Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C061801.83ON58358327850.0
YEL063C (CAN1)1.83ON59051521210.0
Suva_5.41.83ON59051521200.0
Smik_5.241.83ON59051521190.0
NDAI0A006101.83ON56551721030.0
KNAG0C007901.83ON57951620870.0
Skud_5.261.83ON59051520820.0
TPHA0B044801.83ON60351520480.0
CAGL0J08184g1.83ON57256220190.0
NCAS0B085701.83ON53251320040.0
SAKL0C02662g1.83ON54851419530.0
Kpol_2000.651.83ON59551819390.0
TBLA0A054501.83ON60651419170.0
Smik_14.671.83ON57358218970.0
ZYRO0F16654g1.83ON58051618900.0
SAKL0C02640gsingletonON54851418850.0
YNL270C (ALP1)1.83ON57351218850.0
NCAS0A006001.83ON54452018750.0
Skud_14.701.83ON57351118690.0
NDAI0F042001.83ON56651818680.0
SAKL0C02684gsingletonON58858118690.0
KNAG0C05920singletonON59951518670.0
Kwal_33.134011.83ON55950718560.0
KAFR0D007001.83ON57452318470.0
Suva_14.731.83ON49747918370.0
KLTH0F02398g1.83ON55551118130.0
KLLA0C02343g1.83ON58152017990.0
NDAI0F041901.84ON59951117800.0
NCAS0A006101.84ON60751317780.0
TPHA0B044701.84ON59951617590.0
TBLA0A054601.84ON60851617570.0
TDEL0C061701.84ON57351617500.0
CAGL0J08162g1.84ON59751217520.0
Smik_14.681.84ON61150817510.0
YNL268W (LYP1)1.84ON61151617470.0
KNAG0F004801.84ON59751117420.0
Kpol_2000.641.84ON61051617430.0
Suva_14.751.84ON61151117390.0
Skud_14.711.84ON61251117360.0
Ecym_10871.83ON57058617290.0
Ecym_10881.84ON56751717260.0
KLTH0F02420g1.84ON62151517310.0
KAFR0D039401.83ON59752317070.0
Kwal_33.134111.84ON56051616940.0
SAKL0C02728g1.84ON56251516910.0
KLLA0C02365g1.84ON57951116680.0
AFR667C1.84ON56351815980.0
ZYRO0F16632g1.84ON60751515850.0
AFR668W1.83ON55650915640.0
KAFR0B06430singletonON5935228831e-110
Kpol_358.3na 1ON5755198821e-110
CAGL0A01199gna 1ON6135368841e-110
Kwal_26.69407.44ON5705328781e-110
TBLA0A07060na 1ON6255178821e-110
SAKL0G14916gna 1ON5815158641e-108
Kwal_33.15545na 1ON5765028561e-107
TPHA0M00130singletonON6115238521e-106
YPL265W (DIP5)na 1ON6085208511e-106
KLLA0E16281gna 1ON6055168481e-105
Skud_16.12na 1ON6075208471e-105
Smik_6.473na 1ON6065208461e-105
Suva_16.40na 1ON6065208441e-104
KLTH0B01166gna 1ON5775028411e-104
Ecym_2480na 1ON5865408291e-103
KLTH0D01474g7.44ON6245198321e-102
KNAG0E003907.44ON5995298291e-102
NCAS0D02260na 1ON5975158281e-102
TDEL0C00930singletonON5954998221e-101
KNAG0L02470singletonON6385098241e-101
CAGL0E05632g7.44ON5985228171e-100
ZYRO0D03762g1.244ON6004968131e-100
Ecym_60211.244ON6005038121e-100
TPHA0H028507.44ON6015258111e-100
NDAI0E038007.44ON6215378111e-99
Skud_11.2751.244ON6025228091e-99
NDAI0I02660na 1ON5945188063e-99
TDEL0H040707.44ON5775238028e-99
NDAI0B052201.244ON6115108049e-99
Kpol_367.77.44ON5845308011e-98
SAKL0C01232gsingletonON6135088022e-98
SAKL0F09790gsingletonON5585177982e-98
AFR156W7.44ON5585117912e-97
Kwal_27.126811.244ON5935037923e-97
KNAG0C02140singletonON5984977925e-97
TPHA0B010901.244ON6065007864e-96
YKR039W (GAP1)1.244ON6025227831e-95
SAKL0G14014g5.158ON6055057821e-95
YOR348C (PUT4)7.44ON6275307832e-95
Kwal_33.154075.158ON5875077793e-95
KAFR0D005001.50ON6175297813e-95
SAKL0B10956g7.44ON5725037774e-95
KNAG0L02460singletonON5885067775e-95
Suva_8.4027.44ON6835307837e-95
Ecym_80357.44ON5635177749e-95
KAFR0A011203.284ON5925137723e-94
Smik_15.5327.44ON6315307744e-94
KLLA0A11770g5.158ON5815267681e-93
CAGL0B01012g1.50ON6235207692e-93
TDEL0C065101.50ON6425287693e-93
Suva_4.3073.284ON6095847655e-93
ZYRO0D17908gna 1ON5184997561e-92
NCAS0E022607.44ON5935327621e-92
SAKL0C01650g1.50ON6135087622e-92
KLTH0E15642g1.244ON5964967602e-92
Kpol_543.791.244ON6055067603e-92
NCAS0B079001.244ON6195047603e-92
Skud_15.5157.44ON6265347605e-92
Smik_3.531.50ON6335037605e-92
Suva_2.6881.50ON6615157626e-92
NDAI0D021605.158ON5875117567e-92
CAGL0L03267g1.244ON5975067577e-92
Skud_3.381.50ON6335037598e-92
Smik_11.3021.244ON5534757521e-91
YCL025C (AGP1)1.50ON6335087571e-91
KLLA0F23419g7.44ON5735267522e-91
KLTH0B02046g5.158ON5895107532e-91
YBR068C (BAP2)3.284ON6095157524e-91
KAFR0D00510na 2ON6174937525e-91
NCAS0A071105.158ON5925047498e-91
TDEL0A08030singletonON5144777438e-91
Suva_7.4855.158ON6035057499e-91
Skud_4.7841.50ON6635247512e-90
SAKL0D02970g3.284ON6015917472e-90
YDR508C (GNP1)1.50ON6635167513e-90
SAKL0D00836gna 3ON6015017463e-90
CAGL0K05753g1.50ON6605147503e-90
NDAI0A006401.50ON6414927484e-90
Suva_3.1891.50ON6335157474e-90
CAGL0B03773g5.158ON6055017455e-90
Suva_11.2731.244ON6015037437e-90
Kwal_33.132041.50ON6075177421e-89
Suva_2.716singletonON6035037411e-89
AFR698C1.50ON6095077422e-89
Ecym_47895.158ON5884987374e-89
ACL135Wna 1ON5885067366e-89
SAKL0D04664g1.244ON5934977358e-89
NCAS0B085801.50ON6275057371e-88
Smik_16.1155.158ON6035117351e-88
Skud_7.5255.158ON6035127342e-88
Smik_4.7901.50ON6635167382e-88
Kwal_23.4026singletonON5345087282e-88
TPHA0E036601.50ON6475087372e-88
KLLA0A06886gsingletonON5875007313e-88
Ecym_10561.50ON6065117324e-88
KAFR0C051607.44ON5845107297e-88
Kwal_33.14276na 3ON5965047281e-87
Skud_2.1913.284ON6095917291e-87
TBLA0C01240singletonON6295207292e-87
AFR230C1.244ON6045077272e-87
YGR191W (HIP1)5.158ON6035037262e-87
KAFR0D00520na 4ON5985217262e-87
Kwal_26.9612singletonON5435017213e-87
Smik_13.1singletonON5235047203e-87
KLTH0F01584g1.50ON5965127201e-86
SAKL0C13992gsingletonON5524997172e-86
Kpol_1010.325.158ON5995127202e-86
TPHA0A002405.158ON6035117202e-86
YFL055W (AGP3)na 5ON5585007162e-86
KLLA0C01606g1.50ON6205247203e-86
Kpol_2000.921.50ON6375307204e-86
NDAI0G060301.368ON5995147175e-86
TBLA0A05190na 4ON6675147216e-86
TBLA0B077605.158ON6585107216e-86
KLLA0A06930g1.244ON5875007156e-86
Smik_4.2843.284ON6045087167e-86
KAFR0D04120na 4ON6485217197e-86
TBLA0A051801.50ON6765137219e-86
Suva_2.2033.284ON6045087151e-85
Smik_2.2013.284ON6095107151e-85
Kpol_543.78singletonON6055097142e-85
YDR046C (BAP3)3.284ON6045087142e-85
TPHA0A047005.158ON5694937112e-85
Skud_6.2na 5ON5584997093e-85
Ecym_26643.285ON5755077094e-85
KAFR0E018505.158ON5605267075e-85
NCAS0A106803.284ON5935097097e-85
KNAG0G009005.158ON6135117082e-84
NDAI0A056203.284ON5715147023e-84
AGR319W5.158ON6265087064e-84
KNAG0J022003.284ON6075087036e-84
Ecym_26623.284ON5895167019e-84
AGR039Cna 6ON5865107001e-83
KLLA0F27093gsingletonON5635016981e-83
CAGL0H08393g3.284ON6125127021e-83
Kpol_2002.441.50ON6275047021e-83
NDAI0C029505.158ON6094657002e-83
KLTH0C05170g3.284ON5985066983e-83
KLTH0F01606gna 4ON6045016983e-83
AGR038C3.284ON5805156964e-83
SAKL0D02948gna 6ON5945056965e-83
NCAS0D018705.158ON5955066966e-83
Kpol_534.221.368ON5925156941e-82
Skud_4.3003.284ON6045086941e-82
TDEL0E05750singletonON5485036873e-82
Kwal_23.2817na 7ON5805216893e-82
Ecym_2663na 6ON5895106895e-82
KNAG0H011503.284ON6175106906e-82
ZYRO0F17446g1.50ON6335076918e-82
ZYRO0A00308gsingletonON5645066868e-82
NCAS0I015303.284ON5955106889e-82
KAFR0C004003.284ON5825086861e-81
TBLA0G031203.284ON6735076893e-81
NCAS0A089201.368ON5995146844e-81
AEL030W1.368ON5825156825e-81
KAFR0D041401.50ON6375236831e-80
NDAI0A074903.284ON5965186782e-80
Smik_6.482na 8ON5585216752e-80
Kwal_8.590na 9ON6295126803e-80
KLTH0F04048gsingletonON5835296764e-80
SAKL0D02926g3.285ON5835076738e-80
YOL020W (TAT2)1.368ON5925146731e-79
KLTH0B00154gna 9ON5565216701e-79
SAKL0F16544gsingletonON5675366702e-79
ZYRO0G12342g3.284ON6205156732e-79
TDEL0F02830na 10ON5614966692e-79
NCAS0A004201.50ON6795156763e-79
TBLA0C012101.368ON6005156704e-79
KNAG0F002701.50ON6345186725e-79
CAGL0M00154gsingletonON5504986665e-79
Skud_15.1381.368ON5925146685e-79
KLTH0H13398g1.368ON5875046678e-79
Suva_13.517singletonON5475216649e-79
Kwal_27.105383.284ON6025106643e-78
KLLA0A10813g1.368ON5845146591e-77
Suva_15.1481.368ON5925146591e-77
Smik_15.1461.368ON5935146572e-77
Skud_16.2na 8ON4964956502e-77
CAGL0D02178g1.368ON5775146562e-77
AGR040C3.285ON5735056553e-77
KLLA0B14685gna 7ON5715246545e-77
NDAI0F043901.50ON6674926597e-77
Ecym_27161.368ON5925276531e-76
Kwal_33.13215na 4ON5985096521e-76
ZYRO0C18502g7.44ON5755356502e-76
Sklu_YGOB_Anc_1.3681.368ON5414626454e-76
SAKL0H08184gna 11ON5985036451e-75
CAGL0L07546g3.284ON6345226472e-75
KAFR0D04130na 2ON6445016472e-75
SAKL0A09724gna 12ON5515016385e-75
KNAG0J022103.285ON5815096406e-75
NCAS0J00140na 5ON5584956387e-75
TPHA0B047501.50ON6395156411e-74
Ecym_8297na 11ON5695186371e-74
ZYRO0G07172gna 10ON5674966361e-74
KLTH0D07128gna 12ON5435016314e-74
TDEL0D00200singletonON5675376335e-74
TPHA0M012003.284ON6075726355e-74
ADL272Wna 11ON5645016309e-74
KNAG0C005901.50ON6345106351e-73
KNAG0L00110na 5ON5714996292e-73
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C06180
         (583 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...  1077   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   821   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   821   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   820   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   814   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              808   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   806   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   793   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   782   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            776   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   756   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   751   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   743   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   735   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   732   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   730   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   730   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   726   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   724   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            724   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   724   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            723   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   719   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   716   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   712   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   702   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   697   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   690   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              689   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   682   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   681   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   678   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   679   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   679   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   677   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                675   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   676   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   674   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   673   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   670   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   669   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   671   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   662   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   657   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   655   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   647   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   620   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   615   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   607   0.0  
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   344   e-110
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   344   e-110
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   345   e-110
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   342   e-110
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   344   e-110
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   337   e-108
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   334   e-107
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     332   e-106
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   332   e-106
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   331   e-105
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   330   e-105
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   330   e-105
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   329   e-104
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   328   e-104
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   323   e-103
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   325   e-102
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   323   e-102
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              323   e-102
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   321   e-101
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             322   e-101
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   319   e-100
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   317   e-100
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   317   e-100
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   317   e-100
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     317   1e-99
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   316   1e-99
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   315   3e-99
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   313   8e-99
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   314   9e-99
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   313   1e-98
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   313   2e-98
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   311   2e-98
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   309   2e-97
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   309   3e-97
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   309   5e-97
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   307   4e-96
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   306   1e-95
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   305   1e-95
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   306   2e-95
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   304   3e-95
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      305   3e-95
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   303   4e-95
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             303   5e-95
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   306   7e-95
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   302   9e-95
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   301   3e-94
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   302   4e-94
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   300   1e-93
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   300   2e-93
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   300   3e-93
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   299   5e-93
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   295   1e-92
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     298   1e-92
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   298   2e-92
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   297   2e-92
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   297   3e-92
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   297   3e-92
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   297   5e-92
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   297   5e-92
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   298   6e-92
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    295   7e-92
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   296   7e-92
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   296   8e-92
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   294   1e-91
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   296   1e-91
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   294   2e-91
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   294   2e-91
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   294   4e-91
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      294   5e-91
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   293   8e-91
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            290   8e-91
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   293   9e-91
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   293   2e-90
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   292   2e-90
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   293   3e-90
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   291   3e-90
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   293   3e-90
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   292   4e-90
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   292   4e-90
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   291   5e-90
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   290   7e-90
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   290   1e-89
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   290   1e-89
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   290   2e-89
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   288   4e-89
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   288   6e-89
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   287   8e-89
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   288   1e-88
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   287   1e-88
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   287   2e-88
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   288   2e-88
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   285   2e-88
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   288   2e-88
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   286   3e-88
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   286   4e-88
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   285   7e-88
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   285   1e-87
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   285   1e-87
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   285   2e-87
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   284   2e-87
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   284   2e-87
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   284   2e-87
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   282   3e-87
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    281   3e-87
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   281   1e-86
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   280   2e-86
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   281   2e-86
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   281   2e-86
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   280   2e-86
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   281   3e-86
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   281   4e-86
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   280   5e-86
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   282   6e-86
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   282   6e-86
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   280   6e-86
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   280   7e-86
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   281   7e-86
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   282   9e-86
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   280   1e-85
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   280   1e-85
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   279   2e-85
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   279   2e-85
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   278   2e-85
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      277   3e-85
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   277   4e-85
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   276   5e-85
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   277   7e-85
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   277   2e-84
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            275   3e-84
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   276   4e-84
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   275   6e-84
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   274   9e-84
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   274   1e-83
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   273   1e-83
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   275   1e-83
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   275   1e-83
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    274   2e-83
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   273   3e-83
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   273   3e-83
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   272   4e-83
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   272   5e-83
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   272   6e-83
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   271   1e-82
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   271   1e-82
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            269   3e-82
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   270   3e-82
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   270   5e-82
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              270   6e-82
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   270   8e-82
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   268   8e-82
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              269   9e-82
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                268   1e-81
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              270   3e-81
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   268   4e-81
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   267   5e-81
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              267   1e-80
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   265   2e-80
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   264   2e-80
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   266   3e-80
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   265   4e-80
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   263   8e-80
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   263   1e-79
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   262   1e-79
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   262   2e-79
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   263   2e-79
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   262   2e-79
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   265   3e-79
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   262   4e-79
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   263   5e-79
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   261   5e-79
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   261   5e-79
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   261   8e-79
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   260   9e-79
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   260   3e-78
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   258   1e-77
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   258   1e-77
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   257   2e-77
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   254   2e-77
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   257   2e-77
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   256   3e-77
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   256   5e-77
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   258   7e-77
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   256   1e-76
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   255   1e-76
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   254   2e-76
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   253   4e-76
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   253   1e-75
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   253   2e-75
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              253   2e-75
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   250   5e-75
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   251   6e-75
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      250   7e-75
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   251   1e-74
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   249   1e-74
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   249   1e-74
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   247   4e-74
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                248   5e-74
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   249   5e-74
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   247   9e-74
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   249   1e-73
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   246   2e-73
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   246   3e-73
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              245   5e-73
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   246   6e-73
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   242   1e-72
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   242   2e-72
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   243   2e-72
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   243   4e-72
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   244   5e-72
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   244   5e-72
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              243   6e-72
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   241   7e-72
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   241   2e-71
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   239   3e-71
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   240   1e-70
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   240   3e-70
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              236   1e-69
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   236   1e-69
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   236   2e-69
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   235   3e-69
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   240   4e-69
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   235   7e-69
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              233   2e-68
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   233   3e-68
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   231   8e-68
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   231   1e-67
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   231   2e-67
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   231   3e-67
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   230   3e-67
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    230   3e-67
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   235   5e-67
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   229   1e-66
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   227   2e-66
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   232   4e-66
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   232   4e-66
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   227   5e-66
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   226   2e-65
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   225   3e-65
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   225   3e-65
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   224   6e-65
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   224   7e-65
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   224   7e-65
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   223   2e-64
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   223   2e-64
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   226   4e-64
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   220   1e-63
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   225   2e-63
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   224   4e-63
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   219   5e-63
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              219   5e-63
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   218   5e-63
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   219   5e-63
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   219   6e-63
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   218   1e-62
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   217   3e-62
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   221   4e-62
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   220   5e-62
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   216   6e-62
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   214   1e-61
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   219   2e-61
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   217   1e-60
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   210   1e-60
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   211   2e-60
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                211   5e-60
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   215   6e-60
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   210   1e-59
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      210   1e-59
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   207   7e-59
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   206   1e-58
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   206   5e-58
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   204   9e-58
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   205   1e-57
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   208   1e-57
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   204   1e-57
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                204   2e-57
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   199   4e-56
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   203   9e-56
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   199   1e-55
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   202   1e-55
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   197   3e-55
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   202   3e-55
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   201   4e-55
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   199   1e-54
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   199   4e-54
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   194   5e-54
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     179   2e-50
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     178   3e-50
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   175   2e-46
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         126   2e-31
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   122   5e-31
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          90   3e-20
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      90   4e-19
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          88   4e-19
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    86   7e-19
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     90   8e-19
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      74   1e-15
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      74   5e-15
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    55   1e-07
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    49   3e-05
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              40   0.007
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    38   0.047
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    37   0.11 
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    37   0.12 
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    36   0.28 
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    35   0.48 
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    35   0.81 
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    34   0.88 
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    34   1.2  
KAFR0H00960 Chr8 (179275..179315,179370..179685) [357 bp, 118 aa...    32   1.6  
KAFR0A06250 Chr1 complement(1262105..1263832) [1728 bp, 575 aa] ...    32   4.4  
TPHA0B01060 Chr2 complement(241062..242822) [1761 bp, 586 aa] {O...    32   6.3  
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    32   6.6  

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score = 1077 bits (2785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/583 (93%), Positives = 548/583 (93%)

Query: 1   MWNAKQDVSEEGYELGNFSGMNDEDSSSGQAGAINHRKKSVVSKTTAVXXXXXXXXXXXX 60
           MWNAKQDVSEEGYELGNFSGMNDEDSSSGQAGAINHRKKSVVSKTTAV            
Sbjct: 1   MWNAKQDVSEEGYELGNFSGMNDEDSSSGQAGAINHRKKSVVSKTTAVDESLPGLSSSDL 60

Query: 61  XXXXXFVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYL 120
                FVKEGQVHEAEVKRALKQRH                  STPLSNAGPVGGLIAYL
Sbjct: 61  ESSDDFVKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYL 120

Query: 121 FMATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSV 180
           FMATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSV
Sbjct: 121 FMATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSV 180

Query: 181 VGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLC 240
           VGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLC
Sbjct: 181 VGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLC 240

Query: 241 MVCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITA 300
           MVCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITA
Sbjct: 241 MVCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITA 300

Query: 301 GEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIE 360
           GEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIE
Sbjct: 301 GEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIE 360

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
           NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV
Sbjct: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
           FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD
Sbjct: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIW 540
           LPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIW
Sbjct: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIW 540

Query: 541 FRCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           FRCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA
Sbjct: 541 FRCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/515 (76%), Positives = 439/515 (85%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           EG+V  AEVKR LKQRH                  STPL+NAGPVG LI+YLFM +L YS
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V QSLGEMATFIPVTS+FTVFS RFLSPAFGAA+GYMYWFSWAITFALELSVVGQ+I+FW
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           T  VP+AAWI+IFWV++T+ NLFPVKYYGEFEFW+A IKV+A++GF+IYC CMVCGAG+T
Sbjct: 196 TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT 255

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK
Sbjct: 256 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           SVPRAIKKVVFRIL FY    +FIGLLVPYNDPKL  S SYVS+SPFIIAIENSGTKVLP
Sbjct: 316 SVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLP 375

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
           HIFNAV+LTTIISA NSN+YVGSRI++GL+K KLAP F  RT   GVPY AVF T+AFGA
Sbjct: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           LAYME STGG   F WLLNITGVAGFF W+ IS  HIRFMQALKYRGISRD+LPFKAK M
Sbjct: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR 548
           P LAYYA  FM +II+IQGFTAFAP F+GV FAAAY+S+FLF+A+W+  Q  FRCR   +
Sbjct: 496 PGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWK 555

Query: 549 LDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           + +VDID+DRRDIEA+VW+D  PKT WDKFWN+VA
Sbjct: 556 IGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/515 (76%), Positives = 443/515 (86%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           EG+V  AEVKR LKQRH                  STPL+NAGPVG LI+YLFM +L YS
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V QSLGEMATFIPVTS+FTVFS RFLSPAFGAA+GYMYWFSWA+TFALELSVVGQ+I+FW
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           T AVP+AAWI+IFWV++T  N+FPVKYYGEFEFW+A IKVIA++GF+IYC CMVCGAG+T
Sbjct: 196 TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           GPVGFRYWRNPGAWGPGIISK+KNE RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK
Sbjct: 256 GPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           +VPRAIKKVVFRIL FY    +FIGLLVPYNDPKL S+ SYVS+SPFIIAIENSGTKVLP
Sbjct: 316 TVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLP 375

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
           HIFNAV+LTTIISA NSN+YVGSR+++GL+K KLAP FF +T   GVPY AVF TS FGA
Sbjct: 376 HIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGA 435

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           LAYME STGG   F WLLNITGVAGFF W+ IS  HIRFMQALKYRGISRD+LPFKAK M
Sbjct: 436 LAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLM 495

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR 548
           P LAYYA FFMVVIILIQGFT+F PTF+GV+F AAY+SVFLF+AIW+  ++ FRCR   +
Sbjct: 496 PGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWK 555

Query: 549 LDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +++VDID+DRRDIEA+VW++  PKTLWDKFWN+V 
Sbjct: 556 IEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/515 (75%), Positives = 440/515 (85%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G+V  AEVKR LKQRH                  S PL+NAGPVG LI+YLFM +L YS
Sbjct: 76  QGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYS 135

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V QSLGEMATFIPVTS+FTVFS RFLSPAFGAA+GYMYWFSWAITFALELSVVGQ+IEFW
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFW 195

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           T  VP+AAWI+IFWV++T+ NLFPVKYYGEFEFW+A IKV+A++GF+IYC CMVCGAG+T
Sbjct: 196 TNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT 255

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK
Sbjct: 256 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           +VPRAIKKVVFRIL FY    +FIGLLVPYNDPKL ++ SYVS SPFIIAIENSGTKVLP
Sbjct: 316 TVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVSPFIIAIENSGTKVLP 375

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
           HIFNAV+LTTIISA NSN+YVGSRI++GL+K KLAP F  RT   GVPY AVF T+ FGA
Sbjct: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGA 435

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           LAYME STGG   F WLLNITGVAGFF W+LIS  HIRFMQALKYRGISRD+LPFKAK M
Sbjct: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLM 495

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR 548
           P LAY+A  FM++IILIQGFTAFAP F G+DF AAY+S+FLF+AIW+  +I FRCR   +
Sbjct: 496 PGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFIWK 555

Query: 549 LDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +++VDID+DRRDIEA+VW+D  PKT WDKFWN+VA
Sbjct: 556 IEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/517 (75%), Positives = 442/517 (85%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           +  GQ+ EAEVKR LKQRH                  STPL+NAGPVG LIAYLFM TLV
Sbjct: 49  IANGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLV 108

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           YSV QSLGEMATFIPVTS+FTVFS RFLSP+FGAA+GYMYWFSWAITFALELSVVGQII+
Sbjct: 109 YSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQ 168

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
           FWT+AVP+ AWI+IFWVLL   N+FPV++YGEFEFW+A IKV+A++GF+IYCLCMVCGAG
Sbjct: 169 FWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228

Query: 247 ITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
           +TGPVGFRYWRNPG  GPGII+K+ NE +FLGWVSSLINAAFTYQGTELVGITAGEAANP
Sbjct: 229 VTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANP 288

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKV 366
           RKSVPRAIKKVVFRIL FY     FIGLLVPYNDPKL S DSYV++SPFII+I+NSGT +
Sbjct: 289 RKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPI 348

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           LPHIFNAV+L+TIISA NSNVYVGSRIM+GL+K KLAP    RTN  GVP+ +V FT  F
Sbjct: 349 LPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLF 408

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           GALAYME STGG +AFNWLLNITGVAGFF+W+ IS  H+RFMQAL+YRGISRDDLPFKAK
Sbjct: 409 GALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAK 468

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIF 546
           FMP LAYYA+FFM +II+IQGFT+F P+F G+DF AAY+S FLFIAIW+  Q+WFRCR+ 
Sbjct: 469 FMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLI 528

Query: 547 HRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
            ++++VDIDTDRRDIE VVW+D PP T WDKFWN+VA
Sbjct: 529 WKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/516 (75%), Positives = 434/516 (84%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           + G VH+AEVKR LKQRH                  STPL  AGPVG LI+Y+FM TLVY
Sbjct: 64  QTGYVHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVY 123

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           SV QSLGEMATFIPVTS+FTVF+ RFLSP+ GAA+GYMYWFSWA+TFALELSV+GQ+I++
Sbjct: 124 SVTQSLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQY 183

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           WT AVP+AAWI+IFWV++T  N+FPVKYYGE EFWIAFIKVIA+VGF++YCLCMVCGAG+
Sbjct: 184 WTYAVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGV 243

Query: 248 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
           TGPVGFRYWRNPG WGPGIISKDKNE RFLGWVSSLIN AFTYQGTELVGI+AGEAANPR
Sbjct: 244 TGPVGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPR 303

