KLKQ+HW+K+D    ++W        +S K E F       GV +++E  F       
Sbjct: 769  RVKLKQIHWDKIDNIKETVWNEHNERISTSTKLETF-------GVFKEIEDLFKVVPATP 821

Query: 1305 REIKSLATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSV 1364
            +   S +  +     KI  LS D++Q FGINLH++S  S EEL+  +L C  + +    V
Sbjct: 822  KTASSNSPTQTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQNQRV 881

Query: 1365 LEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNL 1424
            +EF SK +I  +  +  R ++PY T++         K+P+KDPA L+RAD++YL+L YNL
Sbjct: 882  IEFFSKDDINHIPQSTQRMFAPYETNY------LTGKTPDKDPAVLERADRIYLELFYNL 935

Query: 1425 QPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMND 1484
            + YW +R + L V+ +YER+Y +++ KL+++D A   I+ S  L+ +F +I+ +GNYMN+
Sbjct: 936  RSYWAARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGNYMNN 995

Query: 1485 SAKQAQGFKLSTLQRLTFIKDA-NNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKI 1543
              KQA G +LS++ +L F K + +N+++F++ +E+I+R  YP  ++F EDL+ V D+  I
Sbjct: 996  --KQALGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQDMANI 1053

Query: 1544 SIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDE 1603
             ++ +  + +EF + I+N+ERS+ +G L+DSS+FH               A K+ ELL +
Sbjct: 1054 IVQHVQQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAELLID 1113

Query: 1604 EVKLSIMEFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEER 1658
            +  L++ +FE L+  +GED                 +  +K+A  +N++ EE  R
Sbjct: 1114 QSTLTMGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKENIEREEIRR 1168

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  268 bits (686), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 139/370 (37%), Positives = 227/370 (61%), Gaps = 15/370 (4%)

Query: 1260 KLKQLHWEKLDATDNSIWSSGKAE-KFAGDLYEKGVLEDLEKAF-----AAREIKSLATK 1313
            KLKQ+HW+K+D    ++WS  K     + +L   GV +++E+ F     A +   ++ T 
Sbjct: 815  KLKQIHWDKIDDISKTVWSDDKERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMFTA 874

Query: 1314 KREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEI 1373
            +     K+T LS D++QQFGINL+++S  SVEELV K+L C+ + M   SV+EF SK +I
Sbjct: 875  QNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKDDI 934

Query: 1374 IEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMR 1433
              +  ++ R ++PY T++    K      PEKD   L RAD++YL+L YNL+ YW  R +
Sbjct: 935  NHIPQSIQRMFAPYETNYLTGDK------PEKDSRSLDRADRIYLELFYNLRSYWAPRAK 988

Query: 1434 ALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFK 1493
             L  + +YE++Y +++ KL+++D     I+ S  L+ +  +I+ VGNYMN+  KQA G +
Sbjct: 989  YLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALGIQ 1046

Query: 1494 LSTLQRLTFIKDA-NNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDC 1552
            LS+L +L F K + +N+++F++ +E IVR NYP  + F+ DL+ +LDV  I ++ +  + 
Sbjct: 1047 LSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQEA 1106

Query: 1553 KEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEF 1612
            +EF + I+ +ERS+ +G L+DSSKFH               A K+ +LL ++  L++ EF
Sbjct: 1107 QEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMGEF 1166

Query: 1613 ESLMQRYGED 1622
            + LM  +GED
Sbjct: 1167 DKLMVFWGED 1176

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  265 bits (677), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 155/492 (31%), Positives = 272/492 (55%), Gaps = 24/492 (4%)

Query: 1259 KKLKQLHWEKLDATDNSIWSSGKAEK-FAGDLYEKGVLEDLEKAFAAREI-----KSLAT 1312
            KKLKQ+HW+K++  +++IW + +  +     L   GVL+++E  F  +E      KS AT
Sbjct: 870  KKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAKKSCAT 929

Query: 1313 KKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPE 1372
            +       ++FLSRD++Q FGINLHM+S LSV+E V K+L C+ D +    VLEF ++ E
Sbjct: 930  EGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEFFNREE 989

Query: 1373 IIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRM 1432
            +  +S++  R Y+PY   +       +  + E  P  L+R D+++L+L Y L+ YW  R 
Sbjct: 990  LGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLPP-LERGDEIFLKLCYVLRDYWSVRS 1048

Query: 1433 RALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGF 1492
              L V+ +YE++Y ++V KL+K++ A+  +++ST L+N   +I+ +GNYMN   K A G 
Sbjct: 1049 HCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYMN--TKAASGV 1106

Query: 1493 KLSTLQRLTFIKDANN-SMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISD 1551
            K+S+L +L FIK ++N +++FL+Y+E+++R  YP    F+ DL+ V D+ K++++QL  +
Sbjct: 1107 KISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVEDLGKLTLDQLELE 1166

Query: 1552 CKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIME 1611
            C E+   I  +  ++  G L+D +K +               A+ + +LL+ ++KLS  +
Sbjct: 1167 CSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLLESQMKLSSND 1226

Query: 1612 FESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXX 1671
               LM+ YGED                 +  +K+   +N++ EE +R+Y+  +K++    
Sbjct: 1227 MNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYEQRRKLLEDKQ 1286

Query: 1672 XXXXXXXXXXNATEEDAS-----EENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIR 1726
                      +A  + A      +ENED    +DKLL++L+        P         R
Sbjct: 1287 SSRSKSGKGNSAAADAAGGNEDDDENEDEEDAVDKLLDKLREVAKPVGKP---------R 1337

Query: 1727 KKMLNDSEAVSD 1738
            ++  +D+E+ SD
Sbjct: 1338 ERRTDDAESKSD 1349

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  262 bits (669), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 148/464 (31%), Positives = 256/464 (55%), Gaps = 19/464 (4%)