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K+VPRAIKKVVFRIL FY     FIGLLVPYND  LN++DSYV+SSPFIIAI+NSGT VL
Sbjct: 304 KAVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVL 363

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           PHIFNAV+  TI+SAGNSNVYVGSRI++GL+K KLAP    RT   GVP+ AV  TS  G
Sbjct: 364 PHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVG 423

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
           ALAYME STGG +AFNWLLNIT VAGFFTW+ IS  HIRFMQALKYRGISRDDLPFKA  
Sbjct: 424 ALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAAL 483

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFH 547
           MP LAYYA F M VII+IQGFTAFAP FSG DFAAAY+S+FLFI IW   QI FRCR  H
Sbjct: 484 MPGLAYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIH 543

Query: 548 RLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           ++++VDIDTDRRDIEAVVW+D  PKT+WDKFWNI+A
Sbjct: 544 KVEDVDIDTDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/515 (75%), Positives = 440/515 (85%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           EG+V  AEVKR LKQRH                  STPL+NAGPVG LIAYLFM +L +S
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFS 135

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V QSLGEMATFIPVTS+FTVFS RFLSPAFGAA+GYMYWFSWAITFALELSVVGQ+I+FW
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           T  VP+AAWI+IFWVL+T+ NLFPVKYYGEFEFW+A IKVIA++GF+IYC CMVCGAG+T
Sbjct: 196 THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           GPVGFRYWRNPGAWGPGIISK+KNEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK
Sbjct: 256 GPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           +VPRAIKKVVFRIL FY    +FIGLLVPYNDPKL  + SYVS+SPFI+AI+NSGTKVLP
Sbjct: 316 TVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLP 375

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
           HIFNAV+LTTIISA NSN+YVGSRI++GL+K KLAP F  RT+  GVPY AVF T+ FGA
Sbjct: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGA 435

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           LAYME STGG   F WLLNITGVAGFF W+ IS  HIRFMQALKYRGISRD+LPFKAK M
Sbjct: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR 548
           P LAYY+ FFM++II+IQGFTAFAP F+G  F AAY+S+FLFIA+W+  +  FRCR   +
Sbjct: 496 PGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWK 555

Query: 549 LDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +++VDID+DRRDIEA+VW+D  PKT WDKFWN+VA
Sbjct: 556 IEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/515 (74%), Positives = 450/515 (87%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           EG V EAEVKR LKQRH                  +TPL NAGPVG LIAYLFMAT+V+S
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V QSLGEMATFIPVTS+FTVFSSRFLSPA GAA+GYMYWFSWA+TFALELSVVGQII+FW
Sbjct: 149 VTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFW 208

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           T AVP++AWI I+WV+LT+ NLFPVK+YGEFEFW+A IKV+A++GF+IYCLCMVCGAG+T
Sbjct: 209 THAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVT 268

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           GPVGFRYWRNPG WGPGIISKD NEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 269 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 328

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           +VPRAIKKV FRIL+FY     FIGLLVPY+D KL S+DSY+S+SPFIIAIENSGTK+LP
Sbjct: 329 TVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSGTKILP 388

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
           HIFNAV+L+TIISAGNSNVYVGSRI++GLAK KLAP +FG T+  GVPY++VFFTS+FGA
Sbjct: 389 HIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGA 448

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           LA++E+S+GGA AFNWLLNI  VAGFF W+LIS  H+RFMQALK+RGISRDDLPFKA+FM
Sbjct: 449 LAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFM 508

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR 548
           P LAYY++FFM +II+IQGFTAFAPTF+G DF AAY+S+FLF  +WL  Q++FR ++   
Sbjct: 509 PHLAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWT 568

Query: 549 LDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           ++EVDIDTDRRD++A++W+D  PKT WDKFW++VA
Sbjct: 569 VEEVDIDTDRRDVDAIIWEDSGPKTFWDKFWDVVA 603

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/562 (67%), Positives = 445/562 (79%), Gaps = 13/562 (2%)

Query: 22  NDEDSSSGQAGAINHRKKSVVSKTTAVXXXXXXXXXXXXXXXXXFVKEGQVHEAEVKRAL 81
           ND DS +   G +  RK+     +T                     K+  +   +VKR+L
Sbjct: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATE-------------KDELLEHHDVKRSL 70

Query: 82  KQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEMATFIP 141
           KQRH                  +TPL+NAGPVG L+AYLFM T+V+SV QSLGEMATFIP
Sbjct: 71  KQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIP 130

Query: 142 VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMAAWITIF 201
           VTS+F+VF+ RFLSPA GAA+GYMY+ SW  TFALELSVVGQII+FWT  VP+AAWI+IF
Sbjct: 131 VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIF 190

Query: 202 WVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVGFRYWRNPGA 261
           WVLLT  N+FPVK+YGEFEFWIA IKV+AL+GF+IY LC+VCGAG TGP+GFRYWRNPGA
Sbjct: 191 WVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGA 250

Query: 262 WGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRI 321
            GPGIIS +  E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPRAI+KV+ RI
Sbjct: 251 MGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRI 310

Query: 322 LVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFNAVVLTTIIS 381
           L+FY     FIGL VPYNDPKL S+DSYVSSSPFII I+N+GT+VLPHIFNAV+LTTIIS
Sbjct: 311 LLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIIS 370

Query: 382 AGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYMELSTGGASA 441
           AGNSNVYVGSRI++ +AK  LAP F  +T   GVPY +V   SAFG+L+YMELSTGGA A
Sbjct: 371 AGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKA 430

Query: 442 FNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAYYALFFMVV 501
           FNWLLNITGVAGFF W+LIS  H+RFMQALK+RGISRDDLP+KA +MPWLAYYA+FFMVV
Sbjct: 431 FNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVV 490

Query: 502 IILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEVDIDTDRRDI 561
           IILIQGFT+FAP FSG DF AAY+SV LF+  W   QI+FRCRI  +L++VDIDTDRR+I
Sbjct: 491 IILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREI 550

Query: 562 EAVVWDDEPPKTLWDKFWNIVA 583
           E+VVW+D+ PKTLWDKFW+ VA
Sbjct: 551 ESVVWEDDAPKTLWDKFWDFVA 572

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/513 (73%), Positives = 429/513 (83%), Gaps = 1/513 (0%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
           +V    V+R LKQRH                  STPL NAGPVG LIAYLFMATL YSV 
Sbjct: 21  EVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVT 80

Query: 131 QSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
           QSLGEMATFIPVTS+FTVFS RF+SPAFGAA+GYMYWFSW ITFALELSVVGQ+I+FWT 
Sbjct: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP 250
           AVP+AAWI+IFWVLLT  N+FPVKYYGEFEFW+A +KV+A++GF+IYC CMVCGAG+TGP
Sbjct: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200

Query: 251 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 310
           VGFRYWR+PGA+GPGII+KDKN+ RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+V
Sbjct: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260

Query: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHI 370
           PRAIKKVVFRIL FY     FIGLLVPY+D KL S+DSYVS+SPFIIAIENSGT VLPHI
Sbjct: 261 PRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHI 320

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
           FNAV++ TIISAGNSN+YVGSRIMYGL+  +LAP    RT   GVP+ AV  TS FGALA
Sbjct: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           YME STGG  AFNWLLNITGVAGFFTW+ IS  HIRFMQAL+ RGISRDDLPFKAK+MP 
Sbjct: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440

Query: 491 LAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLD 550
           LAYY +FFM +II+IQGFT+F P ++G+DF  AY+SVF+FIAIW+  Q WFRCR+  R++
Sbjct: 441 LAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVE 499

Query: 551 EVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +VDIDTDRR +E  VW ++ P+  WDKFWN+VA
Sbjct: 500 DVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/514 (71%), Positives = 419/514 (81%)

Query: 70  GQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSV 129
           G V E +VKRALK RH                  STPLSNAGPVG LIAY+F+ TL YSV
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94

Query: 130 VQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWT 189
            QSLGEMATFIPVTS+FTVF+ RFLSPA G+A+GY+YW SWAITFALELSVVGQII+FWT
Sbjct: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154

Query: 190 TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITG 249
            AVP+ AWI IFWV+LT+SNLFPVKYYGE EFWIA IKV+A+VGFIIY   MVCGAG TG
Sbjct: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214

Query: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
           PVGFRYWRNPG WGPGIISKD NEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+
Sbjct: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPH 369
           VPRAI KV FRIL FY    +FIGLLVP+NDPKL S DSY+SSSPF+IAIENSGTKVLPH
Sbjct: 275 VPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334

Query: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429
           IFNAV+L+TIISAGNSNVYVGSRI Y +A   LAP +   T  +G+PY AV  TS  G L
Sbjct: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394

Query: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489
           AY+E S+G ++ FNWLLNIT VAGFFTW+LIS  HIRFMQALK++GISRDDLPFKAKFMP
Sbjct: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454

Query: 490 WLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRL 549
           W AYYA FF+ VII+IQGFTAFAP F   DF  AY+SV LF   W+G QIWFR  +F + 
Sbjct: 455 WGAYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKT 514

Query: 550 DEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +++D+DTDRR+I+ VVW+++ P+ LW+KFW  +A
Sbjct: 515 EDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/518 (74%), Positives = 448/518 (86%)

Query: 66  FVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATL 125
           +V +G V +AEVKR LKQRH                  STPL NAGPVG LIAYLFMAT+
Sbjct: 78  YVDQGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATI 137

Query: 126 VYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185
           V+SV QSLGEMATFIPVTS+FTVFSSRF+SP+ GAA+GYMYWFSWAITFALELSVVGQII
Sbjct: 138 VFSVTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQII 197

Query: 186 EFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245
           +FWT AVP++AWI I+W +LT+ N+FPVK+YGEFEFW+A IKVIA++GF+IYCLCMVCGA
Sbjct: 198 QFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGA 257

Query: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
           G+TGPVGFRYWRNPG WGPGIIS    EGRFLGWVSSLINAAFTYQGTELVGITAGEAAN
Sbjct: 258 GVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 317

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTK 365
           PRK+VPRAIKKV FRIL+FY     FIGLLVP++DPKL+S DSYVSSSPFIIAI+NSGTK
Sbjct: 318 PRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIQNSGTK 377

Query: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425
           VLPHIFNAV+L+TIISAGNSN+YVGSR+M+GLAK KLAP +FG T   GVPY AV FTSA
Sbjct: 378 VLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSA 437

Query: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485
           FGALA++E+S+GGA AFNWLLNI GVAGFF W+LIS  H+RF+Q L++RGISRDDLPFKA
Sbjct: 438 FGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497

Query: 486 KFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRI 545
             MPWLAYYA+FFM++II+IQGFTAFAPTF+G DF AAY+SVFLF  +W+  Q++FRC++
Sbjct: 498 ALMPWLAYYAIFFMIIIIIIQGFTAFAPTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKL 557

Query: 546 FHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +  LDEVDIDTDRRDI+A++W+D  PKT WD+FW++VA
Sbjct: 558 YWSLDEVDIDTDRRDIDAIIWEDSAPKTFWDRFWDVVA 595

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/514 (73%), Positives = 426/514 (82%), Gaps = 2/514 (0%)

Query: 70  GQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSV 129
           G V EA+VKR LK RH                  +TP+ NAGPVG LIAY+FM TLV+SV
Sbjct: 95  GVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSV 154

Query: 130 VQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWT 189
            QSLGEMATFIPVTS+FTVF+SRF+S  FGAA GYMYWFSWAITFALELSVVGQ+IEFWT
Sbjct: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214

Query: 190 TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITG 249
             VP+AAWI+IFWVL+ + N FPVK YGEFEFW+A IKVIA++GFIIYCLCMVCGAGITG
Sbjct: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274

Query: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
           PVGFRYWR+PG WGPGIISKDKNE RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS
Sbjct: 275 PVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 334

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPH 369
           VPRAIKKV  RIL+FY     FIGLLVPYNDPKL+S+DSYVS+SPFIIAI+NSGTKVLPH
Sbjct: 335 VPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPH 394

Query: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429
           IFNAV+LTTIISA NSNVYVGSRI+YGL+  KLAP FF +T   GVP+ AV FT+AFGAL
Sbjct: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTR-NGVPFIAVLFTAAFGAL 453

Query: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489
           AYME S GG +AFNWLLNITGVAGFF W+ IS  HIRFMQ LK+RG+SRDDLP+KA  MP
Sbjct: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513

Query: 490 WLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRL 549
            LAYY  FF+ +IILIQGFTAFAP F    F  AY+S FLF+ I++ AQ +FR R++  L
Sbjct: 514 GLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL 573

Query: 550 DEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           D+VDIDTDRRDI+ V+W +E P+T WDKFW ++A
Sbjct: 574 DDVDIDTDRRDIDTVIW-EEGPQTFWDKFWAVIA 606

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/582 (62%), Positives = 432/582 (74%), Gaps = 27/582 (4%)

Query: 3   NAKQDVSEEGYELGNFSGMNDEDSSSGQAGAINHRKKSVVSKTTAVXXXXXXXXXXXXXX 62
           N+   + EE      + G + E++ +G++   N   K   +                   
Sbjct: 18  NSISTIKEEELICARYDGQDTEEAVAGKSSINNDSAKETETSP----------------- 60

Query: 63  XXXFVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFM 122
                ++G     EVKR LKQRH                    PL++AGPVG LI+YLFM
Sbjct: 61  -----RKG----GEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFM 111

Query: 123 ATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVG 182
            T++YSV QSLGEMATFIPVTS+F+VF+ RFLSPA GA +GYMYW SW  TFALELSV+G
Sbjct: 112 GTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLG 171

Query: 183 QIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMV 242
           QII++WT AVP+ AWI IFW LLT+ N+FPVKYYGEFEF IA IKVIAL+GFI +  C+V
Sbjct: 172 QIIQYWTDAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIV 231

Query: 243 CGAGITG-PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAG 301
           CGAG +G P+GFRYWRNPGAWGPGIISK+KNEGRFLGWVSSLINAAFTYQGTELVGITAG
Sbjct: 232 CGAGQSGGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAG 291

Query: 302 EAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIEN 361
           EAANPR++VPRAIKKVV RILVFY     FIGLLVPYNDPKL+S  ++VSSSPF+I+IEN
Sbjct: 292 EAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSPFMISIEN 351

Query: 362 SGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVF 421
           SGTKVLP IFNAVVL TI+SAGNSNVY+GSR++Y L+K  LAP F       GVPYFAV 
Sbjct: 352 SGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVL 411

Query: 422 FTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDL 481
            TSAFG LA++E S G    FNWLLNITGVAGFF W+LIS  HIRFMQA+K RGISRDDL
Sbjct: 412 STSAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDL 471

Query: 482 PFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541
           P++A+ MP+LAYYA FF+ +I+LIQGFTAFAPTF  +DF AAY+SVFLFIAIWL  Q+WF
Sbjct: 472 PYRARMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWF 531

Query: 542 RCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +CR   +L +VDID+DRRDIE  VW +   KT W   W+I++
Sbjct: 532 KCRFVWKLQDVDIDSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/516 (68%), Positives = 419/516 (81%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           ++G+V   EVKRALK RH                  S PL NAGPVG LIAYLFMAT+ +
Sbjct: 65  EKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAF 124

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           SV+QSLGEMAT+IPVTSAF+VFS RFLSPAFGAA+GYMYWFSW+ITFALELSV+GQI+++
Sbjct: 125 SVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQY 184

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           WT  VP+AAWI+IFWVL+   N  PVK+YGEFEFWIAFIKV+A+VGFIIYC  MVCGAG 
Sbjct: 185 WTFKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGK 244

Query: 248 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
           TGPVGFRYWR+  A+G GIISK+KNE RFLGWVSSLINAAFTYQGTELVGITAGEAANPR
Sbjct: 245 TGPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 304

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K+VP++IK+ ++RIL+FY    +F+GLLVP+ND  L  S SY +SSPFI+AI+NSGTK L
Sbjct: 305 KTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASSPFILAIKNSGTKAL 364

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P IFNAV+LTT+ISA NS+VYVGSR+MY +A+ +LAP    + +  GVPY AV FTSA G
Sbjct: 365 PDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIG 424

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
           ALAY+E S+ GA+ FNWL+NITGVAGFF+W LIS  H+RFM+ALK RGISR+DLPFKA F
Sbjct: 425 ALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASF 484

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFH 547
           MPW+A Y+ FFM +IIL+QGFT F P F   DF A+Y+SV LF  IW   QIWFRC +  
Sbjct: 485 MPWIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCPLLV 544

Query: 548 RLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
            + E+DIDTDRRD++A VW+DEPPKTLWDKFWNIVA
Sbjct: 545 PIAEIDIDTDRRDVDAEVWEDEPPKTLWDKFWNIVA 580

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/514 (69%), Positives = 412/514 (80%)

Query: 70  GQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSV 129
           G V E +VKRALK RH                  STPLSNAGPVG LIAY+F+ TL Y V
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94

Query: 130 VQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWT 189
            QSLGEMATFIPVTS+F VF+ RFLSPA GAA+GYMY+ SW+ITFALELSVVGQ+I+FWT
Sbjct: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154

Query: 190 TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITG 249
            AVP+ AWI I WV+L  +NL PVK+YGE EFWIA IKV+A+VGFIIY   MVCGAG TG
Sbjct: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214

Query: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
           PVGFRYWRNPG WGPGIISKD NEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+
Sbjct: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPH 369
           VPRAI KV FRIL FY    +FIGLLVP+NDPKL S DSY+SSSPF+IAIENSGTKVLPH
Sbjct: 275 VPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334

Query: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429
           IFNAV+L+TIISAGNS+VY+ SR++Y +    LAP +   T  +G+PY AV  TS  G L
Sbjct: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394

Query: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489
           AY+E S G +  F+WLLNIT VAGFF W+LIS  HIRFMQALK++GISRDDLPFKAKFMP
Sbjct: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454

Query: 490 WLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRL 549
           W AYYA FF+ VII+IQGFTAFAP F+  DF  AYVSV LF A+W+G QIWFR  +F + 
Sbjct: 455 WGAYYAAFFIGVIIIIQGFTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514

Query: 550 DEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +++D+DTDRR+I+  VW+++ PK LW+KFW+ VA
Sbjct: 515 EDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/512 (68%), Positives = 412/512 (80%), Gaps = 1/512 (0%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
              EVKR LKQRH                    PL++AGPVG LI+YLFM T++YSV QS
Sbjct: 62  ERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQS 121

Query: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           LGEM TFIPVTS+F+VF+ RFLSPA GA +GYMYW SW  TFALELSV+G++I++WT AV
Sbjct: 122 LGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAV 181

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT-GPV 251
           P+AAWI IFW LLT  N+FPVKYYGEFEF IA IKVIAL+GFII+  C+VCGAG + GP+
Sbjct: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           GFRYWRNPGAWGPGIIS DKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK++P
Sbjct: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIF 371
           RAIKKVV RILVFY     FIGLLVPYNDPKL+S   +VSSSPF+I+IENSGTKVLP IF
Sbjct: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIF 361

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           NAVVL TI+SAGNSNVY+GSR++Y L+K  LAP F       GVPYF+V  TS FG LA+
Sbjct: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAF 421

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
           +E+S G   AFNWLLNITGVAGFF W+LIS  HIRFMQA++ RGISRDDLP+KA+ MP+L
Sbjct: 422 LEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFL 481

Query: 492 AYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDE 551
           AYYA FF+ +I+LIQGFTAFAPTF  +DF AAY+S+FLF+AIWL  Q+WF+CR+  +L +
Sbjct: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQD 541

Query: 552 VDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +DID+DRR IE +VW +   KT W + W++++
Sbjct: 542 IDIDSDRRQIEELVWIEPECKTRWQRVWDVLS 573

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/520 (69%), Positives = 421/520 (80%), Gaps = 3/520 (0%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           + + Q  + +VKR LK+RH                  + PL  AGP+G LIAYLFM T+V
Sbjct: 25  LDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVV 84

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           +SV QSLGEM TFIPVT++FTVF+ RFLSPAFGAA+GYMYWFSWA+TFALELSVVGQII+
Sbjct: 85  FSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQ 144

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
           FWT AVP+AAWI+I WVLLT+SNLFPV+ YGE EFWIA +KV+A++GFIIY +C++CGAG
Sbjct: 145 FWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAG 204

Query: 247 ITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
           +TGPVGFRYW+NPG WG GIIS + NE RF GWVSSLINAAFT+QGTELVGITAGE   P
Sbjct: 205 VTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKV 366
           RK+VP+AIKKVVFRILVFY    + IGLLVPYNDPKL S+DSYVSSSPFII I+N+GTK+
Sbjct: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKI 324

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           LPHIFNAV+L TIISAGNSNVY+GSRI+YGLAK K AP FF  T+ AGVPY  V FTS F
Sbjct: 325 LPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMF 384

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           G+LAYME +TGG  AF WLLNI GVAGFF W+LIS  HIRFM+ALK RGISR+DLP+KA 
Sbjct: 385 GSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAM 444

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIF 546
            MPWLAYYA+FFMV+II+IQGFT+FAP F   +F AAY+SVFLFI  W+  QIWF+CR+ 
Sbjct: 445 LMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLV 504

Query: 547 HRLDEVDIDTDRRDIEAVVWDD---EPPKTLWDKFWNIVA 583
            +L +VD+DTDRRDIE  VW D   +  K  WD+FWN VA
Sbjct: 505 WKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/511 (68%), Positives = 407/511 (79%), Gaps = 1/511 (0%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
             EV+R LK+RH                    PL++AGPVG LI+YLFM T++YSV QSL
Sbjct: 63  RGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSL 122

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GEMATFIPVTS+F+VF+ RFLSPA GA +GYMYW SW  TFALELSV+GQII++WT AVP
Sbjct: 123 GEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVP 182

Query: 194 MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI-TGPVG 252
           +AAWI IFW LLT+ N+FPVKYYGEFEF IA IKVI L+GFII+  C+VCGAG   GP+G
Sbjct: 183 LAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIG 242

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
           FRYWRNPGAWGPGIIS +KNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 243 FRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPR 302

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFN 372
           AIKKVV RILVFY     FIGLLVPYNDPKL+S  ++VS+SPF+I+IENSGTKVLP IFN
Sbjct: 303 AIKKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIFN 362

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           AVVL TI SAGNSNVY+GSR++Y L+K  LAP         GVPY AV  TS FG LA++
Sbjct: 363 AVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFL 422

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
           E S G   AFNWLLNITGVAGFF W+LIS  HIRFMQA+K RGISRDDLP+KA+ MP+LA
Sbjct: 423 ETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLA 482

Query: 493 YYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEV 552
           YYA FF+ +I+LIQGFTAFAPTF  VDF AAY+SVFLF  IWL  Q+WF+CR+  +L ++
Sbjct: 483 YYASFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDI 542

Query: 553 DIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           DID+DRR+IE  VW +   KT W + W+I++
Sbjct: 543 DIDSDRREIEEQVWIEPECKTRWQRVWDILS 573

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/518 (68%), Positives = 410/518 (79%), Gaps = 1/518 (0%)

Query: 67  VKEGQVHE-AEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATL 125
           V E +  E  EVKR L +RH                  + PL  +GPVG LIAYLF+ T+
Sbjct: 49  VSENEKDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTV 108

Query: 126 VYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185
           VYSV QSLGEMATFIPVT++FT+FS RFLSPA GAA+GYMYWFSWA+TFALELSVVGQII
Sbjct: 109 VYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQII 168

Query: 186 EFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245
           +FWT AVP+ AWI+IFWV+LT+SNLFPV+ YGE EFWIAF+KV A++GFIIYC C+VCGA
Sbjct: 169 QFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGA 228

Query: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
           G TGPVGFRYWRNPG WG GIIS +  E RFLGW SSLINAAFT+QGTELVGITAGEAAN
Sbjct: 229 GKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAAN 288

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTK 365
           PR++VP+AI+KVVFRILVFY     FIGLLVPY+D KL S +SYVSSSPFIIAIENSGTK
Sbjct: 289 PRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTK 348

Query: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425
           +LPHIFN V+L TIISAGNSNVY+GSR+++GLAK    P  F +T  +GVP FAV FTS 
Sbjct: 349 ILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSL 408

Query: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485
           FGALA+ME STGG  AF WLLN+ GVAGFF+W+LIS  HIRFMQ L+ RGISR+DLPFKA
Sbjct: 409 FGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKA 468

Query: 486 KFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRI 545
           KFMP+LAYYA   M++II  QGFTAFAP F  ++F A+Y+SVFLF   W   Q+WF+CR 
Sbjct: 469 KFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRY 528

Query: 546 FHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
             +L ++DID DRR+IE  VW D  P  LW KFW+ VA
Sbjct: 529 VWKLVDIDIDKDRREIEDRVWQDTTPANLWGKFWDFVA 566

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/581 (63%), Positives = 430/581 (74%)

Query: 3   NAKQDVSEEGYELGNFSGMNDEDSSSGQAGAINHRKKSVVSKTTAVXXXXXXXXXXXXXX 62
           N  + +    Y  G        +SS+        +      + T V              
Sbjct: 8   NMAEQIPLTPYPYGQEYNNAMGESSTASEEPFGCKDTKSTDEKTRVVSQVSPMRTGSPNV 67

Query: 63  XXXFVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFM 122
              ++ EG V +AEVKRALK RH                  S+PL++AGPVG LIAY+FM
Sbjct: 68  SIDYMDEGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFM 127

Query: 123 ATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVG 182
            T+ Y V QSLGEMATFIPVTS+FTVF+ RFLSPAFG A+GY+YWFSW ITFALELSVVG
Sbjct: 128 GTIAYFVTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVG 187

Query: 183 QIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMV 242
           QII+FWT AVP+ AWI IFWV+LT SNLFPVKYYGE EFWIA IKV+A+VGFIIY   MV
Sbjct: 188 QIIQFWTFAVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMV 247

Query: 243 CGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 302
           CGAG TGPVGFRYWRNPG WGPGIISKD NEGRFLGWVSSLINAAFTYQGTELVGITAGE
Sbjct: 248 CGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGE 307

Query: 303 AANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENS 362
           + NPR++VPRAI KV FRIL FY    +FIGLLVP+NDPKL S DSY+SSSPF+IAIENS
Sbjct: 308 SKNPRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENS 367

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           GTKVLPHIFNAV+L+TIISAGNSN+YVGSR++YGLAK KLAP  F R    GVPY +V  
Sbjct: 368 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLG 427

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           T+AFG LAY+ LS      F+WLLNIT +AGFF W+ IS  HIRFMQ LK R +SR+DLP
Sbjct: 428 TAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLP 487

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFR 542
           FKAKFMPW AYY+ FF+ +II+IQGFTAFAP F+  +F AAY+SVFLF+AIW+  QI FR
Sbjct: 488 FKAKFMPWGAYYSAFFISLIIIIQGFTAFAPKFNVSNFFAAYISVFLFLAIWVVFQIRFR 547

Query: 543 CRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
            R     ++VDIDTDRRDI+ +VW++E PK  WDKFW  +A
Sbjct: 548 TRFILTKNDVDIDTDRRDIDCIVWEEETPKNAWDKFWAAMA 588

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/515 (66%), Positives = 415/515 (80%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           E  V    VKRALK RH                  + PL NAGPVG LIAY+F+ T+++S
Sbjct: 85  EEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFS 144

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V QSLGEM TFIPVTS+FTVFS RFLSPAFGAA+GYMYWFSWA+TFA+ELSV+G++I+FW
Sbjct: 145 VTQSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFW 204

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           TTAVP+AAWI IFW LLT+SN+FPVKYYGE EFWIAF+KV++LVGF+I+CLC+  GAG  
Sbjct: 205 TTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGPH 264

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           GP GFRYWR+PGAWGPGII++D++E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 265 GPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 324

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           +VP+AIKKV+ RIL FY     FIG+LVP+NDPKL S+ S+VSSSPFIIAI+NSG  +LP
Sbjct: 325 AVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFVSSSPFIIAIQNSGVSLLP 384