Query: 1256 RARKKLKQLHWEKLDATDNSIW--SSGKAEKFAGDLYEKGVLEDLEKAFAAREI---KSL 1310
            +++KKLKQ+HW+K++   N++W  + G+ +    +L   G+ E ++  F+ +++      
Sbjct: 854  QSKKKLKQIHWDKIENVKNTLWDHADGRQDTIL-ELEHAGIFEKVQGMFSVQDLVVKPKR 912

Query: 1311 ATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSK 1370
            A   RE    ++FLSRD SQQ  INLH+++QL+ +E++ K+L C+ D +   SVLEF  K
Sbjct: 913  AVNVRESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFFCK 972

Query: 1371 PEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGS 1430
             E++ + +   R+++PYS D+   S+      P K+P EL+RAD+L+L L +NL+ YW  
Sbjct: 973  DEMVNIGSARIRHFTPYSADYLNASE-----QPAKNPDELERADKLFLYLPFNLRRYWAE 1027

Query: 1431 RMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQ 1490
            R + L VI++YEREY +++  L+K+D A+  I+ S   +    +I+ +GNYMN   K  +
Sbjct: 1028 RSQCLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKAVE 1085

Query: 1491 GFKLSTLQRLTFIKDANN-SMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLI 1549
            G +L++L +L FIK  +N + +FL++VEK++R +YP    F+ DL  V D+ KI+I+Q+ 
Sbjct: 1086 GIRLNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQVQ 1145

Query: 1550 SDCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSI 1609
              C+E+   I  +  S+  G L+D ++ H               A  + ELL  + KL+ 
Sbjct: 1146 LQCEEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKLTN 1205

Query: 1610 MEFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXX 1669
             +F   M  YGED                  + +++   +N++ EE +R Y+  KK+   
Sbjct: 1206 NDFRKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRKKIA-- 1263

Query: 1670 XXXXXXXXXXXXNATEEDASEENEDRRAMMDKLLEQLKNAGPVK 1713
                        N T  D SEE +   +++ +L +  K   P++
Sbjct: 1264 ---ELRNKKNERNDTVHDTSEEIDSVHSLLAQLRDVEKQPEPMR 1304

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  262 bits (670), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 134/414 (32%), Positives = 239/414 (57%), Gaps = 17/414 (4%)

Query: 1260 KLKQLHWEKLDATDNSIWS--SGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKRED 1317
            KLKQ+HW+K+D    ++W   S +  K + +L   G+ +++++ F              +
Sbjct: 961  KLKQIHWDKIDDIKETVWCDQSQRVSK-STELASFGIFQEIDELFQLNPTSPAIANATAN 1019

Query: 1318 L-----DKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPE 1372
            L      K++ LSR+++Q+FGINLH++S  +VEEL +K+L C+ + +   SV+EF  K E
Sbjct: 1020 LLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKVLNCDNEVLKNQSVIEFFCKEE 1079

Query: 1373 IIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRM 1432
            I  +  ++ + ++PYS ++         + P++DP EL RAD++YL+L YNL+ YWG+R 
Sbjct: 1080 INNIPKSVQQLFAPYSANYI------TGEQPDRDPNELDRADRIYLELFYNLRSYWGARS 1133

Query: 1433 RALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGF 1492
            + L VI +++++Y +++ KL ++D A   +Q S  L+ +F +I+ +GNYMN   +   G 
Sbjct: 1134 KYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKELFFIIVEIGNYMNQ--RPVAGI 1191

Query: 1493 KLSTLQRLTFIKDA-NNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISD 1551
            +LS+L +L F K + +N+M+F++ +E+IVR  YPS +DF+E L  +L+V  I ++ +  +
Sbjct: 1192 QLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDFVEGLDKILEVQNIIVQHVQQE 1251

Query: 1552 CKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIME 1611
              EF   I ++ER   IG L+D S+FH               A K+ +LL ++  L++ +
Sbjct: 1252 AHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESKILLAKKKADLLKDQCTLTMSD 1311

Query: 1612 FESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKK 1665
            FE LM  +GE+                 I  +++A  +N + EE  R+Y+  ++
Sbjct: 1312 FEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKENSEREEMTRIYEKRRR 1365

 Score = 38.5 bits (88), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 133/288 (46%), Gaps = 44/288 (15%)

Query: 482 WLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRIL 541
           WL AVE +++   +    V +++       +  +++Y   TM  IN    G      +  
Sbjct: 289 WLEAVETTIKDETQWHDDVPSNQK-----PQQLMIDYCVSTMFLINSLIQGIPTYRGKSR 343

Query: 542 LRTRLENAGGLRIMNQF----KLLDYDKVMELVEAYENLKLDDLNS--VLETGAHASDID 595
           L   L++AG  RI ++     +  D + +++ +  Y++ +  ++NS  V++T  H     
Sbjct: 344 LIRLLKDAGIHRIFHRIVSSGEKFDSEILLDEISKYQS-REGEINSKFVIDTPTH----- 397

Query: 596 MNDS-ASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLV 654
           +N S  S +K +    +GT  E  +      L L + R +  ++   + +K L+L  S+ 
Sbjct: 398 LNVSFKSQIKTIVTLTQGTSLESYMT-----LVLDSIRQIVTSRTSAEATKLLQLFQSIF 452

Query: 655 TN-VSVSAVDESSSINMAIQ----RLYDSMQTDEVARRAILESRTLTKKLEEA------- 702
              +  S  DE     +A+Q    +L D +Q+ +V +RA+ E   +  K+EE        
Sbjct: 453 KYLIEHSYEDEELGTEIALQASLNKLMDDLQSKQVNQRAVQELEEMKVKMEEMKRVIAKL 512

Query: 703 ----QAERDFLSQKLSKTGNGLVGQLE--KEVQQR---DDILEKNQRV 741
               +  +  ++++L+ T   L  +L+   E+++R    +IL KN+R+
Sbjct: 513 EHQKEIAKSVIAKELNATKAALSIKLDYITELEERLESVEILRKNERM 560

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  261 bits (668), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 139/420 (33%), Positives = 239/420 (56%), Gaps = 18/420 (4%)

Query: 1256 RARKKLKQLHWEKLDATDNSIWSSG-KAEKFAGDLYEKGVLEDLEKAFAARE--IKSL-- 1310
            + ++ LKQ+HWEK+D  + ++W    + E+   +L   G+ E ++  F  +   +K +  
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1311 --ATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFL 1368
              +TKK   L   +FLSRD++QQFGINLHMYSQ  VEE V K+L+C+ D +   SVLEF 
Sbjct: 908  DNSTKKTTQLK--SFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFF 965

Query: 1369 SKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYW 1428
            +  E+  +  +L+R+++PYS D+      ++ KSP  DP EL+R D+++L+L YNL+ YW
Sbjct: 966  NNEELTNIPASLSRSFAPYSADF------QENKSPTVDPNELERPDRIFLELCYNLRSYW 1019

Query: 1429 GSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQ 1488
              R + L +  +YER+Y +LV KL+ +D A+  I+ +  L+ +  +I+ +GNYMN   K 
Sbjct: 1020 RERSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKN 1077

Query: 1489 AQGFKLSTLQRLTFIKDA-NNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQ 1547
              G +L++L +L+F+K + +N+++FL+++EK+VR  YP    F +DL     +  IS + 
Sbjct: 1078 VSGIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDH 1137

Query: 1548 LISDCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKL 1607
            + S+C+E+   + +V R    G L+  S  H               A  + +LL ++ KL
Sbjct: 1138 IQSECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKL 1197

Query: 1608 SIMEFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMV 1667
               + + LM+ +GE+                    +K+   +N++ EE  R+Y+  KK++
Sbjct: 1198 ISADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKCAKENIEKEEAYRVYEQRKKLL 1257

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  260 bits (665), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 160/492 (32%), Positives = 276/492 (56%), Gaps = 27/492 (5%)

Query: 1259 KKLKQLHWEKLDATDNSIWSSGKA-EKFAGDLYEKGVLE---DLEKAFAAREIKSLATKK 1314
            ++LKQ+HW+K++    +IW+  +     A  L E G+L+   DL K   +   K+   + 
Sbjct: 919  QRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAPTKANTGRL 978

Query: 1315 REDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEII 1374
             E+   +  L RD++QQFGINLHM+S LSVE+ V K+L C+R  +   SVLEF ++ +++
Sbjct: 979  NEE-GPLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLEFFARDDLV 1037

Query: 1375 EVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRA 1434
             +  +L+  + PYS+D+         K P KD ++L+RAD+++L L YNL+ YW  R   
Sbjct: 1038 NIPHSLSLKFEPYSSDF------RLGKGPLKDSSKLERADRIFLALCYNLRSYWRQRSIC 1091

Query: 1435 LRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKL 1494
            L  + +YE++Y +++ KL++VD A+ +I+ S  L++   +I+ +GNYMN   KQA G KL
Sbjct: 1092 LLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--RKQAPGIKL 1149

Query: 1495 STLQRLTFIKDA-NNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCK 1553
            S+LQ+L F+K + + +++FL+ VE+ +R    +   F+++L  VLD+  + + Q+  D +
Sbjct: 1150 SSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVVGQVEQDFQ 1209

Query: 1554 EFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFE 1613
            E+ + I  V++S+D G L+DS  FH               A+++  LL  + KL++   E
Sbjct: 1210 EYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQFKLTMRALE 1269

Query: 1614 SLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXX 1673
            +LM+ YGED                 I ++K+A  +N++ EE ER+Y   K+++      
Sbjct: 1270 NLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYNHRKELLQQKTKA 1329

Query: 1674 XXXXXXXXNATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKMLNDS 1733
                     +++ DAS E E+  A +D L+++L++   V     S+ KRA  +       
Sbjct: 1330 ---------SSKNDASSEEEEDDA-VDILIQRLRD---VNKSSKSSTKRAPHQNTQDQLL 1376

Query: 1734 EAVSDVLDSIQQ 1745
                 +LDSIQ+
Sbjct: 1377 TRTQHMLDSIQK 1388

 Score = 35.4 bits (80), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 19/129 (14%)

Query: 607 FDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSVSAVDES- 665
            ++C     E L  +LV       +R M DN       K L L  S++  +   +  E  
Sbjct: 443 LEHCMHQLFETLSKTLV-------ARTMSDNL------KVLTLFHSVIDYLKEYSYGEEN 489

Query: 666 ----SSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLV 721
               S +N+++  L D +Q+DE+A+RA+ E     K++E  ++E   L +    T  G++
Sbjct: 490 INIDSVVNISLNHLVDGLQSDEIAKRAMSELELAQKEIENLESEIRALRKDKEITKGGVL 549

Query: 722 GQLEKEVQQ 730
            +L ++ QQ
Sbjct: 550 SEL-RQTQQ 557

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  258 bits (659), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 143/414 (34%), Positives = 244/414 (58%), Gaps = 16/414 (3%)

Query: 1260 KLKQLHWEKLDATDNSIWSS-GKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKREDL 1318
            KLKQ+HW+KL+    +IWS  G+ +  A  L   G L+++ + F  R  +SL  K + + 
Sbjct: 920  KLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELF--RVNQSLPIKAKSET 977

Query: 1319 ----DKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEII 1374
                DK++ L RD++QQFGINLHM+S LSV+E V K+L C+RD ++  SVLEF ++ ++ 
Sbjct: 978  SSGKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLS 1037

Query: 1375 EVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRA 1434
             +  ++A    PY+TD       +  ++P  D  +L+RAD+++L+L YNL+ YW  R   
Sbjct: 1038 IIPRSIASKLEPYATDH------QPNEAPLLDREKLERADRIFLELCYNLRSYWRPRSLC 1091

Query: 1435 LRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKL 1494
            L  +++YE++Y +L+ KL++VD A+ +I+ S  L++   +I+ +GNYMN   KQA G +L
Sbjct: 1092 LLTLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIRL 1149