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
            IFN V+L TIISAGNSNVYVGSRI++GLA   LAP FF RT   GVP+ AV FTS FG+
Sbjct: 385 SIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGS 444

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           LA++EL+T G   FNWLL+I  +AGFF W+LIS  HIRFM+AL+YRGISR+ LPFKA FM
Sbjct: 445 LAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFM 504

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR 548
           PWLAYYA  F+++IILIQGFTAFAP F+  DF A+Y+S+ LF+ IW   Q   +CRIF +
Sbjct: 505 PWLAYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWK 564

Query: 549 LDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           ++++D+D+DR+DIE + W+D+ PKT W K W  +A
Sbjct: 565 VEDIDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/507 (67%), Positives = 407/507 (80%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           V+R LK RH                   +PL NAGPVG LI+YLFM ++ Y V QSLGEM
Sbjct: 53  VQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEM 112

Query: 137 ATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMAA 196
           ATFIPVTS+FTVF+ RFLS   GAA+GYMY FSW++T+ALELS+VGQIIE+WT+AVP AA
Sbjct: 113 ATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAA 172

Query: 197 WITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVGFRYW 256
           WI IFWV +T+SNL PVK+YGEF+FWIA IKV+A++GF++YCLCMVCGAG TGPVGFRYW
Sbjct: 173 WIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYW 232

Query: 257 RNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKK 316
           RNPG WG GIIS D +EGRFLGWVSSL+NAAFTYQGTELVGI+AGE+ANPRK+VP+AI K
Sbjct: 233 RNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINK 292

Query: 317 VVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFNAVVL 376
           V FRIL+FY     FIGLLVP+ND KL SSDSY + SPFIIAI+NSGTK+LP IFNAV+L
Sbjct: 293 VFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNAVIL 352

Query: 377 TTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYMELST 436
            TIISA NSNVYVGSR++YGLAK +LAP FF RTN  GVP  AV F + FG L Y+ +S 
Sbjct: 353 ATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSN 412

Query: 437 GGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAYYAL 496
           G + AF+WLLNIT +AGFF+W+ IS CH+RFMQALK +GISRDDLPFKAK MPW AYY+ 
Sbjct: 413 GASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSA 472

Query: 497 FFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEVDIDT 556
           FF+ +II+IQGFT+ APTF+  +F AAY+SVF+F+ IW   Q W+R RI HR++ VDID+
Sbjct: 473 FFITLIIIIQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDS 532

Query: 557 DRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           DRR+++A  WD+  P TLW KFW  +A
Sbjct: 533 DRREVDAQQWDNTEPTTLWGKFWAAMA 559

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/523 (68%), Positives = 422/523 (80%), Gaps = 6/523 (1%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           +  G VH+AEVKR LKQRH                  STPL ++GPVG LIAY+F+ TL 
Sbjct: 52  LNSGSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLT 111

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           Y+V QSLGEMATFIPVTS+FTVF+SRFLSP+ GAA GYMYWFSWA+TFALELSVVGQI++
Sbjct: 112 YAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVD 171

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
           +WT AVP+AAWI+IFWV+LT  N+FPVK+YGE EFW+A +KV+A+VGF+IYCLCMVCGAG
Sbjct: 172 YWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAG 231

Query: 247 ITGPVGFRYWRNPGAWGPGI------ISKDKNEGRFLGWVSSLINAAFTYQGTELVGITA 300
           +TGPVGFRYWRNPG WG G+      ISK+KN GRFLGW +SLINAAFTYQGTELVGITA
Sbjct: 232 VTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITA 291

Query: 301 GEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIE 360
           GEAANPRK+VPRAIKKVVFRIL+FY     FIGLLVP++DPKL+S DSYVSSSPFIIAIE
Sbjct: 292 GEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIE 351

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
           NSGTK+LP IFNA++L TIISAGNSN+YVGSRI++ LAK  LAP    RT   GVP+ +V
Sbjct: 352 NSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSV 411

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
             T+ FG LAYME + GG + F+WL+NIT +AGF+ W+ I   HIRFMQ LK+RGISRDD
Sbjct: 412 LATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDD 471

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIW 540
           LPFKA  MP LAYYA+F MV+II+ QGFTAF PTF   DF AAY+SV LF  IW   Q+W
Sbjct: 472 LPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLW 531

Query: 541 FRCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           F+CR   +L++VDID++RRD+E ++W+D  PKT WDKFWN+VA
Sbjct: 532 FKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/479 (72%), Positives = 400/479 (83%), Gaps = 1/479 (0%)

Query: 106 PLSNAGPVGGLIAYLFMATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYM 165
           PL++AGPVG LI+Y+FM T++YSV QSLGEMATFIPVTS+F+VF+ RFLSPA GA +GYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 166 YWFSWAITFALELSVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAF 225
           YW SW  TFALELSV+GQII++WT AVP++AWI IFW LLT+ N+FPVKYYGEFEF IA 
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 226 IKVIALVGFIIYCLCMVCGAGI-TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLI 284
           IKVIAL+GFIIY  CMVCGAG   GP+GFRYWRNPGAWGPGIIS DKNEGRFLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 285 NAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLN 344
           NAAFTYQGTELVGITAGEAANPRK+VPRAIKKVV RILVFY     FIGLLVPYNDPKL+
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 345 SSDSYVSSSPFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAP 404
           S  S+VS+SPF+I+IENSGTKVLP IFNAVVL TI+SAGNSNVY+GSR++Y L+K  LAP
Sbjct: 259 SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAP 318

Query: 405 SFFGRTNAAGVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACH 464
            F       GVPYFAV  TS FG LA++E S G   AFNWLLNITGVAGFF W+LIS  H
Sbjct: 319 RFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSH 378

Query: 465 IRFMQALKYRGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAY 524
           IRFMQA+  RGISR+DLP+KA+ MP+LAYYA FF+ +I+LIQGFTAFAP+F  VDF AAY
Sbjct: 379 IRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAY 438

Query: 525 VSVFLFIAIWLGAQIWFRCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +SVFLF+AIW   Q+WF+C I  +L +VDID+DRR+IE  VW +   KT W   W+++A
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/511 (67%), Positives = 411/511 (80%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
            E  ++RALK RH                  + PL +AGPVG LI+YLFM +L + V QS
Sbjct: 45  QERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQS 104

Query: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           LGEMATFIPV S+FTVF+ RFLSPA GAA+GYMY FSW ITFALELS+VG+II++WT  V
Sbjct: 105 LGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGV 164

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
           P AAWI IFWV +++SNL  VK+YGEF+FWIA IKVIA+VGF+IYCLCMVCGAG TGPVG
Sbjct: 165 PNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGPVG 224

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
           FRYWRNPG WG GIISK K+EGRFLGWVSSL+NAAFTYQGTELVG++AGE+ANPRK+VP+
Sbjct: 225 FRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPK 284

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFN 372
           AI+KV  RIL+FY     FIGLLVP+NDPKL+S+ +Y +SSPFIIAI+NSGT+ LP IFN
Sbjct: 285 AIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYSASSPFIIAIQNSGTRALPDIFN 344

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           AV+LTTIISA NSNVYVGSR++YGLAK  LAP   GR N  GVPY  V   S FG L Y+
Sbjct: 345 AVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYL 404

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
            +S+G A AF+WLLNIT +AGFF W+ IS CHIRFMQALKY+GISRDDLPFKAK MPW A
Sbjct: 405 SVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGA 464

Query: 493 YYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEV 552
           YYA FF+++II+IQGFTAFAP F+  +F AAYVSVFLFIA+W+  Q+ F+ R+ H++++V
Sbjct: 465 YYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDV 524

Query: 553 DIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           DID+DRR+IEA VW+D+ P  LW KFW  +A
Sbjct: 525 DIDSDRREIEAEVWEDDEPTNLWGKFWAAMA 555

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/520 (67%), Positives = 409/520 (78%), Gaps = 2/520 (0%)

Query: 66  FVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATL 125
           F  EG + +AEVKRALK RH                  S PL NAGPVG LIA++ + TL
Sbjct: 62  FDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTL 121

Query: 126 VYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185
            YSV QSLGEMATFIPVTS+FTVFS RF+SPA GAA+GYMYWFSWAITFALELS+VGQII
Sbjct: 122 AYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQII 181

Query: 186 EFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245
           ++WT AVP+ AWI IFWVLL   N+FPVK+YGEFEFW+A IKVIA++GF+IY LCMVCGA
Sbjct: 182 QYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGA 241

Query: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
           G  GP+GFRYWR PG WG GII+K+ N+ RFLGWVSSLI+AAFTYQGTELVGITAGE  N
Sbjct: 242 GPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKN 301

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSD--SYVSSSPFIIAIENSG 363
           PRK+VPRAI KV FRIL+FY     FIGLLVPYNDPKL  SD  SY++ SPF+IAI N  
Sbjct: 302 PRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCR 361

Query: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFT 423
           T VLPHIFNAV+LTTIISAGNSNVYVGSRI++GL+K  LAP FF +T   GVP+ AV  T
Sbjct: 362 TPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLIT 421

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
           + FG LAY+ +S      F+WLLNIT +AGF TW+LIS  HIRFMQ LK+RGISRDDLP+
Sbjct: 422 AVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPY 481

Query: 484 KAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRC 543
           KAKFMP+ AYYA FF+ VII+IQGFTAFAP F+  DF AAY+SVFLF  +W   Q  +R 
Sbjct: 482 KAKFMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRT 541

Query: 544 RIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           ++F  LDEVDID+DRRDI+ ++W++E PK LW+KFW + A
Sbjct: 542 KLFRTLDEVDIDSDRRDIDVIIWEEEEPKNLWEKFWAVAA 581

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/511 (63%), Positives = 401/511 (78%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
           H+ +VKRALKQRH                  +TPL+N+GPVG LIAYLFM +++Y + QS
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           LGEMATFIPVTS+ TVFS RFLSPAFG A+GYMYWF+WAITFA+E+SVVGQ+IE+WT  V
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
           P+AAWI IFWVL+T+ N FPVK YGE EFWIAFIKV+A++G+++Y L +VCG    GP+G
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPIG 268

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
           FRYWRNPG WGPGIISKD N GRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 269 FRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 328

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFN 372
           AI KVVFRI +FY     FIG+LVPYND +L S+ + ++SSPF+I+I+N+GTKVLP IFN
Sbjct: 329 AINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGTKVLPDIFN 388

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           A+V+ TIISA NSNVYVGSR++Y LA    AP  F      GVPY  V  TSA G LA++
Sbjct: 389 AIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLAFL 448

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
            ++    +AFNWL+NI+ +AG   W+ IS  HIRFMQALK+RGISRDDLPFKAK MP+ A
Sbjct: 449 VVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPFGA 508

Query: 493 YYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEV 552
           YYA FF+ VII IQGF AF+P +    F  +Y+S+ +   +++G QI++RCR F R++++
Sbjct: 509 YYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRVEDI 568

Query: 553 DIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           DID+DRR+IEAV+W+D+ PKTLWDKFW  VA
Sbjct: 569 DIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/513 (63%), Positives = 400/513 (77%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
           Q H+ EVKRALKQRH                  S PL+N+GPVG LIAYLFM +++YS+ 
Sbjct: 95  QYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSIT 154

Query: 131 QSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
           QSLGEMATFIPVTS+ TVFS RFLSPAFG A+GYMYWF+WAIT+A+E+SVVGQ+IE+WT 
Sbjct: 155 QSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTK 214

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP 250
            VP+AAWI IFWV +T+ N FPVK YGE EFWIAF+KV+A+ G+++Y L +VCG    GP
Sbjct: 215 KVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGP 274

Query: 251 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 310
           +GFRYWRNPG WG GIISKDKN  RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV
Sbjct: 275 IGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 334

Query: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHI 370
           PRAI KVVFRI +FY     FIGLLVPY+DP+L+S  + V+SSPF+I+I+N+GTK+LP I
Sbjct: 335 PRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKILPDI 394

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
           FNA+V+ T+ISA NSNVYVGSR++Y LA+   AP  F      GVPY  V  T+A G LA
Sbjct: 395 FNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLA 454

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++ ++    +AFNWL+NI+ +AG   W+ IS  HIRFMQALK+RGISRDDLPFKAKFMPW
Sbjct: 455 FLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPW 514

Query: 491 LAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLD 550
            AYYA FF+ VII IQGF AF+P F    F  AY+S+ +   +++G QI++RCR F +L+
Sbjct: 515 AAYYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLE 574

Query: 551 EVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           ++DIDTDRR+IE V+W+D+ PKT WDKFW  VA
Sbjct: 575 DIDIDTDRREIEEVIWEDDEPKTYWDKFWAAVA 607

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/516 (62%), Positives = 397/516 (76%), Gaps = 1/516 (0%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           + G V +  VKRALKQRH                  STPL NAGPVG LIAY+FM +++Y
Sbjct: 85  EAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIY 144

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
            + QSLGEMATFIPVTS+ TVFS RFLSPAFG  +GYMYWF+WAIT+A+E+SVVGQ+I++
Sbjct: 145 FITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQY 204

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           WT AVP+AAWI IFWV +T+ N FPVK YGE EFW+A IKV+A++G++IY L +VCG   
Sbjct: 205 WTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGSS 264

Query: 248 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
            GP+GFRYWRNPG WGPGIISKD NEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR
Sbjct: 265 QGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 324

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           KSVPRAI KVVFRI +FY     FIGLLVPYND  L+S DSY++SSPF+I+I+N+GT  L
Sbjct: 325 KSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQNAGTYAL 384

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P IFNAVV+ TIISA NSNVYVGSR++Y LA+   AP  F      GVP+  V  T++ G
Sbjct: 385 PDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLG 444

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++ ++    +AFNWL+NI+ +AG   W  I+  HIRFMQALKYRGISRDDLPFKAK 
Sbjct: 445 LLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKL 504

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFH 547
           MPW AYY+ FF+ VII IQGF AF P +    F  +Y+S+ L + +++G Q+++RCR   
Sbjct: 505 MPWGAYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYYRCRFLL 563

Query: 548 RLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +++++DIDTDRR+IEA++W+D+ PK LW+KFW  VA
Sbjct: 564 KVEDIDIDTDRREIEAIIWEDDEPKNLWEKFWAWVA 599

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/516 (61%), Positives = 399/516 (77%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +E +  + +VKRALK RH                  S PL  +GPVG LIAY+FM T+VY
Sbjct: 93  QEAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVY 152

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
            V Q+LGEMATFIPVTS+ TVFSSRFLSPAFG ++GY+YWF+WAIT+A+E+SVVGQ+IEF
Sbjct: 153 FVTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEF 212

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           WTT VP+AAWI+IFWVL+T  N FPV  YGE EFW+A +KV+A+VG++IY L +VCG   
Sbjct: 213 WTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGSK 272

Query: 248 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
            GP+GFRYWR+  A G G+ISKDKNE RFLGWV+SLINAAFTYQGTELVGITAGEAANPR
Sbjct: 273 QGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPR 332

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           KSVPRAI KVVFRI++FY     FIGLLVPYNDPKLNS+ SY++SSPF+I+IEN+GT+ L
Sbjct: 333 KSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSATSYIASSPFVISIENAGTRAL 392

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           PHIFNA+++ TIISA NSNVYV SR++Y LA    AP  F R    GVP+  V  T+  G
Sbjct: 393 PHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMG 452

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++ ++     AFNWL+NI+ +AG   W+ IS  H+RFM+ALKYRGISRDDLPFKA+F
Sbjct: 453 LLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARF 512

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFH 547
           MP+ +YYA FF+ VII IQGFTAF+P F    F  AY+S+ L   +++G Q+++RCR F 
Sbjct: 513 MPYGSYYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFW 572

Query: 548 RLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +++++DIDTDRR+I+ +VW+D+ PKT WDKFW  VA
Sbjct: 573 KVEDIDIDTDRREIDEIVWEDDEPKTAWDKFWAAVA 608

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/516 (63%), Positives = 406/516 (78%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +E   H+  VKRALKQRH                  +TPLSNAGPVG LIAYLFM ++VY
Sbjct: 58  EEAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVY 117

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
            + QSLGEMATFIPVTS+ TVFS RFLSPAFG A+GYMYWF+WAIT+A+E+SV+GQ+I+F
Sbjct: 118 FITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQF 177

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           WT+AVP+AAWI IFWV +++ N FPVK YGE EFW+A IKVIA+VG++IY L +VCG   
Sbjct: 178 WTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGSS 237

Query: 248 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
            GP+GFRYWRNPG WGPGIIS DKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR
Sbjct: 238 QGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 297

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           KSVPRAI KVVFRI++FY     F+G+LVP+NDP+L S+ + ++SSPF+I+I+N+GT+VL
Sbjct: 298 KSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVIASSPFVISIQNAGTRVL 357

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           PHIFNAVV+ TIISA NSNVYVGSR++Y L++   AP  FG     GVPY  V  TS  G
Sbjct: 358 PHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLLG 417

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++ ++    +AFNWL+NI+ +AG   W+ IS  HIRFMQALK+RGISRDDLPFKAK 
Sbjct: 418 LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKL 477

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFH 547
           MPW AYYA FF+ VII IQGF AF+P F    F  AY+S+ + + + +G Q+++RCR   
Sbjct: 478 MPWGAYYAAFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRFLW 537

Query: 548 RLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +L+++DIDTDRR+IE ++W++E P+ LW+KFW+I+A
Sbjct: 538 KLEDIDIDTDRREIECIIWEEEEPQNLWEKFWSIMA 573

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/512 (63%), Positives = 401/512 (78%)

Query: 72  VHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQ 131
           VH+  VKRALKQRH                  STPLSN+GPVG LIAY+FM T++Y V Q
Sbjct: 86  VHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQ 145

Query: 132 SLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTA 191
           SLGEMATFIPVTS+ TVFS RFLSPAFG A+GYMYWF+WAIT+A+E+SV+GQ+I++WT  
Sbjct: 146 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 192 VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPV 251
           VP+AAWI IFWVL+T+ N FPVK YGEFEFW+A IKVIA+VG++IY L +VCG    GP+
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPI 265

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           GFRYWRNPGA G GIIS D  E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIF 371
           RAI KVVFRI++FY     F+GLLVPYNDP+L++S + ++SSPF+I+I+N+GTKVLP IF
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIF 385

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           NAVVL T+ISA NSNVYVGSR++Y LA+   AP  F      GVPY  V  T+  G LA+
Sbjct: 386 NAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAF 445

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
           + ++    +AFNWL+NI+ +AG   W+ IS  HIRFMQALK+RGISRDDLPFKAKFMPW 
Sbjct: 446 LVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWG 505

Query: 492 AYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDE 551
           AYYA FF+ VII IQGF AFAP F   +F  AY+S+ L + ++ G Q+++RCR   +L++
Sbjct: 506 AYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLED 565

Query: 552 VDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +DID+DRR+I+A+VW+D+ P+ LW+KFW  VA
Sbjct: 566 IDIDSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/508 (62%), Positives = 400/508 (78%), Gaps = 1/508 (0%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
            VKRALKQRH                  STPLSNAGPVG LIAY+FM T++Y + QSLGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 136 MATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMA 195
           MATFIPVTS+ TVFS RFLSPAFG ++GYMYWF+WAIT+A+E+SV+GQ+I++WT  VP+A
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 196 AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVGFRY 255
           AWI IFWVL+T+ N FPVK YGEFEFW+A +KV+A+VG++IY L +VCG    GP+GFRY
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRY 284

Query: 256 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 315
           WRNPGAWGPGIISK+K+EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPRAI 
Sbjct: 285 WRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 316 KVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFNAVV 375
           KVVFRI++FY     FIGLLVPYN+P+L+ S + ++SSPF+I+I+N+GT  LP IFNAVV
Sbjct: 345 KVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNAVV 404

Query: 376 LTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYMELS 435
           L T+ISA NSNVYVGSR++Y LA+   AP  FG     GVPY  V  T+A G LA++ ++
Sbjct: 405 LITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVVN 464

Query: 436 TGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAYYA 495
               +AFNWL++I+ +AG   W+ IS  HIRFMQALK RGISRDDLPFKAK MP+ AYYA
Sbjct: 465 NNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYYA 524

Query: 496 LFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEVDID 555
            FF+ +II IQGF AF P FS  +F  +Y+S+ L   +++  Q++++CR   +L+++DID
Sbjct: 525 SFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDID 583

Query: 556 TDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +DRR+IEA++W+D+ PK LW+KFW  VA
Sbjct: 584 SDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/516 (62%), Positives = 403/516 (78%), Gaps = 1/516 (0%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +E    +  VKRALKQRH                  STPLSNAGPVG LIAY+FM T+VY
Sbjct: 97  EEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVY 156

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
            V QSLGEMATFIPVTS+ TVFS RFLSPAFG ++GYMYWF+WAIT+A+E+SV+GQ+IE+
Sbjct: 157 FVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEY 216

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           WT  VP+AAWI IFWV++T+ N FPVK YGEFEFW+A +KV+A++G++IY L +VCG   
Sbjct: 217 WTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGSH 276

Query: 248 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
            GP+GFRYWRNPGAWGPGIIS DK+EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR
Sbjct: 277 QGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 336

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K+VPRAI KVVFRI++FY     FIGLLVPYND +L++S + ++SSPF+I+I+N+GT  L
Sbjct: 337 KTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYAL 396

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P IFNAVVL T++SA NSNVYVGSR++Y LA+   AP  FG     GVPY  V  T+A G
Sbjct: 397 PDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG 456

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++ ++    +AFNWL+NI+ +AG   W+ IS  HIRFMQALK+RGISRDDLPFKAK 
Sbjct: 457 LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKL 516

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFH 547
           MP+ AYYA FF+ VII IQGF AF P F   +F  +Y+S+ L   +++G QI+++CR   
Sbjct: 517 MPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSEFFTSYISLILLAVVFIGCQIYYKCRFIW 575

Query: 548 RLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +L+++DID+DRR+IEA++W+D+ PK LW+KFW  VA
Sbjct: 576 KLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/511 (62%), Positives = 401/511 (78%), Gaps = 1/511 (0%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           E +VHE +VKRALKQRH                  STPLS AGPVG LIAY+FM T++Y 
Sbjct: 84  EAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYF 143

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V QSLGEMATFIPVTS+ TVFS RFLSPAFG A+GYMYWF+WAIT+A+E+SV+GQ+I++W
Sbjct: 144 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYW 203

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           T AVP+AAWI IFWVL+T+ N FPVK YGE EFWIAF+KV+A+VG++IY L +VCG    
Sbjct: 204 TKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGSHQ 263

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           GP+GFRYWR+PGA+GPGIISK+KN G+FLGWV+SLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 264 GPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRK 323

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           +VPRAI KVVFRI++FY     FIG+L+PYND +L++ D+ ++SSPF+I+I+N+ TKVLP
Sbjct: 324 TVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRLSAQDAVIASSPFVISIKNAHTKVLP 383

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
            IFNAVV+ T++SA NSNVYVGSR++Y LA    AP  F      GVPY  V  T++ G 
Sbjct: 384 DIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGL 443

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           LA++ ++    +AFNWL+NI+ +AG   W+ IS  HIRFMQALK+RGISRDDLPFKAK M
Sbjct: 444 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLM 503

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR 548
           PW AYYA FF+ VII IQG+ AF P +    F  +Y+S+ L   + +G Q+++R R   +
Sbjct: 504 PWGAYYAAFFVTVIIFIQGYQAFCP-WDVSTFFTSYISLILLAVLVVGCQLYYRGRFLLK 562

Query: 549 LDEVDIDTDRRDIEAVVWDDEPPKTLWDKFW 579
           L+++DIDTDRR+IE++VW+D+ PKTLWDKFW
Sbjct: 563 LEDIDIDTDRREIESIVWEDDEPKTLWDKFW 593

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/516 (62%), Positives = 394/516 (76%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +E Q  +  VKRALKQRH                  +TPLSNAGPVG LIAY+FM ++VY
Sbjct: 95  EEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVY 154

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
            V QSLGEMATFIPVTS+ TVFS RFLSPAFG A+GYMYWF+WAIT+A+E+SV+GQ+I++
Sbjct: 155 FVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQY 214

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           WT AVP+AAWI IFWV++T+ N FPVK YGEFEFWIA IKV+A++G++IY L +VCG   
Sbjct: 215 WTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGSH 274

Query: 248 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
            GP+GFRYWRNPG WGPGIIS    E RFLGWVSSLINAAFTYQGTELVGITAGEAANPR
Sbjct: 275 QGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 334

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           KSVPRAI KVVFRI +FY     FIGLLVP+ND +L +  + ++SSPF+I+I+N+GT+ L
Sbjct: 335 KSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDSAVIASSPFVISIQNAGTRAL 394

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P IFNAVVL TIISA NSNVYVGSR++Y LA    AP  F      GVPY  V  T+A G
Sbjct: 395 PDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAALG 454

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++ ++    +AFNWL+NI+ +AG   W+ IS  HIRFMQALKYRGISRDDLPFKAK 
Sbjct: 455 LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKL 514

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFH 547
           MPW AYYA FF+ VII IQGF AF P F    F  +Y+S+ L   ++ G Q+++RCR   
Sbjct: 515 MPWGAYYASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIW 574

Query: 548 RLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +++++DID+DRR+IEA++W+++ PK LW+KFW  VA
Sbjct: 575 KVEDIDIDSDRREIEAIIWEEDEPKNLWEKFWAWVA 610

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/511 (62%), Positives = 398/511 (77%), Gaps = 1/511 (0%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
            +  V+RALKQRH                  STPLSNAGPVG LIAY+FM T+VY V QS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           LGEMATFIPVTS+ TVFS RFLSPAFG ++GYMYWF+WAIT+A+E+SV+GQ+IE+WTT V
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
           P+  WI IFWVL+T+ N FPVK YGEFEFW+A +KV+A++G++IY L +VCG    GP+G
Sbjct: 222 PLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIG 281

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
           FRYWRNPGAWGPGIIS DKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 282 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFN 372
           AI KVVFRI++FY     FIGLLVPY DP+L++S + ++SSPF+I+I+N+GT  LP IFN
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASSPFVISIQNAGTYALPDIFN 401

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           A+VL T+ISA NSNVYVGSR++Y LA+   AP  FG     GVPY  V  T+A G LA++
Sbjct: 402 AIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 461

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
            ++    +AFNWL+NI+ +AG   W+ IS  HIRFMQAL  RGISRDDLPFKAKFMP+ A
Sbjct: 462 VVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGA 521

Query: 493 YYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEV 552
           YYA FF+ VII IQGF +F P F   DF  +Y+S+ L   ++ G Q++++CR   +L+++
Sbjct: 522 YYASFFVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 580

Query: 553 DIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           DID+DRR+IEA++W+D+ PK LW+KFW  VA
Sbjct: 581 DIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/511 (62%), Positives = 398/511 (77%), Gaps = 1/511 (0%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
            +  VKRALKQRH                  STPLS AGPVG LI+Y+FM T+VY + QS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           LGEMATFIPVTS+ TVFS RFLSPAFG A+GYMYWF+WAIT+A+E+SV+GQ+I++WT  V
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
           P+A WI IFWVL+T+ N FPVK YGEFEFW+A +KV+A++G++IY L +VCG    GP+G
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIG 282

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
           FRYWRNPGAWGPGIIS DKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFN 372
           AI KVVFRI++FY     FIGLLVPYN+P+L++S + ++SSPF+I+I+N+GT  LP IFN
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASSPFVISIQNAGTYALPDIFN 402

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           AVVL T+ISA NSNVYVGSR++Y LA+   AP  FG     GVPY  V  T+A G LA++
Sbjct: 403 AVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 462