Query: 1495 STLQRLTFIKDA-NNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCK 1553
            S+LQ+LTF+K + + +M+ L+ VE+ +R    S   F+EDL  VLD+  + + Q+  D  
Sbjct: 1150 SSLQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFH 1209

Query: 1554 EFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFE 1613
            E++Q I+ V++S++ G L+    FH               A+++  LL  +  L++   E
Sbjct: 1210 EYTQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALE 1269

Query: 1614 SLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMV 1667
            +LM+ YGED                 ++++K+   +N + E  ER+Y   K+++
Sbjct: 1270 NLMKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELL 1323

 Score = 36.6 bits (83), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 39/61 (63%)

Query: 666 SSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLE 725
           S I++++ +L D++Q+DE+A RA+ E +T    +++  +E   L ++ S +   ++ +LE
Sbjct: 494 SVISVSLNQLVDNLQSDEIAERAMSELKTAQNSIDQLNSEIQILQKERSVSKGSILSELE 553

Query: 726 K 726
           K
Sbjct: 554 K 554

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  256 bits (653), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 141/471 (29%), Positives = 267/471 (56%), Gaps = 34/471 (7%)

Query: 1259 KKLKQLHWEKLDATDNSIWSSGKAEK-FAGDLYEKGVLEDLEKAFAAREIK------SLA 1311
            K LKQ+HW+K++   +++W+          DL EKGV  ++   F  + ++        A
Sbjct: 801  KPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLFEQKAVRMKKKSNVTA 860

Query: 1312 TKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKP 1371
            +KK E   K++ LSRD++QQFGINLHM+S  SVE+L+ K+L+C+ D +   SVLEF +K 
Sbjct: 861  SKKNE---KVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNHSVLEFFNKD 917

Query: 1372 EIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSR 1431
            +   +  ++ R++ PY++DW      +  K+P++D ++L+RAD++YL++ YN++ YW  R
Sbjct: 918  DFETIPQSIIRSFEPYASDW------KTGKAPKEDVSKLERADRIYLEMFYNMRYYWKIR 971

Query: 1432 MRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQG 1491
              +L +  +YE++Y +++ +L+K+D   ++I+ S  L+  F +++ +GN+MN+  K+ QG
Sbjct: 972  SSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFMNN--KKTQG 1029

Query: 1492 FKLSTLQRLTFIK-DANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLIS 1550
             KLS+L +L+ +K +++ +++FL+ +E+I+R+ YP   DF  DL  + D+ KI+IE + S
Sbjct: 1030 IKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLGKINIESIES 1089

Query: 1551 DCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIM 1610
            +  E+ + I  ++ S + G L+ + K H               A ++ ELL  + KL++ 
Sbjct: 1090 EIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELLHNQCKLTMN 1149

Query: 1611 EFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXX 1670
            +F S M+  GED                 +  + +   +N + E   R+++  ++++   
Sbjct: 1150 DFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHEQRQQLLQK- 1208

Query: 1671 XXXXXXXXXXXNATEEDASEENEDRRA--MMDKLLEQLKNAGPVKADPLSA 1719
                        A+ E   E++ D  A   +D L+++L++  P +  P S+
Sbjct: 1209 ------------ASTETQVEKSADDEAADTIDILIKKLRSVDPQQTIPGSS 1247

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  253 bits (645), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 146/482 (30%), Positives = 248/482 (51%), Gaps = 41/482 (8%)

Query: 1259 KKLKQLHWEKLDATDNSIWSSG--KAEKFAGDLYEKGVLEDLEKAFAAREIKSLATK--- 1313
            K+LKQ+HW+K++   +++W  G  + E   G L   G+   +E  F  +    +A K   
Sbjct: 875  KRLKQIHWDKVEDIKDTLWEDGLQRQETIRG-LQTDGIFSQIEDIFKMKSPTKIANKTSA 933

Query: 1314 ------------KREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDT 1361
                           +L KI+FLSRD++QQFGINLHM+SQLS  E V K+LKC+ D +  
Sbjct: 934  ISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDNDIVQN 993

Query: 1362 PSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLI 1421
             ++L+F  K E++ +  +L   Y PYS   +G           K  ++LQRAD+++L+L 
Sbjct: 994  VNILKFFCKEELVNIPKSLLNKYEPYSRGENG-----------KAASDLQRADRIFLELC 1042

Query: 1422 YNLQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNY 1481
             NL+ YW  R ++L  +++YER+Y +L+ KL+ +D  ++ + +S   +N+  +I  +GN+
Sbjct: 1043 INLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIITEIGNH 1102

Query: 1482 MNDSAKQAQGFKLSTLQRLTFIKDANN-SMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDV 1540
            MN   +  +G KL +L +L F++ + + +M+FL+++EKI+R  YP    F++DL+ V D+
Sbjct: 1103 MN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLKKVEDL 1160

Query: 1541 VKISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVEL 1600
             KIS+E +  +C EF   I N+      G L++                    A  + EL
Sbjct: 1161 GKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRARIKSEL 1220

Query: 1601 LDEEVKLSIMEFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLY 1660
            L ++ KL++++   LM+ YGED                 +  +K+   +N++ EE ER+Y
Sbjct: 1221 LMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKENIEKEEMERVY 1280

Query: 1661 QTHKKMVXXXXXXXXXXXXXXNATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSAR 1720
            +  K ++                   D ++ENE      D +   +     VK DP   R
Sbjct: 1281 EQRKNLLEMRTNGNKKC---------DGNDENEGEEVNTDAVDLLISKLREVKKDPEPLR 1331

Query: 1721 KR 1722
            +R
Sbjct: 1332 RR 1333

 Score = 37.7 bits (86), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 16/90 (17%)

Query: 636 DNQDPTKLS-KQLRLMDSLV----------TNVSV-----SAVDESSSINMAIQRLYDSM 679
           D+Q P   S K L+LM+SL+          TN S      SA +  S    ++ +L DS+
Sbjct: 460 DSQRPYSESIKLLKLMNSLLFYLIDSFQVPTNPSFDENIESAENADSVFQDSVNKLLDSL 519

Query: 680 QTDEVARRAILESRTLTKKLEEAQAERDFL 709
           Q+DE+ARRA+ E   L KK+     + D +
Sbjct: 520 QSDEIARRAVTEIDDLNKKISHLNEKLDLV 549

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  249 bits (637), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 142/481 (29%), Positives = 259/481 (53%), Gaps = 39/481 (8%)

Query: 1259 KKLKQLHWEKLDATDNSIWS-SGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR-- 1315
            K+LKQ+HW+K++   +++W  + + ++   +L   G+   +E  F  +    +A K+   
Sbjct: 876  KRLKQIHWDKVEDIKDTLWEDTFQRQETIKELQTDGIFSQIEDIFKMKSPTKIANKRNAE 935

Query: 1316 -------------EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTP 1362
                          +L KI+FLSRD++QQFGINLHM+SQLS  E V K+L C+ D +   
Sbjct: 936  SSIALSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDIVQNV 995

Query: 1363 SVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIY 1422
            ++L+F  K E++ +  ++   Y PYS   DG           K  ++LQRAD+++L+L  
Sbjct: 996  NILKFFCKEELVNIPKSMLNKYEPYSQGKDG-----------KAVSDLQRADRIFLELCI 1044

Query: 1423 NLQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYM 1482
            NL+ YW +R ++L  +++YER+Y +L+ KL+K+D A++ + +S   +++  +I  +GN+M
Sbjct: 1045 NLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDAISHLNRSPKFKSLMFIITEIGNHM 1104

Query: 1483 NDSAKQAQGFKLSTLQRLTFIKDA-NNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVV 1541
            N   +  +G KL +L +L F++ + + +++FL+++EK++R  YP    F++DL+ + D+ 
Sbjct: 1105 N--KRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKVIRIKYPDIYGFVDDLKNIEDLG 1162

Query: 1542 KISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELL 1601
            KIS+E + S+C EF + I ++     +G L+                     A  + ELL
Sbjct: 1163 KISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDPRDQIIKKVKFKINRAKTKSELL 1222

Query: 1602 DEEVKLSIMEFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQ 1661
              + KL++++   LM+ YGED                 +  +K+   +N++ EE ER+Y+
Sbjct: 1223 IGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYE 1282

Query: 1662 THKKMVXXXXXXXXXXXXXXNATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARK 1721
              K ++              N ++E+  E+    R  +D L+ +L+    VK DP   R+
Sbjct: 1283 QRKSLL----DMRTSSNKKSNGSDENDGEKV--NRDAVDLLISKLRE---VKKDPEPLRR 1333

Query: 1722 R 1722
            R
Sbjct: 1334 R 1334

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  244 bits (623), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 143/485 (29%), Positives = 247/485 (50%), Gaps = 39/485 (8%)

Query: 1259 KKLKQLHWEKLDATDNSIWSSG-KAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR-- 1315
            ++LKQ+HW++++   +++W    + ++   +L   GV   +E  F  R    +A+K    
Sbjct: 875  RRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASKNNAG 934

Query: 1316 -------------EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTP 1362
                          +L K++FLSRD++QQFGINLHM+SQLS  E V K+L C+ D +   
Sbjct: 935  SSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDIIQNV 994

Query: 1363 SVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIY 1422
            ++L+F  K E+  +  +L   Y PYS   +G           K  ++LQRAD+++L+L  
Sbjct: 995  NILKFFCKEELTNIPKSLLNKYEPYSQGKEG-----------KAVSDLQRADRIFLELCI 1043

Query: 1423 NLQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYM 1482
            NL+ YW  R + L  +++YER+Y +L+ KL+K+D  ++ +  S   +N+  +I  +GN+M
Sbjct: 1044 NLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEIGNHM 1103

Query: 1483 NDSAKQAQGFKLSTLQRLTFIKDA-NNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVV 1541
            N   K  +G KL +L +L F++ + + +M+FL+++EKI+R  YP    F++DL+ + D+ 
Sbjct: 1104 N--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKKIEDLG 1161

Query: 1542 KISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELL 1601
            KIS+E +  +C EF   I N+      G L+                     A  + ELL
Sbjct: 1162 KISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKIKSELL 1221

Query: 1602 DEEVKLSIMEFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQ 1661
              + KL++++   LM+ YGED                 +  +K+   +N++ EE ER+Y+
Sbjct: 1222 MGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEMERVYE 1281

Query: 1662 THKKMVXXXXXXXXXXXXXXNATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARK 1721
              K ++              N  + + ++ENE      D +   +     VK DP   R+
Sbjct: 1282 QRKSLL---------EMRTNNNKKSNGNDENEGEEVNTDAVDLLISKLREVKKDPEPLRR 1332

Query: 1722 RAMIR 1726
            R   R
Sbjct: 1333 RKSTR 1337

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  245 bits (625), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 140/470 (29%), Positives = 253/470 (53%), Gaps = 23/470 (4%)

Query: 1259 KKLKQLHWEKLDATDNSIWSSGKAEK-FAGDLYEKGVLEDLEKAFAAREI---KSLATKK 1314
            KKLKQ+HW +++    +IW     ++    +L   GV + ++ +F  +++   K+    K
Sbjct: 1141 KKLKQIHWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKKNTDEAK 1200

Query: 1315 REDLDKI-TFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEI 1373
             +D  ++ +FLSRD++QQFGINLH+++   V EL+ K+L+C+ D     ++LEF +K E 
Sbjct: 1201 TKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITILEFFNKEEF 1260

Query: 1374 IEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMR 1433
              +S ++ARNY+PY  D+      +      KD +EL+RAD+++L+L YNL+ YW  R +
Sbjct: 1261 THISGSVARNYAPYGVDY------QTNNEATKDASELERADRIFLELFYNLRAYWAERSQ 1314