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
            ++    +AFNWL+NI+ +AG   W+ IS  HIRFMQAL+ RGISRDDLPFKAK MP+ A
Sbjct: 463 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGA 522

Query: 493 YYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEV 552
           YYA FF+ VII IQGF AF P F   DF  +Y+S+ L   ++ G Q++++CR   +L+++
Sbjct: 523 YYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 581

Query: 553 DIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           DIDTDRR+IEA++W+D+ PK LW+KFW  VA
Sbjct: 582 DIDTDRREIEAIIWEDDEPKNLWEKFWAAVA 612

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/586 (55%), Positives = 417/586 (71%), Gaps = 32/586 (5%)

Query: 6   QDVSEEGYELGNFSGMNDEDSSSGQAGAINHRKKSVVSKTTAVXXXXXXXXXXXXXXXXX 65
           ++V  E Y  G     ND  + S ++  + H +K   +K   +                 
Sbjct: 3   ENVELETYPAGK--QHNDRSAESSESSDVLHHRKE--TKNEGI----------------- 41

Query: 66  FVKEGQVHEAE---------VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGL 116
           F+ +  + E E         VKR LK RH                  ++P+  AGPVG L
Sbjct: 42  FINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSL 101

Query: 117 IAYLFMATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFAL 176
           +AYLFM T+ + V QSLGEMATFIPVTS+FT+++ RFLSPA GAA+GY+YWFSW +TFAL
Sbjct: 102 LAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFAL 161

Query: 177 ELSVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFII 236
           ELS++GQ+I++WT AVP++ WI +FW+LLT SN+ PV++YGE EFWIA +KV+++ GF+I
Sbjct: 162 ELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLI 221

Query: 237 YCLCMVCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELV 296
           Y L MVCG    G +GFRYW+NPG WG G+IS +K E RFLGWVSSLI AAFTYQGTELV
Sbjct: 222 YALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELV 281

Query: 297 GITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLN-SSDSYVSSSPF 355
           GITAGE+ NPRK+VP+AI KV FRIL FY     F+GLLVPY DP+L+ +SDS +++SPF
Sbjct: 282 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPF 341

Query: 356 IIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGV 415
           ++AI+NSGTKVLP +FN V+L TI+SAGNSN+Y+GSR++YGL+K  LAPS F +TN  GV
Sbjct: 342 VMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGV 401

Query: 416 PYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRG 475
           P++AV  +S FG LAY+ +S      F+WLL IT VAGFF W+LIS  HIRFMQ LK RG
Sbjct: 402 PFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRG 461

Query: 476 ISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWL 535
           ISR+DLPFKAKFMPW AYYA FF+ VIILIQGF +FAP F   +F A Y+SVFLFI  WL
Sbjct: 462 ISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWL 521

Query: 536 GAQIWFRCRIFHRLDEVDIDTDRRDIEAVVW-DDEPPKTLWDKFWN 580
           G Q+ F+ R+  R ++VDIDTDRR+I+A+VW DD+ PKTL  K W 
Sbjct: 522 GFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/517 (60%), Positives = 395/517 (76%), Gaps = 1/517 (0%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +EG  HE EVKRALK RH                  ++PL  AGPVG LIAY+FM T+VY
Sbjct: 51  QEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVY 110

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           S+ QSLGEMATFIPVTS+ TVFS RFLSPAFG A+GYMYWF+WAITFA+ELSVVGQII +
Sbjct: 111 SITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINY 170

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           WT+ VP+ AWITIFW+++T+ N FPV++YGE EFWIA +KVI +VG++IY   +VCG   
Sbjct: 171 WTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGSS 230

Query: 248 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
            GP+GFR WRNPG WG G+IS ++ E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPR
Sbjct: 231 QGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPR 290

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKV 366
           K+VP+AI KV FRIL FY     F+GLLVPYNDP++ N+SD+ V++SPF+I+I N+GTK+
Sbjct: 291 KTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAGTKI 350

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           LP IFNAVVL T++SA NSNVY+GSR++Y LA+   AP  FG  N  GVP   V  T+  
Sbjct: 351 LPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALM 410

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           G +A++ ++    +AFNWL+NI+ +AG   W+ IS  HIRFMQ LK RGISRD LPFKAK
Sbjct: 411 GLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAK 470

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIF 546
           FMPW AYYA  F+ VII IQG+TAF+P F    F  AY+S+ L + +++G QI+++CR  
Sbjct: 471 FMPWAAYYAASFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFL 530

Query: 547 HRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
            +L+++DIDT+RR+I+A+VW+D+ PK LWDKFW+ +A
Sbjct: 531 WKLEDIDIDTNRREIDAIVWEDDEPKNLWDKFWSTIA 567

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/515 (60%), Positives = 396/515 (76%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           EG + E +VKRALK RH                  ++PLS +GPVG LIAY+FM T+VY 
Sbjct: 107 EGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYF 166

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V QS+GEMATFIPVTS+ TVFSSRFLSPAFG A+GYMYWF+WAITFA+ELSV GQ+IE+W
Sbjct: 167 VTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYW 226

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           T AVP AAWI IFWVL+T++N FPV++YGE EFW+A IKV+A+VG++IY L +VCG    
Sbjct: 227 TEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGSKQ 286

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           GP+GFRYWRNPG WG GIISKDK+EGRFLGWV+SLINA+FTYQGTELVGITAGEAANPR+
Sbjct: 287 GPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANPRR 346

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           +VPRAI KV FRIL FY     F+GLLVPYN   L+ + + ++SSPF+I+I+N+GT+ LP
Sbjct: 347 TVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIASSPFVISIQNAGTRALP 406

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
            IFNAVVL TIISA NSNVYVGSR+++ LA   +AP  F      GVP+  V  TS  G 
Sbjct: 407 DIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGL 466

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           LA++ ++     AFNWL+NI+ +AG   W+ IS  HIRFMQ LK RGISRDDLPFK+K M
Sbjct: 467 LAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLM 526

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR 548
           P+ AYYA F++ VII +QGF AF+P F   +F  +Y+S+ L + ++ GAQ+++RCR F+R
Sbjct: 527 PYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQLFYRCRFFNR 586

Query: 549 LDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           L+++DID+DRR+ +A++W+D+ P TLW KFW  VA
Sbjct: 587 LEDIDIDSDRREADALIWEDDEPTTLWGKFWTAVA 621

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/523 (59%), Positives = 397/523 (75%), Gaps = 7/523 (1%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +E    + +VKR LKQRH                  +TPL++AGPVG LIAY+FM ++VY
Sbjct: 75  EEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVY 134

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
            V Q+LGEMATFIPVTS+ TVFS RFLSPAFG A+GYMYWF+WAITFA+E+SVVGQ+I++
Sbjct: 135 FVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQY 194

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AG 246
           WT AVP+AAWI IFWVL+T+ N FPVK YGE EFW+AF+KVIA+VG+++Y L +VCG + 
Sbjct: 195 WTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSK 254

Query: 247 ITGPVGFRYWRNPGAWGPGIISK------DKNEGRFLGWVSSLINAAFTYQGTELVGITA 300
             GP+GFRYWRNPGAWG G+ S        K EGRFLGWV+SLINAAFTYQGTELVGITA
Sbjct: 255 KQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGITA 314

Query: 301 GEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIE 360
           GEAANPRK+VPRAI KVVFRI++FY     FIGLLVP+ D +L+   + ++SSPF+I+IE
Sbjct: 315 GEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRLSDDTTVIASSPFVISIE 374

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
           N+GTK+LP IFNA+V+ T++SA NSNVYVGSR++Y LA  K+AP  F R    GVP+  V
Sbjct: 375 NAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGV 434

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
             TS  G LA++ +     +AFNWL++I+ +AG   W+ IS  H+RFMQ LK RGISRDD
Sbjct: 435 ICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDD 494

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIW 540
           LPFKAKFMPW +YYA F++ VII +QGF AF+P F    F   Y+S+ L   +++GAQ++
Sbjct: 495 LPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISLILLAVVFIGAQLY 554

Query: 541 FRCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           +RCR   +L++VDID+DRR+IE  +W+D+ PKT+WDKFW  +A
Sbjct: 555 YRCRFLWKLEDVDIDSDRREIEDAIWEDDEPKTIWDKFWAAIA 597

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/516 (59%), Positives = 393/516 (76%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
            EG + E +VKRALK RH                  ++PLS+AGPVG LIAY+FM ++VY
Sbjct: 45  DEGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVY 104

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
            V QS+GEMATFIPVTS+ TVFS+RFLSPAFG A+GYMYWF+WAIT+A+E+SV+GQ+I++
Sbjct: 105 FVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQY 164

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           WT AVP+AAWI IFWV +T++N FPV++YGE EFW+A IKVIA+VG+++Y L +VCG   
Sbjct: 165 WTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGSK 224

Query: 248 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
            GP+GFRYWRNPG WG GIIS DK++GRFLGWV+SLINA+FTYQGTELVGITAGEAANPR
Sbjct: 225 QGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPR 284

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K+VP+AI KV FRIL FY     F+GLLVPYN P L+   S ++SSPF+I+I+++GT++L
Sbjct: 285 KTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASSPFVISIQSAGTRIL 344

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P IFNAVVL TIISA NSNVYVGSRI++ LA   +AP  F      GVPY  V  T+  G
Sbjct: 345 PDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLG 404

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++ +       FNWL+NI+ +AG   W+ IS  HIRFMQ LK RGISRDDLPFK+K 
Sbjct: 405 LLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKL 464

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFH 547
           MP+ AYYA F++ VII +QGF AF P F   +F   Y+S+ L   ++  AQ+++RCR F+
Sbjct: 465 MPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFFN 524

Query: 548 RLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           RL+++DID+DRR+I+A++W++E P TLW KFW  VA
Sbjct: 525 RLEDIDIDSDRREIDALIWEEEEPTTLWGKFWVAVA 560

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/515 (62%), Positives = 400/515 (77%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           EG   E EVKRALK RH                  ++PLS +GPVG LIAY+F+ ++VY 
Sbjct: 48  EGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYF 107

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V QSLGEMATFIPVTS+ TVFS RFLSPAFG A+GYMYWF+WAIT+A+E++VVGQ+I++W
Sbjct: 108 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYW 167

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           T AVP+AAWI IFWVL+T++N FPVK+YGE EFW+A +KVIA+VG++IY L +VCG    
Sbjct: 168 TDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGSHQ 227

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           GP+GFRYWRNPG WGPGIISKD NEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 228 GPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 287

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           +VPRAI KV FRIL FY     FIGLLVPY+D +L+++ + ++SSPF+I+I+N+GTKVLP
Sbjct: 288 TVPRAINKVFFRILFFYILSLFFIGLLVPYDDLRLSNTTAVIASSPFVISIQNAGTKVLP 347

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
           HIFNA+V+ TIISA NSNVYVGSR++Y LA    AP  FG     GVPY  V  T+  G 
Sbjct: 348 HIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGL 407

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           LA++ ++     AFNWL+NI+ +AG   W+ IS  H+RFMQ LK+RGISR+DLPFKAK M
Sbjct: 408 LAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLM 467

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR 548
           PW AYYA FF+ VII+IQGF AF P F   DF  +Y+S+ L   ++LG Q+++RCR    
Sbjct: 468 PWGAYYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFIWS 527

Query: 549 LDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           LD++DID+DRR+I+A+VW+D+ PK LW+KFW  VA
Sbjct: 528 LDDIDIDSDRREIDAIVWEDDEPKNLWEKFWVAVA 562

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/511 (61%), Positives = 390/511 (76%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           EG  HE EVKRALK RH                  + PLS +GPVG LIAY+FM ++VY 
Sbjct: 65  EGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYF 124

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V QSLGEMATFIPVTS+ TVFS RFLSPAFG A+GYMYWF+WAIT+A+ELSV+GQII +W
Sbjct: 125 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYW 184

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           T AVP+AAWI IFWVLLT +N FPVK+YGEFEF +A IKVIA+VG+++Y L +VCG    
Sbjct: 185 TDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGSSQ 244

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           GP+GFRYWRNPG WG G I+K+ N+ RFLGWV SL+NA+FTYQGTELVGITAGEA+NPRK
Sbjct: 245 GPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPRK 304

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           +VP+AI KV FRILVFY     F+GLLVPYN P+L S+ + ++SSPF+I+I+N+GTKVLP
Sbjct: 305 TVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLESNSAVIASSPFVISIQNAGTKVLP 364

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
            IFNAVVL TI+SAGNSNVYVGSR++Y LA    AP  F      GVPY  V  T+  G 
Sbjct: 365 DIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLGL 424

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           LA++  +    +AFNWL+NI+ +AG   W  IS  HIRFMQ LK RGISRD LPFKAK M
Sbjct: 425 LAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLM 484

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR 548
           PW AYYA FF+ +I+ IQGFTAFAP F   +F  AY+S+ L + +++  Q+++RCR   +
Sbjct: 485 PWGAYYAAFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLYYRCRFLTK 544

Query: 549 LDEVDIDTDRRDIEAVVWDDEPPKTLWDKFW 579
           ++++DID+DRR+I+A++W+D+ PK LW+KFW
Sbjct: 545 IEDIDIDSDRREIDAIIWEDDEPKNLWEKFW 575

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/518 (57%), Positives = 383/518 (73%), Gaps = 2/518 (0%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +EG   E EVKRALK RH                  ++PL  AGPVG L+AY+F+ T+VY
Sbjct: 46  EEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVY 105

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           S+ QSLGEMATFIPVTS+ TVFS RFLSPAFG A+GYMYWF+WAITFA+ELSVVGQII++
Sbjct: 106 SITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQY 165

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           WT  VP+AAWI IFWVL+T+ N FPV++YGE EFWIA +KV+ +VG++IY   +VCG   
Sbjct: 166 WTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSK 225

Query: 248 TGPVGFRYWRNPGAWGPGIISKD-KNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
            GP+G        A G    S+  +    FLGWVSSLI AAFTYQGTELVGITAGE+ NP
Sbjct: 226 QGPIGLPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNP 285

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNS-SDSYVSSSPFIIAIENSGTK 365
           RK+VP+AI KV FRIL FY    +F+GLLVPY+DP+LNS S + V++SPF+I+I+N+GTK
Sbjct: 286 RKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTK 345

Query: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425
           +LP IFNAVVL T+ISA NSNVY+GSR+ Y LA    AP         GVPYF V  TS 
Sbjct: 346 ILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSL 405

Query: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485
            G ++++ L+   ++AF+WL+NI+ +AG   W+ IS  HIRFMQ LK+RGISRDDLPFKA
Sbjct: 406 MGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKA 465

Query: 486 KFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRI 545
           KFMPW AYYA FF+ VII IQG+TAF P F    F  +Y+S+FL + +++G QI+++CR 
Sbjct: 466 KFMPWAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRF 525

Query: 546 FHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
              ++++DID+DRR+I+A+VW+++ PK +WDKFW+ VA
Sbjct: 526 LWAVEDIDIDSDRREIDAIVWEEDEPKNIWDKFWSAVA 563

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/515 (57%), Positives = 383/515 (74%), Gaps = 1/515 (0%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G+ H+ +VKRALK RH                  S PLS +GPVG LIAY+FM ++VY 
Sbjct: 94  KGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYF 153

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V QSLGEMATFIPVTS+ TVF+ RFLSPA G ++GYMYWF+WAITFA ELSV GQII++W
Sbjct: 154 VTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYW 213

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           T  VP+AAWI IFWV++ V N FPVK YGE EFW++ +KV+A+VG++IY L +VCG    
Sbjct: 214 TYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSRQ 273

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           GP+GFRYWR+  A+G G ISK+K+E RFLGWVSSLINAAFTYQGTELVGI+AGEAANPRK
Sbjct: 274 GPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRK 333

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           +VPRAI KV+FRI +FY     FIGLLVPYND +L+   + ++SSPF+I++ N+GT  LP
Sbjct: 334 TVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPFVISMLNAGTSALP 393

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
            IFNAV+L T++SA NS+VY+ SR++Y LA    AP  F   N  GVPY  VF T   G 
Sbjct: 394 DIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGW 453

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           LA++ +S    +AFNWL+NI+ +AG   W  I   HIRFMQALK++GISRDDLPFKA+FM
Sbjct: 454 LAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFM 513

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR 548
           PW AYYA FF+ +II IQG+ AF P +    F  +Y+S+ LF  ++LG  I++R R+  +
Sbjct: 514 PWGAYYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYYRGRLLIK 572

Query: 549 LDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583
           ++++DIDTDR+++EA VW+++ P+  W+KFW  VA
Sbjct: 573 IEDIDIDTDRKEVEAYVWEEDAPRNWWEKFWAAVA 607

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/509 (60%), Positives = 393/509 (77%), Gaps = 3/509 (0%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
           ++++VKR LK RH                  ++P+ NAGPVG L+AY+F+AT+ Y V QS
Sbjct: 45  NQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQS 104

Query: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           LGEMATFIPVTS+FTVF+SRF+SPA GAA+GY+YW SW ITFALE+SV+G++I +W+ AV
Sbjct: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
           P+ AW+ IFWVLLT  NL PVK+YGEFEFWIA +KVIA++ F+ Y L +VCG    G +G
Sbjct: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
           FRYW++PG WG GI+S++ +  +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR++VP+
Sbjct: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFIIAIENSGTKVLPHI 370
           AI  V FRIL+FY    + IGLLV Y+DP+L  + S +  ++SPF++AI  +GTKVLP I
Sbjct: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V++ TIISAGNSN+YVGSR++YGL +  LAP+F  RT + GVPY AV  TS FGAL 
Sbjct: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           Y+ +S+   S F+WLL+IT V+GFFTW+LIS  HIRFMQ LK RGISRDDLPFKAKFMP+
Sbjct: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464

Query: 491 LAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLD 550
            AYYA FF++VIIL+QGFTAF P FS VDF A Y+S F+F+ IWL  Q  F+ R FH +D
Sbjct: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVD 523

Query: 551 EVDIDTDRRDIEAVVWDDEPPKTLWDKFW 579
           E+DIDTDRRDI+A++WDD+ P TLW K W
Sbjct: 524 EIDIDTDRRDIDAIIWDDDKPTTLWGKIW 552

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  344 bits (883), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/522 (36%), Positives = 300/522 (57%), Gaps = 17/522 (3%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
            +G+     +K+ LK RH                   T L+ AGP    I Y F+  LV+
Sbjct: 55  DDGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVF 114

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
             +  LGEMA FIP+   FT ++SR++ PA G A GY Y   + I  A +L+    ++++
Sbjct: 115 FTMSCLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQY 173

Query: 188 WTTAVPM--AAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245
           W     +    +ITIF +L+   N+F VK +GEFEFW++  KV+ ++G I+    ++ G 
Sbjct: 174 WVDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGG 233

Query: 246 GITGP-VGFRYWRNPGAWGP---GIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAG 301
           G     +GFRYWR+PG++ P    IIS   + G+F+ + S  + A F Y G EL GI A 
Sbjct: 234 GPNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAA 293

Query: 302 EAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDP---KLNSSDSYVSSSPFIIA 358
           EA NPRK++P+AIK  ++RI++FY    + + + V YNDP   K     +  ++SPF++A
Sbjct: 294 EAQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVA 353

Query: 359 IENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYF 418
           IENSG  +LPHIFN  VL  ++SA NS++YV SR +Y LA    AP FFG+TN  G+PY+
Sbjct: 354 IENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYW 413

Query: 419 AVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISR 478
           ++ F++AF  LAYM +S+  ++ FN+ +N   + G  +W+ I   +I F +A K +G+ +
Sbjct: 414 SLAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDK 473

Query: 479 DDLPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGA 537
            +  + A + P+ AY+ALFF  V+ L++ FT F    F   +F   Y+ + +F   ++G 
Sbjct: 474 SNFTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGY 533

Query: 538 QIWFRCRIFHRLDEVDIDT-----DRRDIEAVVWDDEPPKTL 574
           +I ++ +  HR +EVD+ T     D+ + +  + D E  + L
Sbjct: 534 KIVYKTKT-HRPEEVDLVTLKALIDQEEEDGKIEDAEREERL 574

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  344 bits (882), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/519 (36%), Positives = 294/519 (56%), Gaps = 13/519 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           + +G+     +K+ LK RH                   T L   GP   LIAY F+  LV
Sbjct: 40  ISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILV 99

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           + V+  LGEMAT+IP+   FT +++R+  PA G A GY Y F + I    +L+    +I+
Sbjct: 100 FFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQ 158

Query: 187 FWT--TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG 244
           +W     V    WITIF V++ + N   V+Y+GEFEFW++  K++ + G I++   ++ G
Sbjct: 159 YWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLG 218

Query: 245 AGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303
            G     +GFRYW+NPGA+ P   S   ++G+F+ +V+  + A F Y G EL GI A EA
Sbjct: 219 GGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEA 278

Query: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIE 360
            NPR+++PRAIK  ++RI++FY      +G+ V YNDP+L     + +  ++SPF++AI+
Sbjct: 279 ENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQ 338

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
           NSG + LPHIFN  VL  + SA NS++YVG+R +Y LA    AP  F +TN  GVPY A+
Sbjct: 339 NSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAL 398

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
           F    F  LAYM +S+G A  FN+ +N+  + G  +W+ I   +I F +A   + + R+ 
Sbjct: 399 FGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNS 458

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIW 540
             ++A F P+ AY  LFF V+I  I+ FT F   F    F   Y+ + L++  + G +I 
Sbjct: 459 FAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKII 518

Query: 541 FRCRIFHRLDEVDIDT-----DRRDIEAVVWDDEPPKTL 574
           ++ ++  + +E D+ +     DR + E  + + E  + L
Sbjct: 519 YKTKLV-KAEEADLYSFKEAIDREEAEGKIKEAEAKERL 556

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  345 bits (884), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/536 (36%), Positives = 303/536 (56%), Gaps = 21/536 (3%)

Query: 66  FVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATL 125
           ++ +G+     +++ LK RH                     L  AGP+   IAY F+  L
Sbjct: 75  YMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVL 134

Query: 126 VYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185
           V+  + +LGEMA++IP+   FT ++SR+  PA G A GY Y   + I    +L+    +I
Sbjct: 135 VFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVI 193

Query: 186 EFW--TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC 243
           ++W     V    WITIF V++   N   VK++GEFEFW++  KVI ++G II    ++ 
Sbjct: 194 QYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIML 253

Query: 244 GAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 302
           G G T   +GFR++ +PGA+ P   S D ++G+F+ +V+ L+ A F Y G EL GI A E
Sbjct: 254 GGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAE 313

Query: 303 AANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDP---KLNSSDSYVSSSPFIIAI 359
           AANPRKS+P+AIK  ++RI+VFY      +G+ V Y+DP   K  +S +  ++SP+++AI
Sbjct: 314 AANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAI 373

Query: 360 ENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFA 419
            NSG K LPHIFNA VL  + SA NS++YV SR +YGLA    AP  F  TN  GVPY++
Sbjct: 374 INSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYS 433

Query: 420 VFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRD 479
           +  +S F  LAYM +S+G A  FN+ +N+  + G  +W+ I   ++ F +A+K + + R 
Sbjct: 434 LLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRS 493

Query: 480 DLPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQ 538
              ++A F P+ +Y+ L F ++I  I+ FT F    F   +F   Y+ + +F+  + G +
Sbjct: 494 RFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYK 553

Query: 539 IWFRCRIFHRLDEVDIDT-----DRRDIEAVVWDDEPPKTL-------WDKFWNIV 582
              + +I+ + +EVD+ T     D  + +  + D E  + L       WD F+  V
Sbjct: 554 FVKKTKIW-KPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKV 608

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  342 bits (878), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/532 (35%), Positives = 308/532 (57%), Gaps = 22/532 (4%)

Query: 68  KEGQVHEAE-VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
            E Q  E   +K+ L+ RH                  S+ LS  GP G L +Y+ ++ ++
Sbjct: 39  SESQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVI 98

Query: 127 YSVVQSLGEMATFIPVTS-----AFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVV 181
           Y V+ +LGEM  ++P +      + +   SR+  P+ G A+G+ Y++ + I  A E +  
Sbjct: 99  YPVMNALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAA 158

Query: 182 GQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM 241
             ++ +WTT VP AAWITIF  ++T+ N  PVK+YGE EFW A +K++ +VG +     +
Sbjct: 159 SGVVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFIL 218

Query: 242 VCGAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGIT 299
             G G +   +GFRYW+ PGA+   I +   N GRFL   + +I   F +  G ELV +T
Sbjct: 219 FWGGGPSHDRLGFRYWQKPGAFAYHITTG--NTGRFLDVWTGVIKGGFAFILGPELVAVT 276

Query: 300 AGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLN----SSDSYVSSSPF 355
           + EA + R+++ +A ++  +R++ FY   A+ IG++V  NDP L     S  +  +SSPF
Sbjct: 277 SSEAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPF 336

Query: 356 IIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGV 415
           +IAI+N+  K+LPHI NA +L++  S+GNS ++  SR +  +A+  +AP  F + N AGV
Sbjct: 337 VIAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGV 396

Query: 416 PYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRG 475
           PY AV  ++AF  LAY+ +S+G A AF W  NI+ ++GF  W+ I   ++RF +A+ +RG
Sbjct: 397 PYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRG 456

Query: 476 ISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTF-SGVDFAAAYVSVFLFIAIW 534
           +  D +PFK+ F P+  Y+ +  + +I L  G+  F P F  G DF AAY+++ +F+ +W
Sbjct: 457 L-YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLW 515

Query: 535 LGAQIWFRCRI--FHRLDEVDIDTDRRDIEAVVWDDE----PPKTLWDKFWN 580
           +G +I+ R        + EVD+ T   +IE +  + +    PP + W+KF +
Sbjct: 516 VGHKIYTRTLSTWVIPVAEVDVTTGLAEIEELTKELDALRVPPNSAWEKFMD 567

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  344 bits (882), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/517 (37%), Positives = 300/517 (58%), Gaps = 14/517 (2%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
           H   +K+ L+ RH                   T LS AGP    IAY F+  LV+  + +
Sbjct: 95  HTDGLKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAA 154

Query: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW--TT 190
           +GEMA++IP+   FT ++SR++ PA G A GY Y F + I    +L+    +I++W    
Sbjct: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP 250
            V    WITIF V++ + N+  VK++GEFEFW++  KV+ ++G I+    ++ G G    
Sbjct: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHD 273

Query: 251 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
            +GFRYW++PGA+ P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRKS
Sbjct: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIENSGTKV 366
           VPRA+K  V+RI++FY      +G+ V YNDP+L     + +  ++SPF++AI+NSG +V
Sbjct: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRV 393

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           LPHIFNA VL  + SA NS++YVGSR +Y LA    AP+ F RT + G+P++++     F
Sbjct: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
             LAYM +S+G A  FN+ +N+  + G  +W+ I   +I FM+A+K +G+ R    + A 
Sbjct: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513

Query: 487 FMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRI 545
           F P+  Y++L + V I  I+ FT F   +F   +F   Y+ + +F+  + G +   + +I
Sbjct: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573

Query: 546 FHRLDEVDIDT-----DRRDIEAVVWDDEPPKTLWDK 577
             +  EVD+ T     D+++IE  + D E    L + 
Sbjct: 574 V-KSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  337 bits (864), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/515 (37%), Positives = 294/515 (57%), Gaps = 13/515 (2%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G+     +K+ L+ RH                   T LS AGPV  LIAY F+  LVY 
Sbjct: 47  DGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYI 106

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V+  LGEMAT+IP+   FT ++SR+  PA G A GY Y F + I    +L+    ++++W
Sbjct: 107 VMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYW 165

Query: 189 TT--AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
            +   V    WITIF V++   N+  VK++GEFEFW++  KV+ ++  I+    ++ G G
Sbjct: 166 VSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGG 225