Query: 1434 ALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFK 1493
             L ++ +YE++Y +L+ KL+++D AV  +  ST  +    ++L +GN+MN   K A+G  
Sbjct: 1315 CLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN--KKPAEGIL 1372

Query: 1494 LSTLQRLTFIKDA-NNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDC 1552
            +S+L +L FIK + NN+++FL+++EK +R  +P    F++DL  V ++  +S++ +  +C
Sbjct: 1373 ISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVSLDHITMEC 1432

Query: 1553 KEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEF 1612
            KEF   +     ++  G L+     H              +A  +   L ++  L+    
Sbjct: 1433 KEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQQILTNHSI 1492

Query: 1613 ESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXX 1672
              +++ YGED                    +K+   +N+  EE ERLY+  K M+     
Sbjct: 1493 VKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRKYML----- 1547

Query: 1673 XXXXXXXXXNATEEDAS-EENEDRRAMMDKLLEQLKNAGPVKADPLSARK 1721
                     N++ +D+  E+N +    +DKLL +L+     K +PL  R+
Sbjct: 1548 --DNKLQKNNSSGDDSDLEKNTENDDAVDKLLLKLRGVEN-KPEPLRRRR 1594

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  240 bits (612), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 140/474 (29%), Positives = 253/474 (53%), Gaps = 36/474 (7%)

Query: 1260 KLKQLHWEKLDATDNSIW-SSGKAEKFAGDLYEKGVLEDLEKAFAAREIK------SLAT 1312
            +LKQ+HWEK++  ++++W  S + E+ A +L   G+ + +   F  + IK      + A+
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIKMKKRDTTTAS 911

Query: 1313 KKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPE 1372
            KK+      T L R+++QQFGINLHM+S L  +E V K+L+C  D +   SVLEF +K E
Sbjct: 912  KKQNG----TLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEE 967

Query: 1373 IIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRM 1432
            +  + T+L + ++PY+         E+ KS      EL+RAD+++ +L + L  YW  R 
Sbjct: 968  LTSIPTSLIQKFTPYA---------ENIKS----KFELERADRIFFELCFQLHSYWRERS 1014

Query: 1433 RALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGF 1492
              L ++ +YE++Y +L+ KL+KVD  +  +  S+  R+   +I+ +GNYMN   K   G 
Sbjct: 1015 NCLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGI 1072

Query: 1493 KLSTLQRLTFIKDA-NNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISD 1551
            ++ +L +L F+K + +N+++FL+++EKI+R  YP    F+ +L+ + D+ K+SI+QL  D
Sbjct: 1073 RIGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYD 1132

Query: 1552 CKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIME 1611
             +EF   I  +   ++ G L+ + +                 A  + EL+  ++KL   +
Sbjct: 1133 SQEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHD 1192

Query: 1612 FESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXX 1671
            +  +M+ +GED                 I  +K+   +N++ EE ER+Y+  +KM     
Sbjct: 1193 YAKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENIEKEEMERVYEQRQKMFDMRK 1252

Query: 1672 XXXXXXXXXXNATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMI 1725
                         +    E+N++ R+++D L+ QL+       +PL  R++  I
Sbjct: 1253 KEE--------EEQTQEKEQNDENRSIVDALIMQLRVVEK-PNEPLRDRRKTKI 1297

 Score = 38.5 bits (88), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 104/224 (46%), Gaps = 23/224 (10%)

Query: 515 ILEYSQWTMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAY- 573
           I EY    M  IN    G  + N++  +  +L++    ++  +   LD   + E +  Y 
Sbjct: 323 ITEYLSSCMFLINSIIEGFPLQNEKYSVLEKLKDVELPKLFFELSALDSKVIQEQIYRYK 382

Query: 574 ---ENLKLDDLNSVLETGAHASDIDMNDSASLLKKLFDYCKGTESEK----LLNSLVKHL 626
              EN++L  +N   E      DI    +  LL    +  K T  E+    LL+S++K  
Sbjct: 383 KNDENIRLKIIN---ENPLSIPDISYGATLMLL---IEKSKSTPLEEPIGALLDSVLK-- 434

Query: 627 FLSTSRLMEDNQDPTKLSKQLR-LMDSLVTNVSVSAVDESSSINMAIQ----RLYDSMQT 681
            L T    E  +    +S  L  L+D L  + ++S+ + ++S+   +Q    RL D++++
Sbjct: 435 ILDTRTYSESIKLFASVSSLLTYLVDKL--DSTISSAENANSLKPVLQDSIERLIDNLES 492

Query: 682 DEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLE 725
           DEVARRA+ E R     +++   E   L ++ + +   ++ QLE
Sbjct: 493 DEVARRAMKELRESETVIKDLNTEIHNLKREKNSSKEDILEQLE 536

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  234 bits (597), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 120/424 (28%), Positives = 233/424 (54%), Gaps = 26/424 (6%)

Query: 1257 ARKKLKQLHWEKLDATDNSIW-SSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSLATKKR 1315
            ++ +LKQ+HW+K++   +++W  + + ++   +L   G+   +E  F  ++   +A+KK 
Sbjct: 878  SKNRLKQIHWDKVEEIKDTLWEDTTQRQETLKELQTDGIFSQIEDIFKMKDPVKIASKKN 937

Query: 1316 EDL-----------DKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSV 1364
             +              ++FLSRD++QQFGINLHM+SQ+S  E V K+L C+ + +   ++
Sbjct: 938  GNSSTSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNI 997

Query: 1365 LEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNL 1424
            L+F  K E++ +  ++   Y PYS    G           K  ++LQRAD+++L+L  NL
Sbjct: 998  LKFFCKEELVSIPKSMLSKYEPYSQGKGG-----------KSVSDLQRADRIFLELCINL 1046

Query: 1425 QPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMND 1484
            + YW +R ++L  +++YER+Y +L+ KL+K+D  +  + +S   +++  +I  +GN+MN 
Sbjct: 1047 RSYWNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN- 1105

Query: 1485 SAKQAQGFKLSTLQRLTFIK-DANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKI 1543
              K  +G KL +L +L F++  A+ +++FL+++EK++R  YP    F++DL+ + D+ K+
Sbjct: 1106 -KKMVKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKV 1164

Query: 1544 SIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDE 1603
            S+E +  +C+EF   +         G L++                    A  + +LL +
Sbjct: 1165 SLEHVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVD 1224

Query: 1604 EVKLSIMEFESLMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTH 1663
            + KL++++   LM+ YGED                 +  +K+   +N++ EE ER+Y+  
Sbjct: 1225 QCKLTLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQR 1284

Query: 1664 KKMV 1667
            K ++
Sbjct: 1285 KNLL 1288

 Score = 33.1 bits (74), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 103/225 (45%), Gaps = 44/225 (19%)

Query: 547 ENAGGLRIMNQFKLLDYDKVMELVEAYENL-KLDDLNSVLETGAHASDIDMNDSASLLKK 605
           +NA  +  +N F+  +      +V   ENL     + SV+E G     ++      LL K
Sbjct: 385 DNAVIMEQINLFRTKESSIFDPMVPPTENLASFHPVKSVIEKGIQPVCLE----KCLLLK 440

Query: 606 LFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLS-KQLRLMDSLV---------- 654
             D    T   +++N+L K L         D+Q P   S K LRL++SL+          
Sbjct: 441 AKDSPVETPINEIVNALWKIL---------DSQRPYSESIKLLRLINSLLFYLIDSFQVP 491

Query: 655 TNVSVS-AVDES-------SSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAER 706
            N S   A+D+        S    +I +L DS+Q+D++ARRA++E   L  K+       
Sbjct: 492 LNASFDEALDQPQNTQNVDSVFQDSIDKLLDSLQSDDIARRAVIEIDDLNCKIST----- 546

Query: 707 DFLSQKLSKTGNGLVGQLEKEVQQRDDIL----EKNQRVTLQLQD 747
             L++++S   N    QL  ++ + + +L    ++N+ + LQL++
Sbjct: 547 --LNERISLVENYSKDQLLTKLDESEILLSLKTKENENLKLQLKE 589

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  233 bits (593), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 138/477 (28%), Positives = 254/477 (53%), Gaps = 28/477 (5%)

Query: 1259 KKLKQLHWEKLDATDNSIWSSGKAE-KFAGDLYEKGVLEDLEKAFAARE--IKSLATKKR 1315
            K +KQ+HWEK+  T  S+W           +L   G+  ++E  F +++  IK    K +
Sbjct: 968  KNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDAVIKRRNPKDQ 1027

Query: 1316 EDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSKPEIIE 1375
                 +T L R+++QQFGINLHM+SQ+S ++L  K+L+C+       SV+EF +  ++  
Sbjct: 1028 TQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNEDLTN 1087

Query: 1376 VSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGSRMRAL 1435
            + +N+ R + PYS D+    K   +K P KD +EL R D ++L L YNL+ YW  R + L
Sbjct: 1088 IPSNICRTFEPYSIDY----KTPGSK-PTKDISELSRVDHIFLLLCYNLRSYWKERSQCL 1142

Query: 1436 RVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLS 1495
             ++ +YE++Y +L+ KL ++D+A+  I+ S  L++V  +I+A+GN+MN   K   G +LS
Sbjct: 1143 LMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGIRLS 1200

Query: 1496 TLQRLTFIKDANNS-MTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLISDCKE 1554
            +L +LT+IK  + S  +FL+++E+++R  YP    F  DL+ V ++  ++++ L  +  +
Sbjct: 1201 SLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLEYDD 1260

Query: 1555 FSQSITNVERSIDIGNLNDSSKFHXXXXXXXXXXXXXXEASKRVELLDEEVKLSIMEFES 1614
             S  I  V RSI  G L++    H               A+ +  +L ++  L+ ++ E 
Sbjct: 1261 LSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRTILQDKFTLTNIDLEK 1320

Query: 1615 LMQRYGEDXXXXXXXXXXXXXXXXXINEYKRAQAQNLKAEEEERLYQTHKKMVXXXXXXX 1674
            L+  +GED                 +  +++   +N++ EE +R+Y+  ++++       
Sbjct: 1321 LLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADRVYEQRRQLLDSKIQ-- 1378

Query: 1675 XXXXXXXNATEEDAS--EENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKKM 1729
                      + D+S  E  ED++  +D+LL++L+        P +A +R    K++
Sbjct: 1379 ---------AQWDSSMDEIEEDQQDAVDQLLKKLRGV----EQPTTAVRRRKSSKRL 1422

>YLR189C Chr12 complement(530797..534393) [3597 bp, 1198 aa] {ON}
            ATG26UDP-glucose:sterol glucosyltransferase, conserved
            enzyme involved in synthesis of sterol glucoside membrane
            lipids; in contrast to ATG26 from P. pastoris, S.
            cerevisiae ATG26 is not involved in autophagy
          Length = 1198

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 47/110 (42%), Gaps = 11/110 (10%)

Query: 913  SKFNVEERVNELFKQKKLSALDRLNDLENMYKEYG--IDLSTHFPIQDEPQESAESEKNA 970
            S+F   ER N  F++ K     ++ D+E +YK+    ID S H  I    QE ++ +  A
Sbjct: 466  SRFRFRERSNSWFRRAKPLEDSQVEDVEEIYKDAANDIDSSVHSTIHIHEQEDSQEQTVA 525

Query: 971  EGPSTL---------DPRAYQAKLDEIDRISKELIEMKSELKNDKALRRH 1011
              PS L          P  Y+ K     +    LI+   E+  ++  R H
Sbjct: 526  WKPSHLKNFAEMWAAKPIHYRNKFIPFQKDDTYLIKETEEVSANERFRYH 575

>Skud_12.254 Chr12 complement(477413..481024) [3612 bp, 1203 aa] {ON}
            YLR189C (REAL)
          Length = 1203

 Score = 35.8 bits (81), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 11/110 (10%)