Query: 247 ITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
            +   +GFR++++PGA+ P   +   ++G+F+ +V+  + A F Y GTEL GI A E  N
Sbjct: 226 PSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKN 285

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIENS 362
           PR++VPRAIK  ++RI+VFY      +G+ V YNDP L       +  ++SPF++AI+N+
Sbjct: 286 PRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNA 345

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G  VLPHIFNA VL  + SA NS++YV SR +YGLA    AP  F +TN  GVPY ++  
Sbjct: 346 GIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLIL 405

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
              F  LAYM +S+G A  FN+ +N+  + G  +W+ I   +I F +AL+ +G+ +  L 
Sbjct: 406 CILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLA 465

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541
           + A      AY+ALFF  +I LI+ FT F    F   +F   Y+ + +FI  + G + + 
Sbjct: 466 YAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YI 524

Query: 542 RCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWD 576
           R   F + +E D+ T +  I+     +E    LWD
Sbjct: 525 RGTKFVKPEEADLYTFKELIDL----EEEEGKLWD 555

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  334 bits (856), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 190/502 (37%), Positives = 295/502 (58%), Gaps = 9/502 (1%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G+     +K+ L+ RH                   + L++AGPV  LI+Y F+  LVY+
Sbjct: 42  DGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYT 101

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V+  LGEMA FIP+   FT ++SR++ PA G A GY Y F + I    +L+    +++FW
Sbjct: 102 VMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFW 160

Query: 189 TTA--VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
            +   V    WITIF  L+ + N   V+++GEFEFW++ +KV+ ++G I+    ++ G G
Sbjct: 161 VSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGG 220

Query: 247 ITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
                 GFR+WR+PGA+ P   +   ++G+F+ + S    A F Y GTEL GI A EA N
Sbjct: 221 PNHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKN 280

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSS---SPFIIAIENS 362
           PR+SVPRAIK  ++RI+VFY    + +G+ V YNDP+L  +    +S   SPF++AIEN+
Sbjct: 281 PRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENA 340

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
              VLPHIFN  VL  + SA NS++YV SR +YGLA    AP  F  TN  GVPY+++  
Sbjct: 341 SIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGL 400

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           +  F  LAYM +S+G A  FN+ +N+  + G  +W+ I   +IRF +A++ +   +  L 
Sbjct: 401 SVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLS 460

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541
           + A F PW  Y ALFF  +I LI+ +T F    F    F + Y+ + +++  ++G ++ +
Sbjct: 461 YTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVY 520

Query: 542 RCRIFHRLDEVDIDTDRRDIEA 563
           R ++  + ++VD+ T +  I+A
Sbjct: 521 RTKLI-KPEDVDLYTFKDAIDA 541

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  332 bits (852), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/523 (36%), Positives = 296/523 (56%), Gaps = 17/523 (3%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           V +G+     +K+ LK RH                   T L  AGP   LIAY F+ TLV
Sbjct: 72  VMDGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLV 131

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           +  + +LGEMA +IP+   FT ++SR+  PA G A GY Y F + I    +L+    +I+
Sbjct: 132 FFTMAALGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQ 190

Query: 187 FWTT--AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG 244
           +W     V    WITIF V++   N   VKY+GEFEFW++  K++ ++G +I+   ++ G
Sbjct: 191 YWVDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLG 250

Query: 245 AGITGP-VGFRYWRNPGAWGP---GIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITA 300
            G     +GFRYW+ PGA+ P    +++ + + G+F+ +V+  + A F Y G EL GI A
Sbjct: 251 GGPNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVA 310

Query: 301 GEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFII 357
            EA NPR+++PRAIK  V+RIL FY      +G+ V Y+DP L    ++ +  ++SPF++
Sbjct: 311 AEAENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVV 370

Query: 358 AIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPY 417
           AI+NSG  VLPHIFN  VL  + SA NS++YVG+R +Y LA    AP  F +TN  GVPY
Sbjct: 371 AIQNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPY 430

Query: 418 FAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGIS 477
            A+     F  LAYM +S+G A  FN+ +N+  + G  +W  I    I F +A++ +GI 
Sbjct: 431 NAMGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGID 490

Query: 478 RDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLG 536
           R    + A F P+ +Y+ALFF V++ LI+ F+ F    F    F   Y+ + ++   ++G
Sbjct: 491 RSTFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIG 550

Query: 537 AQIWFRCRIFHRLDEVDIDT-----DRRDIEAVVWDDEPPKTL 574
            +++++ +   +  E D+++     DR + E  + + E  + L
Sbjct: 551 YKLYYKTKTV-KPHEADLNSYKAAVDREEEEGKIKEAERKERL 592

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  332 bits (851), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/520 (37%), Positives = 295/520 (56%), Gaps = 14/520 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           V +G+     +++ LK RH                   T L   GPV  LIAY F+  LV
Sbjct: 72  VPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLV 131

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           +  +  LGEMA++IP+   FT ++SR++ PA G A GY Y F + I    +L+    +I+
Sbjct: 132 FYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190

Query: 187 FWTTA--VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG 244
           +W +   V    WITIF V++   N+  VK++GEFEFW++  KV+ ++G I+    ++ G
Sbjct: 191 YWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLG 250

Query: 245 AGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303
            G     +GFRYWR+PGA+     +    +G+F+ +V+  + + F+Y G EL GI   EA
Sbjct: 251 GGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310

Query: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY---VSSSPFIIAIE 360
            NPRKSVP+AIK  V+RI+VFY      +G+ V YNDP+L S+       ++SPF++AI+
Sbjct: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
           NSG +VLPHIFNA VL  + SA NS++YV SR +Y LA    AP  F +T+  GVPY A+
Sbjct: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
             +  F  LAYM +S+G A  FN+ +N+  + G  +W+ I   +I F +A + +GI +  
Sbjct: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQI 539
             + A    + AY+ALFF ++I LI+ FT F    F    F   Y+ + ++I  W G ++
Sbjct: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKL 550

Query: 540 WFRCRIFHRLDEVDIDT-----DRRDIEAVVWDDEPPKTL 574
            ++ ++    D VD+ T     DR + E  + D E  + L
Sbjct: 551 IYKTKVIKSTD-VDLYTFKEIYDREEEEGRMKDQEKEERL 589

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  331 bits (848), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/516 (36%), Positives = 295/516 (57%), Gaps = 12/516 (2%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G+     +K+AL+ RH                   + L+ AGP   LIAY F+  LV+ 
Sbjct: 71  DGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFF 130

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V+  LGEMA +IP+   FT +S+R+  PA G A GY Y F + I    +L+    +I++W
Sbjct: 131 VMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189

Query: 189 TT--AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
                V    WITI  V +   N   V+++GE E++I+ +K+  ++G II  L + CG G
Sbjct: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGG 249

Query: 247 ITGPV-GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
               V GF+YW+NPGA+     +    +GRF+ + S  + A F Y GTEL GI   E  N
Sbjct: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIENS 362
           PRK+VP+AIK  ++RI+VFY      +G+ VP+NDP L    S+ +  S+SPF++AI N+
Sbjct: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNA 369

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G  VLPHI NA +L  + SA NS++YV SR +YGLA    AP  F +TN  GVPY+++  
Sbjct: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
              F  LAYM +S+G +  F + +N   + G  +W+ I   +IRF +A + +GI +  L 
Sbjct: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541
           +++   P+ A+++LFF ++I LI+ F AF   TF    F   Y+ +  +I  ++G ++W+
Sbjct: 490 YQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWY 549

Query: 542 RCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDK 577
           + +I    +EVD+ + +   EAV  ++E  K L ++
Sbjct: 550 KTKIIPS-EEVDLVSFK---EAVDLEEEEGKMLDEE 581

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  330 bits (847), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/520 (37%), Positives = 294/520 (56%), Gaps = 14/520 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           V +G+     +++ LK RH                   T L   GPV  LIAY F+  LV
Sbjct: 71  VPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLV 130

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           +  +  LGEMA++IP+   FT ++SR++ PA G A GY Y F + I    +L+    +I+
Sbjct: 131 FFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 189

Query: 187 FWTTA--VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG 244
           +W +   V    WITIF V++   N+  VK++GEFEFW++  KV+ ++G I+    ++ G
Sbjct: 190 YWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLG 249

Query: 245 AGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303
            G     +GFRYWR+PGA+     +    +G+F+ +++  + + F+Y G EL GI   EA
Sbjct: 250 GGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEA 309

Query: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV---SSSPFIIAIE 360
            NPRKSVP+AIK  V+RI+VFY      +G+ V YNDP+L S+       ++SPF++AI+
Sbjct: 310 QNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQ 369

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
           NSG KVLPHIFNA VL  + SA NS++YV SR +Y LA    AP  F +TN  GVPY A+
Sbjct: 370 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNAL 429

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
            F+  F  LAYM +S G A  FN+ +N+  + G  +W+ I   +I F +A + +GI +  
Sbjct: 430 IFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 489

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQI 539
             + A    + AY+AL F + I LI+ FT F    F    F   Y+ + +++  W+G ++
Sbjct: 490 FAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKL 549

Query: 540 WFRCRIFHRLDEVDIDT-----DRRDIEAVVWDDEPPKTL 574
            ++ ++    D VD+ T     DR + +  + D E  + L
Sbjct: 550 IYKTKVIKSTD-VDLYTFKEIYDREEEQGKIEDQEKEERL 588

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  330 bits (846), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/520 (37%), Positives = 293/520 (56%), Gaps = 14/520 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           + +G+     +K+ LK RH                   T L   GPV  LIAY F+  LV
Sbjct: 70  IADGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLV 129

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           +  +  LGEMA++IP+   FT ++SR++ PA G A GY Y F + I    +L+    +I+
Sbjct: 130 FFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 188

Query: 187 FWTTA--VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG 244
           +W +   V    WITIF V++   N+  VK++GEFEFW++  KV+ ++G I+    ++ G
Sbjct: 189 YWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLG 248

Query: 245 AGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303
            G     +GFRYWR+PGA+     +   + G+F  +V+  + + F+Y G EL GI   EA
Sbjct: 249 GGPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308

Query: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY---VSSSPFIIAIE 360
            NPRKSVP+AIK  V+RI+VFY      +G+ V YNDP+L S+       ++SPF++AI+
Sbjct: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
           NSG KVLPHIFNA VL  + SA NS++YV SR +Y LA    AP  F +T+  GVPY A+
Sbjct: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
             +  F  LAYM +S+G A  FN+ +N+  + G  +W+ I   +I F +A + +GI +  
Sbjct: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQI 539
             + A    + AY+AL F ++I LI+ FT F    F    F   Y+ + ++I  W G ++
Sbjct: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKL 548

Query: 540 WFRCRIFHRLDEVDIDT-----DRRDIEAVVWDDEPPKTL 574
            ++ ++    D VD+ T     DR + E  + D E  + L
Sbjct: 549 IYKTKVIKSTD-VDLYTFKEIYDREEEEGRIKDQEREERL 587

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  329 bits (844), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/520 (36%), Positives = 294/520 (56%), Gaps = 14/520 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           V +G+     +++ LK RH                   T L   GPV  LIAY F+  LV
Sbjct: 70  VPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLV 129

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           +  +  LGEMA++IP+   FT ++SR++ PA G A GY Y F + I    +L+    +I+
Sbjct: 130 FFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 188

Query: 187 FWTTA--VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG 244
           +W +   V    WITIF V++   N+  V+++GEFEFW++  KV+ ++G I+    ++ G
Sbjct: 189 YWVSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLG 248

Query: 245 AGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303
            G     +GFRYWR+PGA+     +   ++G+F+ + S  + + F+Y G EL GI   EA
Sbjct: 249 GGPDHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEA 308

Query: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSS---SPFIIAIE 360
            NPRKSVP+AIK  V+RI+VFY      +G+ V YNDP+L S+     S   SPF++AI+
Sbjct: 309 KNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQ 368

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
           NSG KVLPHIFN  VL  + SA NS++YV SR +Y LA    AP  F +T+  GVPY+A+
Sbjct: 369 NSGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYAL 428

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
             +  F  LAYM +S G A  FN+ +N+  + G  +W+ I   +I F +A + +G+ +  
Sbjct: 429 MVSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSK 488

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQI 539
             + A    + AY+ALFF ++I LI+ FT F   TF    F   Y+ + +++  W+G ++
Sbjct: 489 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKL 548

Query: 540 WFRCRIFHRLDEVDIDT-----DRRDIEAVVWDDEPPKTL 574
            ++ ++    D  D+ T     DR + +  + D E  + L
Sbjct: 549 IYKTKVVKPAD-ADLYTLKEIYDREEEQGKLQDQEKEERL 587

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/502 (37%), Positives = 296/502 (58%), Gaps = 9/502 (1%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G+     +K+AL+ RH                   + L++AGP   LI+Y F+  LVY+
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V+  LGEMA FIP+   FT ++SR++ PA G A GY Y F + I    +L+    ++++W
Sbjct: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161

Query: 189 TT--AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
            +   V    WITIF VL+ + N   V+++GEFEFW++ +KV+ ++G I+    ++ G G
Sbjct: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGG 221

Query: 247 ITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
                 GFRYWR+PGA+ P   +   ++G+F+ + S    A F Y GTEL GI A EA N
Sbjct: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKN 281

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDP---KLNSSDSYVSSSPFIIAIENS 362
           PR+SVPRAIK  ++RI++FY    + +G+ V YNDP   K     +  ++SPF++AI+N+
Sbjct: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNA 341

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G  VLPHIFNA VL  + SA NS++YV SR +YGLA  + AP  F +TN  GVPY+++  
Sbjct: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           +  F  LAYM +S+G A  FN+ +N+  + G  +W+ I   ++RF +A+  +   +    
Sbjct: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541
           + A F PW  + +LFF  +I LI+ +T F   TF    F + Y+ + ++   ++G ++  
Sbjct: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521

Query: 542 RCRIFHRLDEVDIDTDRRDIEA 563
           R ++  + ++VD+ T +  I+A
Sbjct: 522 RSKLI-KPEDVDLYTFKAAIDA 542

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  323 bits (829), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/540 (33%), Positives = 300/540 (55%), Gaps = 34/540 (6%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G+     +K+ L+ RH                   + LS AGP+  LIAY  M  +V++
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V+  LGEMA +IP+   FT +++R+  PA G A GY Y F + +    +L+    ++++W
Sbjct: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168

Query: 189 TT--AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
                V    WIT+F  ++   N+  VK++GEFEFW++  KV+ +       LC++    
Sbjct: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVM-------LCVMTLLL 221

Query: 247 IT--------GPVGFRYWRNPGAWGP--GIISKDKNEGRFLGWVSSLINAAFTYQGTELV 296
           +           +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL 
Sbjct: 222 VLVLGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELC 281

Query: 297 GITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSS 353
           GI A E  NPR++VPRAIK  ++RI+VFY      +GL V YNDP L     + +  ++S
Sbjct: 282 GIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAAS 341

Query: 354 PFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAA 413
           P+++AI+N+G  VLPHIFNA VLT + SA NS++YVGSR +YGLA  K AP  F +TN+ 
Sbjct: 342 PYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSW 401

Query: 414 GVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKY 473
           GVPY ++   + F  LAYM +S+   + F++ +N+T + G  +W+ I   +I F +A + 
Sbjct: 402 GVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRV 461

Query: 474 RGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIA 532
           +GI ++ L ++A F P  A+ AL F +++ L++ FT F   TF    F   Y+ + ++I 
Sbjct: 462 QGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYIL 521

Query: 533 IWLGAQIWFRCR--------IFHRLDEVDIDTDRRDIEAVVWDDEPPKT--LWDKFWNIV 582
            ++  +I  + +        +F     +D++ +   +E +   +E  +    W +F++ +
Sbjct: 522 CFVCYKIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  325 bits (832), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/519 (35%), Positives = 299/519 (57%), Gaps = 21/519 (4%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           +K+ L+ RH                  S+ LS  GP G L +Y+ ++ ++Y V+ SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 137 ATFIPVTS-----AFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTA 191
             F+P ++     + +   +R+  P+ G A+G+ Y++ + I  A E +    ++ +WTTA
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 192 VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP- 250
           VP  AWI IF  ++TV N  PVK YGE EFW A +K++ +VG +     +  G G T   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 251 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKS 309
           +GFRYW++PGA+   I +   N GRFL   + +I   F +  G ELV IT+ EA + R++
Sbjct: 285 LGFRYWQHPGAFAYHITTG--NTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSS----DSYVSSSPFIIAIENSGTK 365
           + +A ++  +R++ FY   A+ IG++V   DP L ++     +   SSPF+IAI+N+  K
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425
           VLPHI NA +L++  S+GNS ++  SR +  +A+   AP   GR N  GVPY+AV  ++A
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485
           F  LA++ +S+G A AF W  NI+ ++GF  W+ I   +++F +A+ +RG+  + +PFK+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 486 KFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRC-- 543
              P+  Y+ +  + +I L  G+ +F   ++  DF AAY+++ +F+ +W+G +I+ R   
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWS 580

Query: 544 RIFHRLDEVDIDTDRRDI--EAVVWDDE--PPKTLWDKF 578
                + EVD+ T   +I  E  + D +  PP   W KF
Sbjct: 581 TWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  323 bits (829), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/529 (34%), Positives = 293/529 (55%), Gaps = 22/529 (4%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
           +E  +++ LK RH                  S+ L+  GP G  I+Y+ ++++VY ++  
Sbjct: 73  NEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCG 132

Query: 133 LGEMATFIP-----VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
            GEM  ++P      + +     +R++  + G A+ + Y++ + I  A E +    ++E+
Sbjct: 133 FGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEY 192

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           WT AVP   WI IF  ++ + N  PVKYYGE EFW A IK++ +VG II    +  G G 
Sbjct: 193 WTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGP 252

Query: 248 TGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAAN 305
               +GFRYW+ PGA+   I+      GRFL   S +I   F +  G ELV +T+ E  +
Sbjct: 253 NHDRLGFRYWQRPGAFTEHIMKG--GFGRFLDIYSGVIKGGFAFILGPELVCLTSAECED 310

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL----NSSDSYVSSSPFIIAIEN 361
            R+++ +A ++ ++R++ FY    + I ++V YNDP L     S      SSPF+I I+N
Sbjct: 311 QRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQN 370

Query: 362 SGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVF 421
           +G +VLPHI NA +L++  SAGN+ ++  +R +  +A+   AP  FG+ N  GVPY A+ 
Sbjct: 371 AGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAIS 430

Query: 422 FTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDL 481
            +     LA++ +S+  A  FNW  NI+ ++GF  W+     +IRF +A+ + G+  D L
Sbjct: 431 LSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRL 489

Query: 482 PFKAKFMPWLAYYALFFMVVIILIQGFTAFAP-TFSGVDFAAAYVSVFLFIAIWLGAQIW 540
           PFK    P+  YY+LF + +I L  G+  F P  + G DF AAY+++ +F+ +W+G ++W
Sbjct: 490 PFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLW 549

Query: 541 FRC---RIFHRLDEVDIDTDRRDIE--AVVWDDE--PPKTLWDKFWNIV 582
            R    R + R+D++D+ T   DIE    + D+    P T W KF + V
Sbjct: 550 TRTFTKRWWRRVDQIDVTTGLVDIEERTKILDETRVEPSTRWQKFMDAV 598

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/515 (36%), Positives = 290/515 (56%), Gaps = 13/515 (2%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G+     +K+ L+ R                      L+ AGPV  LIAY F+  LV+ 
Sbjct: 63  DGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFF 122

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            + SLGEMA++IP+   FT +++R+  PA G A GY Y F + I    +L+    +I++W
Sbjct: 123 TMASLGEMASYIPL-DGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYW 181

Query: 189 --TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
                V    WITIF V++   N   V+++GEFEFW++  KV+ +   II    ++ G G
Sbjct: 182 IPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGG 241

Query: 247 ITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
                +GFR+W++PGA+     +   + G+F+ +VS  + A F Y GTELVGI  GEA N
Sbjct: 242 PNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARN 301

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIENS 362
           PRKSVP+AIK  ++RI++FY    + +G+ V Y+DP L    +  +  ++SPF++AI NS
Sbjct: 302 PRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNS 361

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G KVLPHIFNA VL  + SA NS++YV SR +Y LA    AP  F RTN  G+PY+++  
Sbjct: 362 GIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGL 421

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           +  F  LAYM +S+G A  FN+ +N+  + G  +W+ I   ++ F +A++ +GI +    
Sbjct: 422 SVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFS 481

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541
           + A    + AY+ALFF  +I LI+ FT F    F    F   Y+ + +F   + G ++ +
Sbjct: 482 YVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKLIY 541

Query: 542 RCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWD 576
           + +I   L EVD+ T     +A +  +E    L D
Sbjct: 542 KTKIIDPL-EVDLYT----FKAAIDQEEEDGKLED 571

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  321 bits (822), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/499 (35%), Positives = 278/499 (55%), Gaps = 12/499 (2%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
           +  ++ +K  LK RH                   T L  AGP G LI +    T++YS+V
Sbjct: 73  KTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMV 132

Query: 131 QSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
            ++GE+A   PV   FT +++RF+  +FG A+ ++Y   W +   LE+      + +W T
Sbjct: 133 MAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGT 192

Query: 191 AVP-MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITG 249
                  ++ +F+V++ + N+F VK YGE EF  +FIKVI ++GFII  + ++CG G   
Sbjct: 193 DPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDH 252

Query: 250 P-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
             +G +YW NPGA+       D    +F G+ +  + AAF++ G+ELVG+   EA  PRK
Sbjct: 253 KYIGAQYWYNPGAF-----VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRK 307

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVL 367
           SVP A K+V +RI +FY    + IG+LVP + P+L  +S    ++SPF+IAI N G K L
Sbjct: 308 SVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIVNHGIKGL 367

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P + N V+L  ++S GNS +Y  SR +  LA     PS  G  +  G P   +  ++ FG
Sbjct: 368 PSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFG 427

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            +A++  S      FNWL+ ++G++  FTW  I  CHIR+  AL  +G S D+LPF+A  
Sbjct: 428 LIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPA 487

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFS---GVDFAAAYVSVFLFIAIWLGAQIWFRC- 543
             W +Y+  F  +++ + Q +    P  +     DF  AY+S  +FIA++   +IW R  
Sbjct: 488 GVWGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIWKRNW 547

Query: 544 RIFHRLDEVDIDTDRRDIE 562
           ++F  L ++DIDT RR+++
Sbjct: 548 KLFIPLKDLDIDTGRREVD 566

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  322 bits (824), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/509 (36%), Positives = 285/509 (55%), Gaps = 19/509 (3%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           + +G+     +K+ LK RH                     L  AGPV  LIAY F+  +V
Sbjct: 55  IGDGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMV 114

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           +  +  LGEMATFIP+   FT ++SR+  PA G A GY Y   + I    +L+    +++
Sbjct: 115 FFTMACLGEMATFIPL-DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQ 173

Query: 187 FWT--TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVG-----FIIYCL 239
           +W     V    W+T+ + ++TV N+F V+++GEFEFW++ +KV+ ++G     F+I   
Sbjct: 174 YWVPRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVI--- 230

Query: 240 CMVCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGIT 299
            M+ GAG    +GFRYW++PGA+         + G+F+ +V+ L+   F Y G EL GI 
Sbjct: 231 -MLGGAGSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIV 289

Query: 300 AGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIA 358
           A EA+NPR+SVP+AIK   +RILVFY      +G+ VPYND KL  ++++ +++SPF IA
Sbjct: 290 AAEASNPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIA 349

Query: 359 IENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYF 418
           I N+G  VLP IFN  +L  + SA NS++YV SR +Y LA    AP  F  TN  G+PY 
Sbjct: 350 ILNAGITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYN 409

Query: 419 AVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISR 478
           ++F +  F  LAYM +S+  A  F + +N+  +AG  TW+ I   +I F +A++ + + +
Sbjct: 410 SLFVSCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDK 469

Query: 479 DDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQ 538
               + A F P+ AY +LFF  +I +I+ FT F   F    F   Y+ + +F+  + G +
Sbjct: 470 STFAYVAPFQPYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYK 529

Query: 539 IWFRCRIFHRLDEVDIDT-----DRRDIE 562
           I  +  I      VD+ +     DR  +E
Sbjct: 530 ITCKSEI-RSARYVDLVSQKSLVDREQVE 557

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  319 bits (817), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/522 (33%), Positives = 295/522 (56%), Gaps = 21/522 (4%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
           E+K+ LK RH                  S+ L   GP G  I+Y  +++++Y ++Q +GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 136 MATFIPVTSA----FTVF-SSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
           M  ++P + +    F  +   +++  + G A  + Y++ + I  A E +    ++E+WTT
Sbjct: 134 MVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTT 193

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP 250
           +VP AAWITIF   + + N   VK+YGE EFW A IK++ +VG II    +  G G    
Sbjct: 194 SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 253

Query: 251 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRK 308
            +GFRYW+NPG +   I  +  + G FL   + +I   F +  G E++ +T+ E  + R+
Sbjct: 254 RLGFRYWQNPGGFAHHI--RGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRR 311

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY----VSSSPFIIAIENSGT 364
           ++ +A ++ V+R++ FY   A+ I ++V YNDP L ++ +       SSPF+I I+N+G 
Sbjct: 312 NIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGI 371

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
           KVLPHI NA +L++  SAGN+ ++  SR +  +A+   AP  F + N  GVPY+AV  +S
Sbjct: 372 KVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSS 431

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
           A   LAY+  S+  A  FNW  NI+ ++GF  W+ +   +IRF +A+ + G+ +  LP+ 
Sbjct: 432 AISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRLPYT 490

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAPTF-SGVDFAAAYVSVFLFIAIWLGAQIWFRC 543
           A+ MP+L Y+ L  + +I L  G+  F P F    +F AAY+++ +F  +W+G ++ +R 
Sbjct: 491 ARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRV-YRR 549

Query: 544 RIF-----HRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWN 580
           +IF       ++E+D+ T   +IE    + +  + L  K+W 
Sbjct: 550 KIFTLKWWKSIEEIDVVTGVEEIEEKTRECDASRVLPTKWWE 591

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/496 (35%), Positives = 277/496 (55%), Gaps = 12/496 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
            + ++  LK RH                   T L  AGP G LI ++   +++Y +V S+
Sbjct: 81  RSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSV 140

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
            E+A   PV   FT +++RF+  ++G A+ + Y   W +T  LE+      + +W T   
Sbjct: 141 AELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKK 200

Query: 194 -MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
               ++ +FWV++ + N+F V+ YGE EF  +  K++ +VGFII  + ++CG G      
Sbjct: 201 YRDGFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYI 260

Query: 253 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
             RYW +PGA+     + D +  +F G+ S  + AAF++ G+ELVG+ A EA+NPRK VP
Sbjct: 261 GARYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVP 315

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
            A K+V +RI +FY    + IG+LVPY DP+L   S    ++SPF+IAI+N G   LP +
Sbjct: 316 GAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGLPTL 375

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V+L  ++S GNS VY  SR +  LA     P  F   +  G P   +  TSAFG +A
Sbjct: 376 VNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIA 435

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S      F+WL+ ++G++  FTW  I  CHIRF +AL  +G S ++L F +    W
Sbjct: 436 FVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVW 495

Query: 491 LAYYALFFMVVIILIQGFTAFAPTF---SGVDFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
            A + LF  ++++  Q + A  P     S  DF   Y+S+ + +A+WLG +IW +  ++F
Sbjct: 496 GAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKLF 555

Query: 547 HRLDEVDIDTDRRDIE 562
            + +++DIDT RR+++
Sbjct: 556 IKAEDMDIDTGRRELD 571

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  317 bits (812), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/503 (35%), Positives = 293/503 (58%), Gaps = 12/503 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           ++ ++R LK RH                  S  L  AGP G LI +  MAT++  +  SL
Sbjct: 81  QSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSL 140