Query: 913  SKFNVEERVNELFKQKKLSALDRLNDLENMYKEYG--IDLSTHFPIQDEPQESAESEKNA 970
            S+F    R N  F++ KL    ++ D+E +YK+    ID S H  IQ   QE  + +   
Sbjct: 471  SRFRFRGRSNSWFRRAKLLEDSQIEDVEEIYKDATDDIDSSVHSTIQVHEQEDNQEQIMD 530

Query: 971  EGPSTL---------DPRAYQAKLDEIDRISKELIEMKSELKNDKALRRH 1011
              PS L          P  Y+ +  E ++    LI++  E+  ++  R H
Sbjct: 531  WKPSHLKNFAEMWAAKPIHYRNECIEFEKNDTYLIKVAEEVSANERFRYH 580

>SAKL0F06446g Chr6 (498840..501677) [2838 bp, 945 aa] {ON} similar
           to uniprot|P53258 Saccharomyces cerevisiae YGR100W MDR1
           Cytoplasmic GTPase-activating protein for Ypt/Rab
           transport GTPases Ypt6p Ypt31p and Sec4p involved in
           recycling of internalized proteins and regulation of
           Golgi secretory function
          Length = 945

 Score = 35.8 bits (81), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 67/136 (49%), Gaps = 15/136 (11%)

Query: 585 LETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLME--DNQDPTK 642
           +  G  +S++D +  +  L K  D+CK +E++ L+ +  K       RL E  D  D  +
Sbjct: 563 ISMGTGSSNMDFDAFSQFLSKFCDWCKPSEND-LIPNFRKQKSGFLKRLFEKWDTADTGE 621

Query: 643 LS--KQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILE-SRTLTKKL 699
           L+    +  +D LVT   +++++E          LYD   T E+ R A+L+ S  L    
Sbjct: 622 LTLNNVVAGLDRLVTKDLMASLNEFFG-------LYDKTGTGEIEREAVLQMSEGLLFLT 674

Query: 700 EEAQAER--DFLSQKL 713
           E  ++ +  D+L+QKL
Sbjct: 675 EPWKSGKYVDYLTQKL 690

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 35.4 bits (80), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 868 QAPVKVESSNYVRKENELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFK- 926
           Q P  ++S N V   +E   KEL  ++L+EL K  AD  K S+  SK + EE  NEL+  
Sbjct: 91  QEPQALKSFNAVIDSDESSFKELSVSRLNELNKKYADWNKISDPASKTD-EELFNELYDS 149

Query: 927 -QKKLSALDRLNDLENMYKE 945
              KL   D +  LE  ++E
Sbjct: 150 ISTKLGKPDSMEYLEAKFQE 169

>CAGL0C05247g Chr3 (501476..502549) [1074 bp, 357 aa] {ON} highly
            similar to uniprot|P32179 Saccharomyces cerevisiae
            YOL064c MET22
          Length = 357

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 1067 NSSERKGHSRQSFMERMKKPSGVPAYLEELPLKVPKAPPLGVAETEDSSDNIA-EDVEKE 1125
              S+  G+    ++    K  G  A+      KVP   P+ V + +D+S+ I+ E VEK 
Sbjct: 184  GGSDLPGYKEFGYLFSAIKTQG--AFYATCSTKVPDWKPIKVRQLKDTSEMISLEGVEKS 241

Query: 1126 SAEHDEQEE 1134
             + HDEQ +
Sbjct: 242  HSSHDEQSQ 250

>SAKL0F13398g Chr6 complement(1060920..1062029) [1110 bp, 369 aa] {ON}
            similar to uniprot|P37366 Saccharomyces cerevisiae
            YPR025C CCL1 Cyclin associated with protein kinase Kin28p
            which is the TFIIH-associated carboxy-terminal domain
            (CTD) kinase involved in transcription initiation at RNA
            polymerase II promoters
          Length = 369

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 44/95 (46%), Gaps = 17/95 (17%)

Query: 928  KKLSALDRLNDLENMYKEYGIDLSTHFPIQDE--------------PQESAESEKNAEGP 973
            KKL     L D+  +Y    I L+T   I+DE               +E  E EKNAE P
Sbjct: 233  KKLITDALLTDVIYLYTPPQITLATLL-IEDEVLTTRYLELKFGSNEEEKTEGEKNAEAP 291

Query: 974  STLDPRAYQAKLDEIDRISKELIEMKSELKNDKAL 1008
            ++  P+ YQ  LD I R  K+ I +K  L  + A+
Sbjct: 292  ASTMPK-YQRLLDLIQR-CKDTISVKPNLSKEAAI 324

>Suva_10.285 Chr10 complement(503424..507020) [3597 bp, 1198 aa] {ON}
            YLR189C (REAL)
          Length = 1198

 Score = 33.5 bits (75), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 45/110 (40%), Gaps = 11/110 (10%)

Query: 913  SKFNVEERVNELFKQKKLSALDRLNDLENMYKEYG--IDLSTHFPIQDEPQESAESEKNA 970
            SKF   ER N  F++ K     ++ D+E +YK+    ID S +  IQ   Q   + +   
Sbjct: 466  SKFGFRERSNSWFRKAKPLEDSQIEDVEEIYKDIADDIDSSVYSTIQVHDQGDNQDQTVD 525

Query: 971  EGPSTL---------DPRAYQAKLDEIDRISKELIEMKSELKNDKALRRH 1011
              PS L          P  YQ K  E  +    L++   E   ++  R H
Sbjct: 526  WKPSHLKNFADMWAAKPIHYQNKYVEFGKDDTYLVKETEEFSANERFRYH 575

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 172,925,420
Number of extensions: 7320228
Number of successful extensions: 34840
Number of sequences better than 10.0: 462
Number of HSP's gapped: 36036
Number of HSP's successfully gapped: 572
Length of query: 1879
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1755
Effective length of database: 39,262,815
Effective search space: 68906240325
Effective search space used: 68906240325
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 73 (32.7 bits)