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW-TTAV 192
           GEMA   PV+  +T +++RF+  ++G A+   Y     +   LE+      +++W   + 
Sbjct: 141 GEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQ 200

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP-V 251
             AA++ +FW+ +   N+F VK YGE EF  + IKV+ ++GFII  + +VCG G T   +
Sbjct: 201 YRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYI 260

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           G ++W NPGA+       D    +F G  S  + AAF++  TELVG+ A E  +PRKSVP
Sbjct: 261 GSKFWSNPGAF-----VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVP 315

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
           +A K+V +RI +FY    + +GLLVPY DP+L  SS    ++SPF++A++N G K LP +
Sbjct: 316 KAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSV 375

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V+LT ++S GNS+V+  SR +  L++    P+ FG  +  G P  ++ F+SAFG L 
Sbjct: 376 INVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLC 435

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++ +S      F+W+L+++G++  F W+ IS CHIRF +AL  +  S D+L F +    W
Sbjct: 436 FLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIW 495

Query: 491 LAYYALFFMVVIILIQGFTAFAPTF---SGVDFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
            +YY++F ++V++++Q + A  P     S  +F  AY+S+ + +A++LG +I+ +  ++ 
Sbjct: 496 GSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKLL 555

Query: 547 HRLDEVDIDTDRRDIEAVVWDDE 569
                +DIDT RR+++  ++  E
Sbjct: 556 IDPKYMDIDTGRRELDIELFKQE 578

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/525 (33%), Positives = 297/525 (56%), Gaps = 26/525 (4%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           +K+ LK RH                  S+ L   GP G  IAY  +++++Y ++ ++GEM
Sbjct: 75  LKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEM 134

Query: 137 ATFIP-----VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTA 191
             ++P        + T    R++  +   A+G+ Y++ + I  A E +    ++E+WT A
Sbjct: 135 VCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLA 194

Query: 192 VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP- 250
           VP AAWITIF  ++ + N+  VKY+GE EFW A IK++ ++G II    +  G G +   
Sbjct: 195 VPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDR 254

Query: 251 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKS 309
           +GFRYW+NPGA+   +   D + G FL   S +I  AF +  G ELV +T+ E ++ R++
Sbjct: 255 LGFRYWKNPGAFAHHV--TDGSLGNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRN 312

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY----VSSSPFIIAIENSGTK 365
           + +A K+ ++R++ FY    + IG++V +NDP L S+ S       SSPF+I I+N+G +
Sbjct: 313 IAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIE 372

Query: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425
           VLPHI NA +LT+  S+GN+ ++  SR ++ +A+   AP  FGR N  GVPY AV  ++ 
Sbjct: 373 VLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTL 432

Query: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485
              LAY+  S+  A  F WL NI+ ++GF  W+     ++RF +A+ Y  +  D +PFK 
Sbjct: 433 ISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNL-YDRMPFKT 491

Query: 486 KFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV-DFAAAYVSVFLFIAIWLGAQIWFR-- 542
              P+L  ++L  + +I +  G+  F P F  V DF AAY+++ +F+A+++G +++    
Sbjct: 492 WGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFK 551

Query: 543 -----CRIFHRLDEVDIDTDRRDIEAVVWD-DEP---PKTLWDKF 578
                 ++ + ++++D+ T   +IE    + DE    P   W++F
Sbjct: 552 NDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRILPTNRWERF 596

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  317 bits (811), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 187/537 (34%), Positives = 298/537 (55%), Gaps = 25/537 (4%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           KE      E+K+ LK RH                  S+ L+N GP G  I+YL ++T VY
Sbjct: 87  KERSSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVY 146

Query: 128 SVVQSLGEMATFIPVTSAFTVFSS-----RFLSPAFGAASGYMYWFSWAITFALELSVVG 182
            ++ +LGEM  F+P   + +  S+     +++ P+ G A+ + Y++ + I  A E+S   
Sbjct: 147 PIMNALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAAS 206

Query: 183 QIIEFWTTA--VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLC 240
            +IE+W  A  VP  AWITIF  L+ + N  PV  YGE EFW A IK++ + G II    
Sbjct: 207 GVIEYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFI 266

Query: 241 MVCGAG--ITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVG 297
           +  G G    G +GFRYW+NPG++   I       G FL   + +I   F+   G ELV 
Sbjct: 267 LFWGGGPKSDGILGFRYWKNPGSFAHHITGGGG--GNFLDIYTGIIKGGFSVILGPELVC 324

Query: 298 ITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNS----SDSYVSSS 353
           +T+ E A+ R+++ +A K+ V+R++ FY   ++ IG++V YNDP L +    S +   SS
Sbjct: 325 LTSSECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSS 384

Query: 354 PFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAA 413
           PF+I I+N+G + +PHI N  +LT+  SAGN+ ++  SR +  +A+   AP  F R N  
Sbjct: 385 PFVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQL 444

Query: 414 GVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKY 473
           GVPY AV  +     LAY+ +S+  A  FNW  NI+ ++GF  W+     +IRF +A+ Y
Sbjct: 445 GVPYTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITY 504

Query: 474 RGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV-DFAAAYVSVFLFIA 532
             ++   +PF+AK   +  +Y+LF++ +I L  G+  F P    V DF AAY+++ +FI 
Sbjct: 505 NKLTH-RIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIV 563

Query: 533 IWLGAQIWFRCRI---FHRLDEVDIDTDRRDIEAVVW----DDEPPKTLWDKFWNIV 582
           +W+G +++ R  +      +D++D+ T   +IE +      + + PK  W+KF  I+
Sbjct: 564 LWIGHKVFTRTLLKAWLRPIDKIDVYTGLEEIEELTEELNANRQAPKNKWEKFMAIL 620

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  316 bits (809), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 188/522 (36%), Positives = 288/522 (55%), Gaps = 20/522 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +  +K  LK RH                   T L   GP   LI +    T++YS+V +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMAL 142

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GE+A   P++  FT +++RF+  +FG A+ + Y   W +   LE+      + FW T   
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 194 -MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
               ++ +FW+++ + N+F VK YGE EF  +FIKVI +VGFII  + + CG G  G   
Sbjct: 203 YRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 253 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
             +YW +PGA+     + D    +F G  S  + +AF++ G+ELVG+ A E+ +PRKSVP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVP 317

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
           +A K+V +RI +FY    + +GLLVPYNDP L  +S    ++SPF+IAI+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTV 377

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V+L  ++S GNS +Y  SR M  LA+ +  P  F   +  G P   +  TSAFG +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIA 437

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S      FNWLL ++G++  FTW  I  CHIRF +AL  +G   D+L FK+    W
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 491 LAYYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
            +Y+ LF +V++ + Q + A  P   + S   F  AY+S  L +A++LG +I+ R  ++F
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIYKRNWKLF 557

Query: 547 HRLDEVDIDTDRRDIEAVVWDDE--------PPKTLWDKFWN 580
              +++DIDT RR+++  +   E          K  W + WN
Sbjct: 558 IPAEDMDIDTGRREVDLELLKQEIAEEKAIMATKPKWYRIWN 599

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  315 bits (806), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 185/518 (35%), Positives = 294/518 (56%), Gaps = 14/518 (2%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G+     +K+ALK RH                   T L+ AGPV  LIAY F+  LV+ 
Sbjct: 60  DGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFF 119

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            +  LGEMAT+IP+   FT ++SR+  PA G A GY Y F + I    +L+    +I++W
Sbjct: 120 TMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYW 178

Query: 189 T--TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
                V    W+TIF V++   N+F V+++GEFEFW++  KV+ ++G ++    ++ G G
Sbjct: 179 VDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGG 238

Query: 247 ITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
                +GFRYWR+PG++     +   + GRF+ +VS  + A + Y G EL GI A EA N
Sbjct: 239 PDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQN 298

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDP---KLNSSDSYVSSSPFIIAIENS 362
           PRKS+P+AIK  ++RI++FY      +G+ V Y+DP   K  +S +  ++SPF++AI NS
Sbjct: 299 PRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINS 358

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G   LPHI NA VL  + SA NS++YV SR +Y LA    AP  F +TN  G+PY+A+  
Sbjct: 359 GINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSV 418

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           +  F  LAYM +S+  A  FN+ +N+  + G  +W+ I   +I F +A++ +G+ +    
Sbjct: 419 SVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFA 478

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541
           + A F P+ A+++LFF  +I LI+ FT F    F   +F   Y+ + +F   + G +  +
Sbjct: 479 YVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538

Query: 542 RCRIFHRLDEVDIDT-----DRRDIEAVVWDDEPPKTL 574
           + ++   L +VD+ T     D+ + +  + D E  + +
Sbjct: 539 KTKVIDPL-KVDLYTFKAAIDQEEEDGKMADAEKAERI 575

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  313 bits (802), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 178/523 (34%), Positives = 294/523 (56%), Gaps = 21/523 (4%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           E ++++ L  RH                  S+ L   GP G  I+Y+ ++T++Y ++ + 
Sbjct: 53  EGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAF 112

Query: 134 GEMATFIP-----VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           GEM  ++P        + +    R++ P+   A+G+ Y++ + I  A E +    ++++W
Sbjct: 113 GEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYW 172

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           T AVP AAWITIF  ++ + NL  VKYYGE EFW A IKV+ +VG II    +  G G  
Sbjct: 173 TDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPN 232

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANP 306
              +GFRYW+NPG +   I     N G FL   S +I  AF +  G EL+ + + E  + 
Sbjct: 233 HDRLGFRYWKNPGGFAHHITGG--NLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQ 290

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSS----DSYVSSSPFIIAIENS 362
           R+++ +A K+ V+R++ FY   A+ I ++V  NDP L S+         SSPF+I I+N+
Sbjct: 291 RRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNA 350

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G K+LPHI NA +LT+  SAGN+ ++  SR +  +A    AP  FG+ N  GVP+ AV F
Sbjct: 351 GIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTF 410

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           ++    LAY+ +S+  A  F W  NI+ ++GF  W      ++RF +A+KY G+  + LP
Sbjct: 411 SALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGL-ENRLP 469

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV-DFAAAYVSVFLFIAIWLGAQIWF 541
           +  +F  ++ ++++  + ++I   G+  F P F  V DF AAY+++ LF+ +W+G +I+ 
Sbjct: 470 YAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYT 529

Query: 542 R--CRIFHRLDEVDIDTDRRDIE--AVVWDDE--PPKTLWDKF 578
           R   + ++ ++E+D+ T   +IE    + D+E   PK  + KF
Sbjct: 530 RDFKKWWYPVEEIDVVTGLTEIEERTRILDEERVEPKGAFPKF 572

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  314 bits (804), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 186/510 (36%), Positives = 286/510 (56%), Gaps = 14/510 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +A +K  LK RH                  ST L  AGP G +I +   +T++Y +V +L
Sbjct: 92  KAPLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMAL 151

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GE+A   PV+  FT +++RF+  +FG AS + Y   W  T  LE+      + +W T   
Sbjct: 152 GELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPER 211

Query: 194 -MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
               ++ +FW+++ + NLF V+ +GE EF  + IKV+ ++GFII  + +V G G  G   
Sbjct: 212 YRDGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFV 271

Query: 253 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
             RYW NPGA+       D    +F G  S  + AAF++ G+ELVGITA EAANPRKSVP
Sbjct: 272 GGRYWHNPGAF-----VGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVP 326

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
           RA K+VV+RI++FY    + IGLLVPY DP+L  +S    S+SPF+IAI   G + LP +
Sbjct: 327 RAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSV 386

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V+L  ++S GNS ++ GSR +  L++    P  FG  +  G P   +   S FG +A
Sbjct: 387 INVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIA 446

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S      F WL+ ++G++  FTW  I  CHIRF  ALK +G S ++LPF +     
Sbjct: 447 FIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGII 506

Query: 491 LAYYALFFMVVIILIQGFTAFAPTFSGVD---FAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
            + + LF ++++ + Q + A  P  S      F  +Y+S  + +A + G +I+ +  ++F
Sbjct: 507 GSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKLF 566

Query: 547 HRLDEVDIDTDRR--DIEAVVWDDEPPKTL 574
            + +++DIDT RR  D+E +  + E  K +
Sbjct: 567 IKAEDMDIDTGRRETDLELLKQEIEEEKAI 596

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  313 bits (801), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 179/530 (33%), Positives = 293/530 (55%), Gaps = 26/530 (4%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
             ++K+ L  RH                  S  L   GP G +I+Y+ ++T++Y ++ +L
Sbjct: 55  NGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNAL 114

Query: 134 GEMATFIP---VTSAFTV--FSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           GEM  ++P     SA +V     R++  +   A+G+ Y++ + I  A E +    ++ +W
Sbjct: 115 GEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYW 174

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           TT+VP A WITIF  ++T+ N   VKY+GE EFW A IK++ ++G I+    +  G G +
Sbjct: 175 TTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPS 234

Query: 249 G-PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANP 306
              +GF YW++PG +   I     + G FL   + +I  AF +  G ELV +T+ E  + 
Sbjct: 235 HVRLGFHYWKDPGTFAHHI--TGGSWGSFLDIYTGIIKGAFAFILGPELVALTSSECNDQ 292

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDP----KLNSSDSYVSSSPFIIAIENS 362
           R+++ +A K+ ++R++ FY    + I ++V YNDP     L       +SSPF+I I+N+
Sbjct: 293 RRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNA 352

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G KVLPHI NA +L++  SAGNS ++  SR +  +A    AP  F + N  GVPY++V  
Sbjct: 353 GIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGL 412

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           ++    LA++ +S+  A  F+W  NI+ ++GF  W+     ++RF +A+ Y  +  D LP
Sbjct: 413 SAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNM-YDRLP 471

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAFAPTF-SGVDFAAAYVSVFLFIAIWLGAQIWF 541
           FK    P+L +Y+L  + VI L  G+  F P F SG DF AAY+++ LF+ +W+G + W 
Sbjct: 472 FKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWA 531

Query: 542 R-------CRIFHRLDEVDIDTDRRDIEAVV----WDDEPPKTLWDKFWN 580
           R        ++++ +DE+D+ T   + E V      +  PP T W KF N
Sbjct: 532 RYKHAVPLLKLYYPVDEIDVITGLAEAEEVAEKLDMNRIPPSTYWGKFIN 581

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  313 bits (802), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 178/508 (35%), Positives = 282/508 (55%), Gaps = 13/508 (2%)

Query: 70  GQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSV 129
           G   + ++K+ +K RH                     L N GP G +I Y  M + +Y +
Sbjct: 89  GDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCI 148

Query: 130 VQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           +Q+ GE+A  +  ++  F  + S  + PA G +  ++Y   W     LEL      I++W
Sbjct: 149 IQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYW 208

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGI 247
           TT+V    ++ IF+V++   N+F  + Y E EF+    KV+ + GF+I  + + CG AG 
Sbjct: 209 TTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGN 268

Query: 248 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
            G +G +YW +PG++     S DK    F G VS+L+ AAF +  TE + +TA E ANPR
Sbjct: 269 DGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPR 323

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKV 366
           KS+P A KK+++RILV Y    + IG LVP+N  +L  S  S   +SP++IAI + G KV
Sbjct: 324 KSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKV 383

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           +PH+ NAV+L ++IS GNS  Y  SR++  LA+   APSF    +  G P  A+  +S F
Sbjct: 384 VPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVF 443

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           G ++++  S    + F WLL I+G++  FTW  I   HIRF +A+K +G S  +L FK++
Sbjct: 444 GLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQ 503

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAA----YVSVFLFIAIWLGAQIWFR 542
              W +YYA   M++I++ Q +TA AP   G   A A    Y+++ + IA++ G ++W R
Sbjct: 504 VGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKR 563

Query: 543 C-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
              ++    ++D+ ++RR  +  V   E
Sbjct: 564 DWTLYIPASKIDLISNRRIFDEDVLKQE 591

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  311 bits (798), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 177/517 (34%), Positives = 288/517 (55%), Gaps = 12/517 (2%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
           +  E  +++ L  RH                  S+ L N GP+   ++++ ++ +VY V+
Sbjct: 40  KCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVM 99

Query: 131 QSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
            +L EM  ++P        +SR++ P+ G A+G+ Y +S++I  A ELS    ++++WT 
Sbjct: 100 NTLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTD 159

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP 250
            V +A WITIF V++   N  PVK+YGE EFW A +K+I ++G +I  + +  G   +  
Sbjct: 160 KVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHD 219

Query: 251 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRK 308
            +GFRYW NPG +   I     N GRFL   +++I + F +    EL+G+   EA + R+
Sbjct: 220 RLGFRYWNNPGPFAYHI--TGGNTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRR 277

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPK----LNSSDSYVSSSPFIIAIENSGT 364
           ++ +A ++ ++RI+ FY    + IG ++  +DPK    L S     +SSPF+  I N+G 
Sbjct: 278 NIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGI 337

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
            VL HI NAV+L++  S+ NS +Y  SR +  LAK   AP  F R N  GVPY AV  ++
Sbjct: 338 PVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALST 397

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
           A   L Y+  S+  A  F WL NI  ++GF  W LI   ++RF +A+ Y  +  + +PFK
Sbjct: 398 AVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNL-YERVPFK 456

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAPTF-SGVDFAAAYVSVFLFIAIWLGAQIWFRC 543
           +   P+  Y+ + F+V++ L  G+  F P + +  DF AAY+++ +F  ++LG +IWF+ 
Sbjct: 457 SALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKT 516

Query: 544 RIFHRLDEVDIDTDRRDIEAVVWDDEP--PKTLWDKF 578
           R +    E+D+ T   D E      +P  PK +W+KF
Sbjct: 517 RWYIPFREIDVITGLADAEEEAKMTQPRTPKNMWEKF 553

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  309 bits (791), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 174/511 (34%), Positives = 282/511 (55%), Gaps = 12/511 (2%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           + + L+ RH                  S  L N G    L++++ ++T+VY ++ SL EM
Sbjct: 46  LHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEM 105

Query: 137 ATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMAA 196
             ++P   +     SR++ P+ G A+G+ Y +++AI  A ELS    ++ +W   VPMAA
Sbjct: 106 ICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMAA 165

Query: 197 WITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VCGAGITGPVGFRY 255
           WITIF V++   N   VKYYGE EFW A IK+I ++G ++  + +   GA      GFRY
Sbjct: 166 WITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRY 225

Query: 256 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKSVPRAI 314
           W+NPG +   +     + GRFL    ++I +AF +    EL+GI   EA + R++  +A 
Sbjct: 226 WKNPGPFAMSL--APGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKAS 283

Query: 315 KKVVFRILVFYYPIAVFIGLLVPYNDPK----LNSSDSYVSSSPFIIAIENSGTKVLPHI 370
           ++ ++RI+ FY   A+ IG+++   DPK    L +     +SSPF+  I N+G  VL H+
Sbjct: 284 RRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHV 343

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N  +L++  SAGNS +Y  +R++  LA+   AP F  + N  GVPY AV   +    LA
Sbjct: 344 INVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLA 403

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           Y+ + T  A+ F WL NI  ++GF  W  +    IRF + + +  + +  +P++    P+
Sbjct: 404 YLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNNL-QSRIPYQGPLQPY 462

Query: 491 LAYYALFFMVVIILIQGFTAFAP-TFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRL 549
           +AYY  F  VV+ L  GF  F    ++ VDF AAYV++ +++ ++LG ++WFR R +  +
Sbjct: 463 IAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYIPV 522

Query: 550 DEVDIDTDRRDIEAVVWDDEP--PKTLWDKF 578
           +++D+ T   + E       P  PK LW+KF
Sbjct: 523 EQIDVITGLVEAEEESKMTPPRIPKNLWEKF 553

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  309 bits (792), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 179/503 (35%), Positives = 278/503 (55%), Gaps = 12/503 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           ++ ++R LK RH                     L   GP G LI +  +  ++Y VV S+
Sbjct: 74  QSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSM 133

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GE+A   PV+  FT +++RF+  +FG A  Y Y   W +   LE+      + FW T   
Sbjct: 134 GELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPK 193

Query: 194 -MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
               ++ +F++++ + N F V+ YGE EF  +FIKVI ++GFII  + +VCG G  G   
Sbjct: 194 YRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYI 253

Query: 253 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
             +YW NPGA+     S D    RF G  S  + AAF++ GTELVG+ + E ANPRK++P
Sbjct: 254 GGKYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALP 308

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
           RA K+V +RIL+FY      IGLLVP+   +L  +S    ++SPF++AI+  G K LP +
Sbjct: 309 RAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGLPSV 368

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V+L +++S GNS VY  SR M  LA+    P  F   +  G P  A+  T  FG L+
Sbjct: 369 INVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLS 428

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S      FNWLL ++G++  F+W  I  CHIRF +AL  +G S D+L F +     
Sbjct: 429 FIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIA 488

Query: 491 LAYYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
            +Y+ +  ++++++ Q + A  P   + +  DF +AY+S  + +A ++  +IW R  ++F
Sbjct: 489 GSYFGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKLF 548

Query: 547 HRLDEVDIDTDRRDIEAVVWDDE 569
            R  ++DIDT RR+++      E
Sbjct: 549 TRAKDIDIDTGRREMDTEALRQE 571

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  309 bits (792), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 179/497 (36%), Positives = 278/497 (55%), Gaps = 11/497 (2%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
           +   + ++  LK RH                   T L  AGP G LI +    T++YS+V
Sbjct: 75  RTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMV 134

Query: 131 QSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW-T 189
            +LGE+A   PV+  FT +++RF+  ++G A+   Y   W +   LE+      + +W T
Sbjct: 135 MALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGT 194

Query: 190 TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG-IT 248
                  ++ +FW+ + + NLF VK YGE EF  + IKVI +VGFII  + + CG G + 
Sbjct: 195 NPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVK 254

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           G +G RYW +P     G    D    RF G  S  + AAF++ G+ELVG+ + E ANPRK
Sbjct: 255 GYIGGRYWHHP----YGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRK 310

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVL 367
           SVP+A K+V +RI +FY      +GLLVPY + +L  +S    ++SPF+IAI   G + L
Sbjct: 311 SVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPFVIAITTHGIRGL 370

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P + N V+L  ++S GNS +Y  SR +  LA+    P FFG  + +G P +++  TS FG
Sbjct: 371 PSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFG 430

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            +A++  S      FNWLL ++G++  FTW  I  CHIRF +AL  +G   D+L F +  
Sbjct: 431 LVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPA 490

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVD---FAAAYVSVFLFIAIWLGAQIWFRC- 543
             + +Y+ LF ++++ + Q + A  P  +  +   F  AY+S  + IA +LG +I+ +  
Sbjct: 491 GVYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKIYKKNW 550

Query: 544 RIFHRLDEVDIDTDRRD 560
           +IF + +++DIDT R+D
Sbjct: 551 KIFIKAEDMDIDTGRKD 567

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  307 bits (786), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 179/500 (35%), Positives = 280/500 (56%), Gaps = 12/500 (2%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           +K  LK RH                   T L  AGP   +I +    +++YS+V ++ EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 137 ATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP-MA 195
           A   P++  FT +++RF+  +FG A+ + Y   W +   LE+      + +W T      
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 196 AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVGF-R 254
            ++ +FW+++ + NLF VK YGE EF  + IKVI +VGFII  L +VCG G TG     +
Sbjct: 209 GFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAK 268

Query: 255 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 314
           YW +PGA+            +F G+ S  + AAF++ G+EL+GI   EA NPRK+VP A 
Sbjct: 269 YWHDPGAFVGATAG-----AQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAA 323

Query: 315 KKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHIFNA 373
           K+V +RIL+FY    +FIGLLVP ND +L  SS+   ++SPF+IAI   G + LP + N 
Sbjct: 324 KQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINV 383

Query: 374 VVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYME 433
           V+L  ++S GNS +Y  SR +  LA+    P      + +G P   +  +S FG +A++ 
Sbjct: 384 VILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVA 443

Query: 434 LSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAY 493
            S      FNWLL I+G++ FFTW  I  CHIRF  ALK +  S D+LPF +    + +Y
Sbjct: 444 QSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSY 503

Query: 494 YALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC-RIFHRL 549
           + LF +V+++  Q + A  P   T S  +F +AY+S+ + + +++  ++W +  +IF  L
Sbjct: 504 WGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKNWKIFIPL 563

Query: 550 DEVDIDTDRRDIEAVVWDDE 569
            ++D+DT R+ ++  +   E
Sbjct: 564 GQLDLDTGRKQLDLDLLRQE 583

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  306 bits (783), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 186/522 (35%), Positives = 285/522 (54%), Gaps = 20/522 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +  +K  LK RH                   T L   GP   LI +    T++Y++V +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GE+A   P++  FT +++RF+  +FG A+ + Y   W +   LE+      + FW T   
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 194 -MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
               ++ +FW+ + + N+F VK YGE EF  +FIKVI +VGFII  + + CG G TG   
Sbjct: 203 YRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYI 262

Query: 253 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
             +YW +PGA+     + D    +F G  S  + AAF++ G+ELVG+ A E+  PRKSVP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVP 317

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
           +A K+V +RI +FY    + IGLLVPYND  L  +S    ++SPF+IAI+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSV 377

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V+L  ++S GNS +Y  SR M  LA+ +  P  F   +  G P   +  TSAFG +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIA 437

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S      FNWLL ++G++  FTW  I  CHIRF +AL  +G   D+L FK+    W
Sbjct: 438 FVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVW 497

Query: 491 LAYYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
            +Y+ LF ++++ + Q + A  P   + S   F  AY+S  L + +++G +I+ R  ++F
Sbjct: 498 GSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLF 557

Query: 547 HRLDEVDIDTDRRDIEAVVWDDE--------PPKTLWDKFWN 580
              +++DIDT RR+++  +   E          K  W + WN
Sbjct: 558 IPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWN 599

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  305 bits (782), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 167/505 (33%), Positives = 280/505 (55%), Gaps = 13/505 (2%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
           +++++ + L  RH                     L+  GP   ++A++ ++T ++++V +
Sbjct: 84  NDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNA 143

Query: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           LGE+A   PV   F V+ +RF+ P+FG A    Y   WA+   LEL      I +W   +
Sbjct: 144 LGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNNTI 203

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP-V 251
              AW+ IF+  + ++N+  VK +GE EF ++ IK++A++GF I  + + CG G +G  +
Sbjct: 204 NSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYI 263

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           G RYW +PGA+       D    RF G  +  + AAF+Y GTELV ++A E+ NPR ++P
Sbjct: 264 GGRYWNDPGAF-----VGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLP 318

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSGTKVLPH 369
           +A K+  + I + Y  +   IG LVPYND +L + +S V  ++SP +IAIEN G K LP 
Sbjct: 319 KASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPS 378

Query: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429
           + NA++L  I+S  NS VY  SR M  +A+I   P      +  G P +A+F T  FG L
Sbjct: 379 LMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLL 438

Query: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489
           +++  S      F WL  ++G++  F W  I+  HIRF QA+K +  S ++LPF +    
Sbjct: 439 SFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGV 498

Query: 490 WLAYYALFFMVVIILIQGFTAFAPTFS-GVD---FAAAYVSVFLFIAIWLGAQIWFRC-R 544
           + ++Y    + ++++   +T+  P  S G D   F   Y+S+ +FI  +LG +++ +  R
Sbjct: 499 YGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKDWR 558

Query: 545 IFHRLDEVDIDTDRRDIEAVVWDDE 569
           ++ +  ++D+DT RR+I+  +   E
Sbjct: 559 LYVKTKDMDLDTGRREIDLDILKQE 583

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  306 bits (783), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 176/530 (33%), Positives = 292/530 (55%), Gaps = 21/530 (3%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G     ++K+ L+ RH                  S+ L   GP G  I+Y+ ++ ++Y 
Sbjct: 98  DGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYP 157

Query: 129 VVQSLGEMATFIPVTSAFTVFSS-----RFLSPAFGAASGYMYWFSWAITFALELSVVGQ 183
           ++ +LGEM  F+P   + +  S+     R++ P+ G A+G+ Y++ + I  A E +    
Sbjct: 158 IMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASG 217

Query: 184 IIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC 243
           ++E+WTTAVP   WITIF  ++ + N   VK YGE EFW A IK++ +VG II    +  
Sbjct: 218 VVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFW 277

Query: 244 GAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAG 301
           G G     +GFRYW++PGA+   +     + G F    + +I  AF +  G ELV +T+ 
Sbjct: 278 GGGPNHDRLGFRYWQHPGAFAHHLTGG--SLGNFTDIYTGIIKGAFAFILGPELVCMTSA 335

Query: 302 EAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY----VSSSPFII 357
           E A+ R+++ +A ++ V+R++ FY    + I ++VPYNDP L ++ +       SSPF+I
Sbjct: 336 ECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVI 395

Query: 358 AIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPY 417
            I+N+G KVLPHI N  +LT+  SA N+ ++  +R +  +A+   AP   GR N  GVPY
Sbjct: 396 GIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPY 455

Query: 418 FAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGIS 477
            AV  +     LAY+ +S+  A  FNW  NI+ ++GF  W+     ++RF +A+ Y G+ 
Sbjct: 456 VAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL- 514

Query: 478 RDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV-DFAAAYVSVFLFIAIWLG 536
            D LPFK    P+  +++L  + +I +  G+  F P +  V DF AAY+++ +F+ +W G
Sbjct: 515 YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFG 574

Query: 537 AQIWFRC--RIFHRLDEVDIDTDRRDIEAVVWDDE----PPKTLWDKFWN 580
            +++ R   + +  + E+D+ T   +IE    + E    PP    DKF +
Sbjct: 575 HKLYTRTWRQWWLPVSEIDVTTGLVEIEEKSREIEEMRLPPTGFKDKFLD 624

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  304 bits (779), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 167/507 (32%), Positives = 274/507 (54%), Gaps = 13/507 (2%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
              ++   + L  RH                   + L+  GP   +I ++ ++T ++++V
Sbjct: 64  DAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIV 123

Query: 131 QSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
            +LGE+++  PV   F V+ SRF+ P+FG A    Y   WA+   LEL      I +W +
Sbjct: 124 NALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNS 183

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP 250
            +   AW+ IF+ ++ ++NL  VK +GE EF ++ +K++A++GF I  + + CG G  G 
Sbjct: 184 TINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGG 243

Query: 251 VGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
               +YW NPGA+       + +  RF G  S  + AAF+Y GTEL+ ++A E+ NPR +
Sbjct: 244 YIGGKYWSNPGAF-----VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRIT 298

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFIIAIENSGTKVL 367
           +P+A K+  + I V Y  +   +G LVP +DP+L   SS   V++SP +IAIEN G K L
Sbjct: 299 LPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGL 358

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P + NA++L  ++S  NS VY  SR M  +A+I   P  F   +  G P +A+  T  FG
Sbjct: 359 PSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFG 418

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            L+++  S    + F WL  ++G++  F W  I+  HIRF   +K RG S D+LPF +  
Sbjct: 419 LLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMT 478

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGV----DFAAAYVSVFLFIAIWLGAQIWFRC 543
             W +YY    + V++++  +TA  P+  GV     F   Y+S  + +  ++G +++ + 
Sbjct: 479 GVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKS 538

Query: 544 -RIFHRLDEVDIDTDRRDIEAVVWDDE 569
            R+     E+DID+ RR ++  V  DE
Sbjct: 539 WRLLTPTTEIDIDSGRRAVDIEVLKDE 565

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  305 bits (781), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 175/529 (33%), Positives = 284/529 (53%), Gaps = 23/529 (4%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           + Q++E ++K+ ++ RH                   T LS+AGP G +I Y  M+T +Y 
Sbjct: 92  DNQINE-KLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYC 150

Query: 129 VVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           V+Q++GEMA  ++ +   F+ +    + P    A  ++Y   W     LEL      I++
Sbjct: 151 VMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQY 210

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFP-VKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-A 245
           WTT V    ++ IF++L+   N+F   + Y E EF+    K++ + GF I  + ++CG A
Sbjct: 211 WTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGA 270

Query: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
           G +G +G RYW +PGA+       D    RF G VS+L+ AAF + GTE + ITA E AN
Sbjct: 271 GNSGFIGARYWHSPGAF-----RGDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQAN 325

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGT 364
           PRK++P A KKV++R L+ Y    + +G LVPYN  +L  SS     +SP++IA+ + G 
Sbjct: 326 PRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASHGI 385

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
           +V+PH  NAV+L ++ S  +S  Y  SR++  LA+   AP  F   +  G P       +
Sbjct: 386 RVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGA 445

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
               +++   S+  A  FNWLL+I+G++  FTW +IS  HIRF +A+K +G S D++ FK
Sbjct: 446 IIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFK 505

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGAQIW 540
           ++   W + YA   M+++++ Q +    P    +   V F  AY+++ +FI ++ G +IW
Sbjct: 506 SQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIW 565

Query: 541 FRC-RIFHRLDEVDIDTDRRDIEAVVWDDEPPKT--------LWDKFWN 580
            R  R+F R   +D+   R   +  +   E  +         LW K +N
Sbjct: 566 NRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAPLWRKIYN 614

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  303 bits (777), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 168/503 (33%), Positives = 281/503 (55%), Gaps = 17/503 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +  +K+ LK RH                  S+ L   GP G   +Y  ++ ++Y V+ +L
Sbjct: 48  DHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNAL 107

Query: 134 GEMATFIPVTSAFTV-----FSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           GEM  ++P   + +        +R++ P+ G A+G+ Y++ + I  A E +    ++++W
Sbjct: 108 GEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYW 167

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           TTAVP  AWITIF  ++ + N   VK+YGE EFW A +K++ ++G +     +  G G  
Sbjct: 168 TTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPH 227

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANP 306
              +GFRYW+ PGA+   I S   N GRFL   + +I   F +  G ELV +T+ EA + 
Sbjct: 228 HDRLGFRYWQKPGAFAYHITSG--NTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDA 285

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSS----DSYVSSSPFIIAIENS 362
           R+++ +A ++ V+R++ FY   ++ IG +V YND  L+++         SSPF+I I+N+
Sbjct: 286 RRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNA 345

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G KVLPHI N  +L++  S+GNS ++  SR +  +++   AP   GR N  GVPY AV  
Sbjct: 346 GIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVAL 405

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           TS    +AY+ +S+  A  F W  NI+ ++GF  W+ I   ++RF +A+ ++ +  + +P
Sbjct: 406 TSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVP 464

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV-DFAAAYVSVFLFIAIWLGAQIWF 541
           FK  F P+  ++ +  + VI L  G+  F P    V DF AAYV++ +F+ +W+G ++W 
Sbjct: 465 FKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWT 524

Query: 542 RCRIFHRL--DEVDIDTDRRDIE 562
           R      +   E+D+ T  ++IE
Sbjct: 525 RTWKTWAIPVPEIDVTTGLKEIE 547

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  303 bits (777), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 187/506 (36%), Positives = 281/506 (55%), Gaps = 16/506 (3%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G+  +  +K+ LK RH                     L+ AGPV  LI+Y F+  LV+ 
Sbjct: 54  DGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFF 113

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V+  +GEMA +IP+   FT ++SR+  PA G A GY Y   + I    +L+    +I++W
Sbjct: 114 VMSCIGEMAAYIPL-DGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYW 172

Query: 189 --TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYC-LCMVCGA 245
                V    WITI  V++ V N F VK++GEFEFW++  KVI ++G II   + M+ G 
Sbjct: 173 IPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGT 232

Query: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
                +GFRYW++PGA+     S   + GRF+ +VS  +   F Y G EL GI A EA N
Sbjct: 233 PTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAEN 292

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIENS 362
           PRK++P+AIK  ++RI++FY      +G+ V  NDP L    +  +  ++SPF++AI NS
Sbjct: 293 PRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNS 352

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G + LPHIFNA VL  + SA NS++YV SR +Y LA    AP  F +TN  G+PY ++  
Sbjct: 353 GIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGV 412

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
              F  LAYM +S+G A  FN+ +N+  + G  TW+ I   +I F +A++ +GI +    
Sbjct: 413 AVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFA 472

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541
           + A   P+ AY++LFF  ++ LI+ FT F    F   +F   Y+ + LF   + G +   
Sbjct: 473 YVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVK 532

Query: 542 RCRIFHRLDEVD-------IDTDRRD 560
           + +I  + +EVD       ID +  D
Sbjct: 533 KTKI-RKPEEVDLFSFKAAIDQEEED 557

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  306 bits (783), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 175/530 (33%), Positives = 292/530 (55%), Gaps = 21/530 (3%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G      +K+ L+ RH                  S+ L   GP G  I+Y+ ++ ++Y 
Sbjct: 154 DGDAGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYP 213

Query: 129 VVQSLGEMATFIPVTSAFTVFSS-----RFLSPAFGAASGYMYWFSWAITFALELSVVGQ 183
           ++ +LGEM  F+P   + +  SS     R++  + G A+G+ Y++ + I  A E +    
Sbjct: 214 IMCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASG 273

Query: 184 IIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC 243
           ++E+WTTAVP   WITIF  ++ + N   VK YGE EFW A IK++ +VG II    +  
Sbjct: 274 VVEYWTTAVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFW 333

Query: 244 GAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAG 301
           G G     +GFRYW++PG++   +     + G F    + +I  AF +  G ELV +T+ 
Sbjct: 334 GGGPKHDRLGFRYWQHPGSFAHHL--AGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSA 391

Query: 302 EAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY----VSSSPFII 357
           E A+ R+++ +A ++ V+R++ FY    + I ++VPYNDP L ++ +       SSP++I
Sbjct: 392 ECADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVI 451

Query: 358 AIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPY 417
            I+N+G KVLPHI N  +LT+  SA N+ ++  +R +  +A+   AP   G+ N  GVPY
Sbjct: 452 GIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPY 511

Query: 418 FAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGIS 477
            AV  +     LAY+ +S+  A  FNW  NI+ ++GF  W+     ++RF +A+ + G+ 
Sbjct: 512 VAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL- 570

Query: 478 RDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV-DFAAAYVSVFLFIAIWLG 536
            D LPFK    P+  +++L  + +I +  G+  F P +  V DF AAY+++ +F+ +WLG
Sbjct: 571 YDRLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLG 630

Query: 537 AQIWFRC--RIFHRLDEVDIDTDRRDIEAVVWDDE----PPKTLWDKFWN 580
            +++ R     +H + E+D+ T   +IE    D E    PP T  +KF +
Sbjct: 631 HKLYTRTWNHWWHSVSEIDVTTGLVEIEEKSRDIEELRLPPATFKEKFMD 680

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  302 bits (774), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 172/517 (33%), Positives = 281/517 (54%), Gaps = 12/517 (2%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
           +E  +K+ L  RH                  S+ L+  GP    ++++ ++T+VY ++ +
Sbjct: 47  YEHNLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCT 106

Query: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           L EM  ++P   +     +R++ P+ G A+G+ Y +S+A+  A EL+    I+ +WT  V
Sbjct: 107 LAEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQV 166

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VCGAGITGPV 251
           P   WITIF +++ V N   V++YGE EFW A +K+I ++  ++  + +   GA     V
Sbjct: 167 PQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRV 226

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKSV 310
           GFRYWRNPGA+G  I     N GRFL   +++I +AF +    ELVG+   EA + R+++
Sbjct: 227 GFRYWRNPGAFGYHI--TGGNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNI 284

Query: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPK----LNSSDSYVSSSPFIIAIENSGTKV 366
            +A ++ ++RI+ FY   ++ IG++V  ND      L  +    +SSPF+  I NSG  V
Sbjct: 285 EKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPV 344

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           L H+ N  +LT+  SAGNS  Y  SR +  L+K   AP  F + N  GVPY AVF  S  
Sbjct: 345 LNHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLV 404

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
             LAY+ +S+  +  F WL NI  ++GF  W LI   +IRF +A+ +  +  D +P+++ 
Sbjct: 405 ACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRIPYRSP 463

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAP-TFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRI 545
             P+ AY+    + +I L  G+  F    +   DF  +Y+S+ +F+A +LG +  ++ R 
Sbjct: 464 LQPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRF 523

Query: 546 FHRLDEVDIDTDRRDIEAVVWDD--EPPKTLWDKFWN 580
              +D++D+ T   + E          PK  W+KF N
Sbjct: 524 CIPVDQIDVITGLEEAEEEAKLSVVRVPKNAWEKFIN 560

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  301 bits (772), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 176/513 (34%), Positives = 273/513 (53%), Gaps = 15/513 (2%)

Query: 72  VHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQ 131
           V + ++K+ +K RH                  +  L  AGP   +IAY  ++ + Y ++Q
Sbjct: 70  VTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQ 129

Query: 132 SLGEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
           + GEMA   P +   F  + S F+S  FG A+ ++++  W     LEL      +++W  
Sbjct: 130 AAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWND 189

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VCGAGITG 249
           ++    ++ IF+V L   + F VK YGE EF     K++ + GFII+ + + V GAG +G
Sbjct: 190 SINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSG 249

Query: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
            +G +YW +PGA+     + D N GRF G    L+ A F+Y G EL  ++  E  NPR+S
Sbjct: 250 YIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRS 304

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLP 368
            P A K+ ++RI+V Y    + +G  VP N  +L  S  S   +SP+++A    G KV+P
Sbjct: 305 TPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHASPYVLAASIHGVKVVP 364

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
           HI NAV+L ++IS GNS +Y   R+M  LA+   AP F    +  G P FA+   S FG 
Sbjct: 365 HIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGV 424

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           + ++  S+     FNWL  I G+A  FTW  I   HIRF QA+K +  S D++ +K+ F 
Sbjct: 425 IGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFG 484

Query: 489 PWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC- 543
            + +Y+ +FF +++ + Q + A AP      S   F  +Y++  +F A + G  IW R  
Sbjct: 485 VYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGYMIWKRDF 544

Query: 544 RIFHRLDEVDIDTDRR--DIEAVVWDDEPPKTL 574
            +F  L+ VD+D  RR  D E V  +DE  K +
Sbjct: 545 TLFSDLESVDLDYHRRIYDPELVKQEDEEKKEM 577

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  302 bits (774), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 176/530 (33%), Positives = 292/530 (55%), Gaps = 21/530 (3%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           EG     ++K+ L+ RH                  S+ L   GP G  I+Y+ ++ ++Y 
Sbjct: 102 EGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYP 161

Query: 129 VVQSLGEMATFIPVTSAFTVFSS-----RFLSPAFGAASGYMYWFSWAITFALELSVVGQ 183
           ++ +LGEM  F+P   + +  S+     R++  + G A+G+ Y++ + I  A E +    
Sbjct: 162 IMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASG 221

Query: 184 IIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC 243
           ++E+WTTAVP   WITIF  ++ + NL  VK YGE EFW A IK++ +VG II    +  
Sbjct: 222 VVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFW 281

Query: 244 GAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAG 301
           G G     +GFRYW++PGA+   +     + G F    + +I  AF +  G ELV +T+ 
Sbjct: 282 GGGPNHDRLGFRYWQHPGAFAHHLTGG--SLGNFTDIYTGIIKGAFAFILGPELVCMTSA 339

Query: 302 EAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY----VSSSPFII 357
           E A+ R+++ +A ++ V+R++ FY    + I ++VPYNDP L ++ +       SSPF+I
Sbjct: 340 ECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVI 399

Query: 358 AIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPY 417
            I+N+G KVLPHI N  +L++  SA N+ ++  +R +  +A+   AP   GR N  GVPY
Sbjct: 400 GIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPY 459

Query: 418 FAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGIS 477
            AV  +     LAY+ +S+  A  FNW  NI+ ++GF  W+     ++RF +A+ Y G+ 
Sbjct: 460 VAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL- 518

Query: 478 RDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV-DFAAAYVSVFLFIAIWLG 536
            D LPFK    P+  + +L  + +I L  G+  F P +  + DF AAY+++ +F+ +W G
Sbjct: 519 FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFG 578

Query: 537 AQIWFRC--RIFHRLDEVDIDTDRRDIEAVVWDDE----PPKTLWDKFWN 580
            +++ R   + +  + E+D+ T   +IE    + E    PP +  DKF +
Sbjct: 579 HKLYTRTWSQWWLPVSEIDVTTGLIEIEEKSREIEEMRLPPSSFKDKFMD 628

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  300 bits (768), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 171/526 (32%), Positives = 282/526 (53%), Gaps = 21/526 (3%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
              ++++ + L  RH                     LS  GP   +IA+  ++T ++++V
Sbjct: 58  NTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIV 117

Query: 131 QSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
            SLGE++   PV   F V+ +RF+ P+FG A  + Y   WAI   LEL      I +W  
Sbjct: 118 NSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNK 177

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC-GAGITG 249
           ++   AW++IF+V +  +N+  VK +GE EF ++ +K++A++GF I  + ++C G    G
Sbjct: 178 SINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGG 237

Query: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
            +G +YW +PGA+       D    RF G  +  I AAF+Y G ELVG++A E+ NPR +
Sbjct: 238 FIGGKYWNDPGAF-----VGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVT 292

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSGTKVL 367
           +P+A K+  + I + Y  I   IG LVP NDP L +  S V  ++SP +IAI+N G K L
Sbjct: 293 LPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGL 352

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P + NA++L  ++S  NS VY  SR +  +A+I   P      +  G P +A+  T   G
Sbjct: 353 PSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVG 412

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            L+++  S      F WL  ++G++  F W  I+  H+RF  A+K++  S ++LP+ +  
Sbjct: 413 LLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMT 472

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPT-FSGVD---FAAAYVSVFLFIAIWLGAQIWFR- 542
             W ++Y    + ++++   +T+  P   +G D   F  +Y+S+ +FIA +LG +IW R 
Sbjct: 473 GEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKRN 532

Query: 543 CRIFHRLDEVDIDTDRRDIEAVVWDDEPP--------KTLWDKFWN 580
            R++ +L EVD+D+ R D +A     E          K  + + WN
Sbjct: 533 LRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWN 578

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  300 bits (769), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 175/520 (33%), Positives = 278/520 (53%), Gaps = 22/520 (4%)

Query: 67  VKEGQV-------HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAY 119
           V+E QV          E+K+ +K RH                  +  L NAGP G LI Y
Sbjct: 89  VQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGY 148

Query: 120 LFMATLVYSVVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALEL 178
             M T +Y ++Q+ GE+A ++  ++  F V+ S  + PAFG +  ++Y   W     LEL
Sbjct: 149 SIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLEL 208

Query: 179 SVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYC 238
                 I++WTT V    ++ IF+VL+ V N F  + Y E EF+    K++ ++GF I  
Sbjct: 209 VTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILG 268

Query: 239 LCM-VCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVG 297
           + +   GAG  G +G RYW  PGA+     + D+    F G +++++ AAF +  TE + 
Sbjct: 269 IVINTGGAGNDGYIGDRYWHTPGAF-----AGDRPIDHFKGIMATMVTAAFAFGATEFIA 323

Query: 298 ITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFI 356
           +TA E +NPRK++P A KKV++RIL  +      +G LVPY+ D  + S  S   +SP++
Sbjct: 324 LTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYV 383

Query: 357 IAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVP 416
           +A+   G KV+PH  NAV+L +++S GNS  Y  SR++Y LA+   AP FF   +  G P
Sbjct: 384 LAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRP 443

Query: 417 YFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGI 476
           + A+     F  +++   S      F WLL I+G++  FTW  I   HIRF +A+  +  
Sbjct: 444 FRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKR 503

Query: 477 SRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSG----VDFAAAYVSVFLFIA 532
           S  ++ FKA+   W +YY  F +V+I++ Q + A AP   G      F   Y+++ + I 
Sbjct: 504 SLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILIL 563

Query: 533 IWLGAQIWFRC-RIFHRLDEVDIDTDRR--DIEAVVWDDE 569
            ++G +IW +   +F R + +D+D  R+  D E +  +DE
Sbjct: 564 FYVGYKIWKKDWSLFIRANNIDLDKHRQIFDEELLKQEDE 603

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  300 bits (769), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 176/528 (33%), Positives = 284/528 (53%), Gaps = 21/528 (3%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           EG+  E  +K+++K RH                  +  L++AGP G  I Y  M + +Y 
Sbjct: 117 EGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYC 176

Query: 129 VVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           ++Q+ GEMA T+  +   F  + S  +SP  G A  ++YW  WA    LEL      I++
Sbjct: 177 IIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKY 236

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AG 246
           WTT V    ++ IF+ L+ V N+F  + Y E EF+    KV+ + GF I  + + CG AG
Sbjct: 237 WTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAG 296

Query: 247 ITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
             G +G +YW +PGA+       DK   RF G  ++L+ AAF + G+E + +TA E +NP
Sbjct: 297 NDGYIGGKYWHDPGAF-----RGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNP 351

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDS-YVSSSPFIIAIENSGTK 365
           RK++P A KK+++RI++ +    + +G LVP+N  +L  SDS    +SP++IAI + G +
Sbjct: 352 RKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVR 411

Query: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425
           V+PH  NAV+L +++S GNS  Y  SRI+  L++   AP FF   +  G P  A+   + 
Sbjct: 412 VVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGAL 471

Query: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485
           F  +A+   S+     F WLL I+G++  FTW  I   HIRF +A+  +G S  ++ FK+
Sbjct: 472 FAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKS 531

Query: 486 KFMPWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGAQIWF 541
           +   W +YYA   M ++++ Q +   AP          F  +Y+++ + IA ++G   W 
Sbjct: 532 ELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWK 591

Query: 542 RC-RIFHRLDEVDIDTDRR--DIEAVVWDDEPPKT------LWDKFWN 580
           +   +F R  ++D+D  R+  D + +  +DE  K       LW +  N
Sbjct: 592 KDWTLFIRAKDIDLDHHRQIFDEDVLRQEDEETKEKLRNGPLWKRILN 639

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  299 bits (765), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 190/584 (32%), Positives = 296/584 (50%), Gaps = 23/584 (3%)

Query: 3   NAKQDVSEEGYELGNFSGMNDEDSSSGQ---AGAINHRKKSVVSKTTAVXXXXXXXXXXX 59
           + K++ S +   + +FS +N+  SSS +   +G      K +     +            
Sbjct: 10  SGKKEASPDSISIRSFSAVNNLQSSSSEKNYSGQTTRNNKLIHRFVDSFKRAEGSTTHTK 69

Query: 60  XXXXXXFVKEGQVH----EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGG 115
                    EG V+    ++++K+++K RH                  +  L   GP   
Sbjct: 70  QINENTSDLEGDVNSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAAL 129

Query: 116 LIAYLFMATLVYSVVQSLGEMATFIPVTSA-FTVFSSRFLSPAFGAASGYMYWFSWAITF 174
           +I Y  ++ + Y ++Q+ GEMA   P   A F  +SS F+S  FG A+ ++Y F W    
Sbjct: 130 VIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVL 189

Query: 175 ALELSVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGF 234
            LEL      I+FW   +    +I IF+V L   + F VK YGE EF     K++ + GF
Sbjct: 190 PLELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGF 249

Query: 235 IIYCLCMVCG-AGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGT 293
           II  + + CG AG  G +G +YWRNPGA+     + D + GRF      L+ A F++ G 
Sbjct: 250 IILSVVINCGGAGNDGYIGGKYWRNPGAF-----AGDTSAGRFKNVCYILVTAYFSFGGM 304

Query: 294 ELVGITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSS 352
           EL  ++  E ANPRK+ P A K+ ++RILV Y    + IG  VPYND +L  +  S   +
Sbjct: 305 ELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHA 364

Query: 353 SPFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNA 412
           SP+++A    G KV+PHI NAV+L ++IS  NS++Y G R+M  LA+    P F    + 
Sbjct: 365 SPYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDR 424

Query: 413 AGVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALK 472
            G P  A+   S FG + ++  S+     F WL  I G++  FTW  I   H+RF QA+K
Sbjct: 425 EGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMK 484

Query: 473 YRGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSG-----VDFAAAYVSV 527
            +G S D+L +KA    W + Y +FF +++ + Q + A AP  +G       F  +Y++ 
Sbjct: 485 VQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQSYLAF 544

Query: 528 FLFIAIWLGAQIWFRCRIF-HRLDEVDIDTDRR--DIEAVVWDD 568
            ++IA +LG  I+ R   F + LD++D+D  R   D E +  +D
Sbjct: 545 PIWIAFYLGYMIYNRDFTFLNPLDKIDLDFHRHIYDPELMRQED 588

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  295 bits (756), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 174/499 (34%), Positives = 268/499 (53%), Gaps = 9/499 (1%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +E       + R LK R                    + L+  GP+   IAYLF  +L+ 
Sbjct: 23  EEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLC 82

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
            V+ SL EMA+F P+   F+ + +R++ PAFG A+G+ Y+  +AI  +  L+  G +I +
Sbjct: 83  VVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGY 142

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           W   V +  W+T+ +V +   N   VKY+GE E  +   K++ LV   I CL + CG   
Sbjct: 143 WRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAP 202

Query: 248 TGPV-GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
                GFRYWR  GA  P ++      G+FLGW + ++ + F + G+E++GI  GE ANP
Sbjct: 203 NHTTTGFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANP 259

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFI-GLLV-PYNDPKLNSSDSYVSSSPFIIAIENSGT 364
           +K++P++   V FRI  F Y   VFI GL + P N   +++  +  ++SPF+IAI +SG 
Sbjct: 260 KKTIPKSSMNVFFRI-GFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGI 318

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
           KVLP+  NA +L  IIS+ N+++Y+ SR +YGLAK   AP  F   N   VP       S
Sbjct: 319 KVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGS 378

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
             G LAYM      A+ F+++ +   V G   W  I   +I + +A+K +GIS DD+PF+
Sbjct: 379 LLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCR 544
             F P+ AY  LFF+ +I    G+ AF   F    F  +Y+ VF  I + +G +++F+ +
Sbjct: 439 MWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTK 498

Query: 545 IFHRLDEVDIDTDRRDIEA 563
            F +  E+   T R + E 
Sbjct: 499 -FVKPSEISFRT-RNEHEG 515

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  298 bits (762), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 183/532 (34%), Positives = 293/532 (55%), Gaps = 24/532 (4%)

Query: 68  KEGQVHE-AEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           K+ Q  E  ++K+ LK RH                  S  L+  GP G   +YL + T +
Sbjct: 60  KQQQPEENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFI 119

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSS-----RFLSPAFGAASGYMYWFSWAITFALELSVV 181
           Y ++ + GEM  ++P   + +  SS     +++  + G AS + Y++ + I  A E +  
Sbjct: 120 YPIMNAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAA 179

Query: 182 GQIIEFWTTA--VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCL 239
             ++E+W  A  VP  AWITIF   +   N+ PV +YGE EFW A IK++ ++G II   
Sbjct: 180 AGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSF 239

Query: 240 CMVCGAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVG 297
            +  G G +   +GFRYW+ PGA+   I   D   G FL   + +I   F +  G ELV 
Sbjct: 240 ILFWGGGPSHDRLGFRYWQRPGAFADHI--TDGTGGNFLDVYTGVIKGGFAFVLGPELVS 297

Query: 298 ITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNS----SDSYVSSS 353
           +T+ E  + R+++ +A ++ V+R+++FY   ++ I ++V YNDP L +    S     SS
Sbjct: 298 LTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSS 357

Query: 354 PFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAA 413
           PF+I I+N+G KVLPHI N  ++T+  SAGN+ ++  SR +  +A    AP FF + N  
Sbjct: 358 PFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRF 417

Query: 414 GVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKY 473
           GVPY AV F+  F  LAY+ +S+  A+ FNW  NI+ ++GF  W+     +IRF +A+ +
Sbjct: 418 GVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIF 477

Query: 474 RGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTF-SGVDFAAAYVSVFLFIA 532
             +  D LP+K     +L +Y+LF + +I L  G+  F P F    DF AAY+++ +FI 
Sbjct: 478 NDL-YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIV 536

Query: 533 IWLGAQIWFRC--RIFHRLDEVDIDTDRRDIEAVVWD-DE---PPKTLWDKF 578
           +W+G ++  R   + +  +D++D+ T   +IE +  + DE   PP   WDKF
Sbjct: 537 LWIGHKLVTRSWRQWYIPVDKIDVFTGLEEIEELTNELDEKRVPPNNAWDKF 588

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  298 bits (762), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 175/508 (34%), Positives = 278/508 (54%), Gaps = 13/508 (2%)

Query: 70  GQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSV 129
           G   + ++K+ +K RH                     L N GP G +I Y  M + +Y +
Sbjct: 89  GDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCI 148

Query: 130 VQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           +Q+ GE+A  +  ++  F  + S  + PA G +  ++Y   W     LEL      I++W
Sbjct: 149 IQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYW 208

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGI 247
           TT+V    ++ IF+VL    N+F  + Y E EF+    KV+ + GF I  + + CG AG 
Sbjct: 209 TTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGN 268

Query: 248 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
            G +G +YW +PG++     S DK    F G VS+L+ AAF +  TE + +TA E ANPR
Sbjct: 269 DGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPR 323

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKV 366
           KS+P A KKV++RI+V +      +G LVP+N  +L  S  S   +SP++IAI + G KV
Sbjct: 324 KSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKV 383

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           +PH  NAV+L +++S GNS  Y  SR++  LA+   APSF    +  G P  A+  ++ F
Sbjct: 384 VPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVF 443

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           G ++++  S    + F WLL I+G++  FTW  I   HIRF +A+K +G S  +L FK++
Sbjct: 444 GLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQ 503

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAA----YVSVFLFIAIWLGAQIWFR 542
              W +YYA   M++I++ Q +TA AP   G   A A    Y+++ + IA++ G ++W R
Sbjct: 504 VGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKR 563

Query: 543 C-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
              ++    ++D+ ++RR  +  V   E
Sbjct: 564 DWTLYIPASKIDLISNRRIFDEDVLKQE 591

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  297 bits (760), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 173/496 (34%), Positives = 264/496 (53%), Gaps = 12/496 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
            + ++R LK RH                   + L   GP   LI +  +  ++YSVV ++
Sbjct: 77  RSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAM 136

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW-TTAV 192
           GE+A   PV   FT +  RF+  +FG A  Y+Y   W +   LE+      + +W T A 
Sbjct: 137 GELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAK 196

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
               ++ +F+V++ + N+F VK YGE EF  + IKV  +VGFII  + ++CG G  G   
Sbjct: 197 YRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYV 256

Query: 253 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
             +YW NPGA+     + D    RF    S  + AAF++ GTELVG+ A E  NPRK++P
Sbjct: 257 GGKYWHNPGAF-----NGDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALP 311

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
           RA K+V +RI +FY      IGLLVPY    L  SS    ++SPF++AI+  G   LP +
Sbjct: 312 RAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSV 371

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V+L +++S GNS+VY  SR +  LA     P  F   +  G P   +  T  FG L 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S      FNWL+ ++G++  FTW  I  CH+RF +AL  +G S D+L F +    W
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 491 LAYYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIF- 546
            +Y+ +  + ++ + Q + A  P   T +  DF  AY+SV + +  +L  +++ R   F 
Sbjct: 492 GSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWTFA 551

Query: 547 HRLDEVDIDTDRRDIE 562
            R  ++DIDT RR+++
Sbjct: 552 KRAKDIDIDTGRRELD 567

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  297 bits (760), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 180/506 (35%), Positives = 280/506 (55%), Gaps = 12/506 (2%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
           +   + ++  LK RH                     L  AGP G LI +    T+++++V
Sbjct: 82  KTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMV 141

Query: 131 QSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
            +LGE+A   PV+  FT +++RF+  +FG A  + Y   W +   LE+      + +W T
Sbjct: 142 MALGELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWET 201

Query: 191 AVPMA-AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITG 249
            V     ++ +FW+++ + N+F V+ YGE EF  + IKV A++GFII  + +VCG G  G
Sbjct: 202 PVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVG 261

Query: 250 PVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
                RYW NPGA+  G  S  K    F G+ S  + AAF++ G+EL+G+   EA NPRK
Sbjct: 262 GYVGARYWHNPGAF-VGSTSGQK----FHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRK 316

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVL 367
           +VP A K+V +RIL+FY    + IG LVPYNDP+L +SS    S+SPF+IAI   G   L
Sbjct: 317 AVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGL 376

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P + N V+L +++S GNS +Y  SR +  L++    P      +  G P   +  +S FG
Sbjct: 377 PSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFG 436

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            +A++  S      FNWLL I+G++ FFTW  I  CHIRF  ALK +G   D+LPF +  
Sbjct: 437 LIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPA 496

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC- 543
               +Y+ LF  +++++ Q + A  P   + S  +F +AY++  + +A ++  ++W +  
Sbjct: 497 GVIGSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKKNW 556

Query: 544 RIFHRLDEVDIDTDRRDIEAVVWDDE 569
           +    L++VDIDT RRD +  +   E
Sbjct: 557 KFLIPLEDVDIDTGRRDTDVNLLKQE 582

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  297 bits (760), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 181/504 (35%), Positives = 280/504 (55%), Gaps = 14/504 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +A ++  LK R                   ST L   GP G +I +   +T++YS+V +L
Sbjct: 100 KAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMAL 159

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GE+A   PV   FT +++RF+  +FG A+ + Y   W +   LE+      + +W T   
Sbjct: 160 GELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTR 219

Query: 194 -MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
               ++ +FW+++ + N+F VK +GE EF  + IKV  ++GFII  + +VCG G  G   
Sbjct: 220 YRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFV 279

Query: 253 F-RYWRNPGAW-GPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 310
             +YW +PGA+ G G      +  +F G  S  + AAF++ G+EL+GITA EAANPRKS+
Sbjct: 280 GAKYWHDPGAFVGHG------SGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSI 333

Query: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPH 369
           P A K+VV+RI++FY      IGLLVPYND +L  +S    ++SPF+IAI   G K LP 
Sbjct: 334 PGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPFVIAIVTHGIKGLPS 393

Query: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429
           + N V+L  ++S GNS ++  SR +  L+     P  FG  + +G P   +  TS FG L
Sbjct: 394 VINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLL 453

Query: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489
           A++  S      FNWLL ++G++  FTW  I  CHIRF  ALK +G   ++L F +    
Sbjct: 454 AFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGV 513

Query: 490 WLAYYALFFMVVIILIQGFTAFAPTFSGVD---FAAAYVSVFLFIAIWLGAQIWFRC-RI 545
             +Y+ LF +V++ + Q + A  P     D   F  +Y+S  + +A + G +I+ R  ++
Sbjct: 514 AGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWKL 573

Query: 546 FHRLDEVDIDTDRRDIEAVVWDDE 569
           F  L+++DIDT RR+ +  +   E
Sbjct: 574 FIPLEDMDIDTGRRETDMELLKQE 597

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  297 bits (760), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 175/534 (32%), Positives = 293/534 (54%), Gaps = 25/534 (4%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G     ++K+ L+ RH                  S+ L   GP G  I+Y+ ++ ++Y 
Sbjct: 97  DGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYP 156

Query: 129 VVQSLGEMATFIPVTSAFTVFSS-----RFLSPAFGAASGYMYWFSWAITFALELSVVGQ 183
           ++ +LGEM  F+P   + +  S+     R++  + G A+G+ Y++ + I  A E +    
Sbjct: 157 IMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASG 216

Query: 184 IIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC 243
           ++E+WTTAVP   WIT+F +++ + N   VK YGE EFW A IK++ +VG II    +  
Sbjct: 217 VVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFW 276

Query: 244 GAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAG 301
           G G     +GFRYW++PGA+   +     + G F    + +I  AF +  G ELV +T+ 
Sbjct: 277 GGGPKHDRLGFRYWQHPGAFAHHLTGG--SLGNFTDIYTGIIKGAFAFILGPELVCMTSA 334

Query: 302 EAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDP----KLNSSDSYVSSSPFII 357
           E A+ R+++ +A ++ V+R++ FY    + I ++VPYNDP     L        SSPF+I
Sbjct: 335 ECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVI 394

Query: 358 AIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPY 417
            I+N+G KVLPHI N  +LT+  SA N+ ++  +R +  +A+   AP   G+ N  GVPY
Sbjct: 395 GIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPY 454

Query: 418 FAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGIS 477
            AV  +     LAY+ +S+  A  FNW  NI+ ++GF  W+     ++RF +A+ Y G+ 
Sbjct: 455 VAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGL- 513

Query: 478 RDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV-DFAAAYVSVFLFIAIWLG 536
            D LPFK    P+  +++L  + +I +  G+  F P +  V DF AAYV++ +F+ +WLG
Sbjct: 514 YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLG 573

Query: 537 AQIWFRCRIFHR----LDEVDIDTDRRDIEAVVWDDE----PPKTLWDKFWNIV 582
            +++   R +H+    + E+D+     +IE    + E    PP ++ DKF + +
Sbjct: 574 HKLY--TRTWHQWWLPVSEIDVTRGLVEIEEKSREIEELRLPPTSIKDKFMDTL 625

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  297 bits (760), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 173/503 (34%), Positives = 281/503 (55%), Gaps = 15/503 (2%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           +K+ ++ RH                   T L +AGP G LI Y  M +++Y ++Q+ GEM
Sbjct: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEM 175

Query: 137 A-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMA 195
           A  +  +T  +  + S  +   FG A  ++Y   W     LEL      I++WTT+V   
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPD 235

Query: 196 AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VCGAGITGPVGFR 254
            ++ IF+VL+   N+F  + Y E EF+    K++ + GF I  + + V GAG  G +G +
Sbjct: 236 VFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGK 295

Query: 255 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 314
           YW +PGA+  G  S D    RF G V++L+ AAF + G+E + IT  E ANPRK+VP A 
Sbjct: 296 YWHDPGAFN-GKHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAA 350

Query: 315 KKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHIFNA 373
           K++++RIL  +    + +G LVPYN  +L  SS     +SP++IA+ + G +V+PH  NA
Sbjct: 351 KQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFINA 410

Query: 374 VVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYME 433
           V+L +++S  NS+ Y  +RI+  L++   AP  F   + AG P  A+  ++ FG +A+  
Sbjct: 411 VILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCA 470

Query: 434 LSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAY 493
            S      F WLL I+G++  FTW  I   HIRF +A+K +G S  +L F+++   W + 
Sbjct: 471 ASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGST 530

Query: 494 YALFFMVVIILIQGFTAFAPTFSGVDFAAA----YVSVFLFIAIWLGAQIWFRC-RIFHR 548
           YA   M++I++ Q + A AP   G   A A    Y+++ + IA+++G +IW +  ++F R
Sbjct: 531 YACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWKLFIR 590

Query: 549 LDEVDIDTDRR--DIEAVVWDDE 569
            D++D+ + R+  D E +  +DE
Sbjct: 591 ADKIDLISHRQIFDEELIKQEDE 613

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  298 bits (762), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 171/515 (33%), Positives = 280/515 (54%), Gaps = 20/515 (3%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +E   ++  +K+ +K RH                  S  L+NAGP G +I Y  M + +Y
Sbjct: 134 QEQDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIY 193

Query: 128 SVVQSLGEMAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
            ++Q+ GE+A  +  +   F  + S  + PA G +  ++Y   W     LEL      I+
Sbjct: 194 CIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIK 253

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-A 245
           +WT  V    ++ IF+VL+ V N+F  K Y E +F+    K++ ++GF I  + + CG A
Sbjct: 254 YWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGA 313

Query: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEG--RFLGWVSSLINAAFTYQGTELVGITAGEA 303
           G  G +G RYW NPGA+         N G  RF G V++ + AAF +  +E + +TA E 
Sbjct: 314 GTDGYIGSRYWHNPGAF-------RGNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQ 366

Query: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPY-NDPKLNSSDSYVSSSPFIIAIENS 362
           +NPRK++P A KK+++RIL  +    V +G LVPY +D  L +S S   +SP++IA+ + 
Sbjct: 367 SNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASPYVIAVASH 426

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G +V+PH  NAV+L +++S  N   Y  SRI+  LAK   AP  F   +  G P  A+  
Sbjct: 427 GVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLV 486

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           +S FG +A+   S      F WLL I+G++  FTW+ I   HIRF +A+K +G S  ++ 
Sbjct: 487 SSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVG 546

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAA-----YVSVFLFIAIWLGA 537
           +K++   W + YA+  MV+ ++ Q + A +P   G   +A      Y+++ + IA+++  
Sbjct: 547 YKSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFY 606

Query: 538 QIWFRC-RIFHRLDEVDIDTDRR--DIEAVVWDDE 569
           ++W +   +F   D++D+ TDR+  D E +  +DE
Sbjct: 607 KVWKKDWTLFIPADKIDLVTDRQIFDEELLKQEDE 641

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  295 bits (756), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 169/511 (33%), Positives = 275/511 (53%), Gaps = 13/511 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           V    V    + + L  RH                     L++ GP   +I ++ ++T +
Sbjct: 60  VSNASVTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCL 119

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           ++V+ +LGEMA   PV   F V+ +RF+ P+ G A    Y   W +   LEL      I+
Sbjct: 120 FTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIK 179

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
           +W   +   AW+ IF+ ++  +N+  VK +GE EF ++ +K++A++GF I  + + CG G
Sbjct: 180 YWNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGG 239

Query: 247 ITGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
             G     +YW NPG++  G  S  K    F G  S  + AAF+Y G E+  ++A E+ +
Sbjct: 240 PQGGYLGGKYWHNPGSF-VGHTSGTK----FKGLCSVFVTAAFSYSGIEMTAVSAAESKD 294

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSG 363
           PR+++P+A K+  + I   Y  I   IG LVPY++P+L S  S V  +SSP +IAIEN G
Sbjct: 295 PRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGG 354

Query: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFT 423
            K LP + NA++L +IIS  NS VY  SR M  +A I   P      +  G P  A+ FT
Sbjct: 355 IKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFT 414

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
             FG L+++  S   A  F WL  ++G++  F W+ I+  HIRF QA+K +  S D+LP+
Sbjct: 415 LFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPY 474

Query: 484 KAKFMPWLAYYALFFMVVIILIQGFTAFAPT-FSGVD---FAAAYVSVFLFIAIWLGAQI 539
            ++   W ++Y +  + +++++  +T+  P   SG D   F   Y+S  + IA ++G ++
Sbjct: 475 LSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKL 534

Query: 540 WFRCR-IFHRLDEVDIDTDRRDIEAVVWDDE 569
            +R + I   L+++DIDT RR ++  +   E
Sbjct: 535 VYRKKQIVVALEDMDIDTGRRQVDLTIRRQE 565

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  296 bits (757), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 181/506 (35%), Positives = 279/506 (55%), Gaps = 12/506 (2%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
           +   A +K  LK RH                   T L  AGP G LI +    T++Y +V
Sbjct: 75  RTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMV 134

Query: 131 QSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
            ++GE++   P++  FT +++RF+  +FG A+ + Y   W     LE+      + +W T
Sbjct: 135 MAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGT 194

Query: 191 AVP-MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITG 249
                  ++ +FWV++ + NLF VK YGE EF  + IKV+ ++GFII  + + CG G  G
Sbjct: 195 DPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEG 254

Query: 250 PVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
                +Y+ +PGA+       D    RF G  S  + AAF++ G+EL+GI A E+A PRK
Sbjct: 255 GYIGGKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRK 309

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVL 367
           SVP+A K+V +RI +FY    + +GLLVPY D +L  +S    ++SPF+IAI + G + L
Sbjct: 310 SVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFVIAITSHGIRGL 369

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P + N V+L  ++S GNS VY  SR +  LA+    P  FG  + +G P F + FTSAFG
Sbjct: 370 PSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFG 429

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            +A++  S      F WLL ++G++  FTW  I  CHIRF  AL  +G S D+LPFKA  
Sbjct: 430 LVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPA 489

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC- 543
             + + + LF +V++ + Q + A  P     S   F  +Y+S  + +A + G +++ R  
Sbjct: 490 GIYGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHKLYARNW 549

Query: 544 RIFHRLDEVDIDTDRRDIEAVVWDDE 569
           ++   L ++DIDT RR+++  V   E
Sbjct: 550 KLLIPLSKLDIDTGRREMDLDVLRQE 575

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  296 bits (759), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 171/503 (33%), Positives = 280/503 (55%), Gaps = 15/503 (2%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           +K+ ++ RH                   T L +AGP G LI Y  M +++Y ++Q+ GE+
Sbjct: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEL 175

Query: 137 A-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMA 195
           A  +  +T  +  + S  +   FG A  ++Y   W     LEL      I++WTT+V   
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPD 235

Query: 196 AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VCGAGITGPVGFR 254
            ++ IF+VL+   N+F  + Y E EF+    K++ + GF I  + + V GAG  G +G +
Sbjct: 236 VFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGK 295

Query: 255 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 314
           YW +PGA+  G  S D    RF G V++L+ AAF + G+E + IT  E +NPRK++P A 
Sbjct: 296 YWHDPGAFN-GKHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAA 350

Query: 315 KKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFNA 373
           K++++RIL  +    + +G LVPYN D  L S      +SP++IAI + G +V+PH  NA
Sbjct: 351 KQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPHFVNA 410

Query: 374 VVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYME 433
           V+L +++S  NS+ Y  +R+   L++   AP FF   + AG P  A+  ++ F  +A+  
Sbjct: 411 VILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCA 470

Query: 434 LSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAY 493
            S      F WLL I+G++  FTW  I   HIRF +A+K +G S  +L FK++   W + 
Sbjct: 471 ASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSM 530

Query: 494 YALFFMVVIILIQGFTAFAPTFSGVDFAAA----YVSVFLFIAIWLGAQIWFRC-RIFHR 548
           YA   M++I++ Q + A AP   G   A A    Y+++ + IA+++G +IW +  ++F R
Sbjct: 531 YACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWKLFIR 590

Query: 549 LDEVDIDTDRR--DIEAVVWDDE 569
            D++D+++ R+  D E +  +DE
Sbjct: 591 ADKIDLESHRQIFDEELIKQEDE 613

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  294 bits (752), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 175/475 (36%), Positives = 264/475 (55%), Gaps = 11/475 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +  +K  LK RH                   T L   GP   LI +    T++Y++V +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GE+A   P++  FT +++RF+  +FG A+ + Y   W +   LE+      + FW T   
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 194 -MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
               ++ +FWV++ + N+F VK YGE EF  +FIKVI +VGFII  + + CG G  G   
Sbjct: 203 YRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 253 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
             +YW +PGA+     + D    +F G  S  + +AF++ G+ELVG+ A E+  PRKSVP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVP 317

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
           +A K+V +RI +FY    + IGLLVPYND  L  +S    ++SPF+IAI+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSV 377

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V+L  ++S GNS +Y  SR M  LA+ +  P  F   +  G P   +  TSAFG +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIA 437

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S      FNWLL ++G++  FTW  I  CHIRF +AL  +G   D+L FK+    W
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 491 LAYYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFR 542
            +Y+ LF +V++ + Q + A  P   + S   F  AY+S  L +A+++G +I+ R
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHKIYKR 552

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  296 bits (757), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 168/508 (33%), Positives = 283/508 (55%), Gaps = 16/508 (3%)

Query: 73  HEAE-VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQ 131
           H+++ +K+ ++ RH                   T L +AGP G LI Y  M +++Y ++Q
Sbjct: 111 HKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQ 170

Query: 132 SLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
           + GEMA  +  +T  +  + S  +   FG A  ++Y   W     LEL      I++WTT
Sbjct: 171 ACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VCGAGITG 249
           +V    ++ IF+VL+   N+F  + Y E EF+    K++ + GF I  + + V GAG  G
Sbjct: 231 SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDG 290

Query: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
            +G +YW +PGA+  G  + D    RF G  ++L+ AAF + G+E + IT  E +NPRK+
Sbjct: 291 FIGGKYWHDPGAFN-GKHAID----RFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKA 345

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           +P A K++++RIL  +    + +G LVPYN D  L S+     +SP++IA+ + G +V+P
Sbjct: 346 IPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVP 405

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
           H  NAV+L +++S  NS+ Y  +R+   L++   AP  F   + AG P  A+  ++ F  
Sbjct: 406 HFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAV 465

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           +A+   S      F WLL I+G++  FTW  I   H+RF +A+K +G S  +L FK++  
Sbjct: 466 IAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTG 525

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAA----YVSVFLFIAIWLGAQIWFRC- 543
            W + YA   M++I++ Q + A AP   G   A A    Y+++ + IA+++G ++W +  
Sbjct: 526 VWGSAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDW 585

Query: 544 RIFHRLDEVDIDTDRR--DIEAVVWDDE 569
           ++F R D++D+D+ R+  D E +  +DE
Sbjct: 586 KLFIRADKIDLDSHRQIFDEELIKQEDE 613

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  294 bits (752), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 173/526 (32%), Positives = 284/526 (53%), Gaps = 23/526 (4%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
           Q  +  +K+ LK  H                  S+ L   GP G  I+Y  M+T++Y V+
Sbjct: 46  QSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVM 105

Query: 131 QSLGEMATFIP-------VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQ 183
            +L EM  F+P          + +   +R++  + G A G+ Y + + I  A E +    
Sbjct: 106 NALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASG 165

Query: 184 IIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC 243
           ++ +WTTAVP AAWITIF  ++ V N   V++YG  E     +K+  ++G II  + +  
Sbjct: 166 VVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFF 225

Query: 244 GAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAG 301
           G G     +GFR+W++PGAW   +   D   GR    ++ +I A F +  G ELV +T+ 
Sbjct: 226 GGGPNHDRLGFRFWKDPGAWAYHL--ADGGAGRLSDIITGVIRAGFAFILGPELVVLTST 283

Query: 302 EAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDP----KLNSSDSYVSSSPFII 357
           EA + R+++ +A ++ V+R++ FY   ++  G++V  NDP     L+       SSPF+I
Sbjct: 284 EAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVI 343

Query: 358 AIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPY 417
            I+N+G KVLPHI N  +L++  S+GNS +Y  +R +  L++   AP  F R N  GVPY
Sbjct: 344 GIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPY 403

Query: 418 FAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGIS 477
             V F +AF  LAY+ +S+  A  FNW  NI+ ++GF  W+     ++RF +A+ +  + 
Sbjct: 404 TGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL- 462

Query: 478 RDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGA 537
            D LPFK  F P+  ++ +  + +I LI G+ +F   ++  DF AAY+++ LF+ +WLG 
Sbjct: 463 YDRLPFKTPFQPYFTWFYIILIAIICLINGYESFV-HWNYKDFIAAYITLPLFLILWLGH 521

Query: 538 QIWFRC--RIFHRLDEVDIDTDRRDIEAVVWDDE----PPKTLWDK 577
           + + R   +    + E+D+ T  R+IE    +      PP+ LW+K
Sbjct: 522 KAYTRTWSQWMISVSEIDVTTGLREIEEETKELNARRIPPRNLWEK 567

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  294 bits (753), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 165/510 (32%), Positives = 273/510 (53%), Gaps = 13/510 (2%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +E +  +A   + L  RH                     L+  GP   +I ++ ++T ++
Sbjct: 63  QEVEDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLF 122

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           ++V +LGE+++  PV   F V+ SRF+ P+FG A    Y   WA+   LEL      I +
Sbjct: 123 TIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRY 182

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           W   +   AW+ IF+ ++ ++NL  VK +GE EF ++ +K++A++GF I  + + CG G 
Sbjct: 183 WNHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGP 242

Query: 248 TGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
            G     +YW NPGA+  G  + D    RF G  S  + AAF+Y GTEL+ ++A E+ NP
Sbjct: 243 KGGYIGGKYWSNPGAF-VGHTAGD----RFHGLCSVFVTAAFSYSGTELIAVSAAESVNP 297

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFIIAIENSGT 364
           R ++P+A K+  + I V Y  +   +G LV  +DP+L   SS   V++SP +IAIEN G 
Sbjct: 298 RITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGI 357

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
           K LP + NA++L  ++S  NS VY  SR M  +A+I   P  F   +  G P +A+  T 
Sbjct: 358 KGLPSLMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATL 417

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
            FG L+++  S      F WL  ++G++  F W  I+  HIRF + +K RG + D+LPF 
Sbjct: 418 IFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFV 477

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGAQIW 540
           +    W +YY    + +++++  +T+  P      +   F   Y+S  + +A + G +++
Sbjct: 478 SMTGVWGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLY 537

Query: 541 FRC-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
            R  R+     E+D+D+ RR ++  +  DE
Sbjct: 538 TRSWRLLTPTKEIDLDSGRRAVDLELMKDE 567

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  294 bits (752), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 173/515 (33%), Positives = 273/515 (53%), Gaps = 16/515 (3%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           E    ++++K+++K RH                  +  L   GP   +I Y+ ++ + Y 
Sbjct: 83  ESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYF 142

Query: 129 VVQSLGEMATFIPVTSA-FTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           ++Q+ GEMA   P   A F  +SS F+S +FG A+ ++Y F W     LEL      I+F
Sbjct: 143 MIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQF 202

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AG 246
           W   +    +I IF+V L   + F VK YGE EF     K++ + GFII  + + CG AG
Sbjct: 203 WNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAG 262

Query: 247 ITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
             G +G  YW NPGA+     + D + GRF      L+ A F++ G EL  ++  E +NP
Sbjct: 263 NDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNP 317

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTK 365
           RKS P A K+ ++RI+V Y    + IG  VPYND +L  +  S   +SP+++A    G K
Sbjct: 318 RKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVK 377

Query: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425
           ++PHI NAV+L +++S  NS++Y G R++  LA+   AP F    +  G P  A+     
Sbjct: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCV 437

Query: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485
           FG +A++  S+     F WL  I G++  FTW  I   H+RF QA+K +G S D+L +KA
Sbjct: 438 FGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

Query: 486 KFMPWLAYYALFFMVVIILIQGFTAFAPTFSG-----VDFAAAYVSVFLFIAIWLGAQIW 540
               W + Y +FF +++ + Q + A AP  +G       F   Y++  +++A + G  ++
Sbjct: 498 TTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVY 557

Query: 541 FRC-RIFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572
            R   + + LD++D+D  RR  D E +  +DE  K
Sbjct: 558 NRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENK 592

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  294 bits (752), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 162/493 (32%), Positives = 268/493 (54%), Gaps = 14/493 (2%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
           ++K+ ++ RH                   T L++AGP G +I Y  MA+ +Y ++Q++GE
Sbjct: 98  KLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGE 157

Query: 136 MA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPM 194
           MA  ++ +   F  +    + PA   +  ++Y   W     LEL      I++WTT V  
Sbjct: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNA 217

Query: 195 AAWITIFWVLLTVSNLFP-VKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVG 252
             ++ IF++L+   N+F   + Y E EF     K++ ++GF I  + ++CG AG  G +G
Sbjct: 218 DIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIG 277

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
            +YWR+PGA+            RF G VS+L+ AAF++  TE + ITA E +NPRK++P 
Sbjct: 278 GKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPS 332

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHIF 371
           A KKV++R L+ Y    + +GLLVPY+  +L  SS +   +SP+++A+   G +V+PH  
Sbjct: 333 AAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFI 392

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           NAV+L ++ S  +S  Y  SR++  LA+   AP  F   +  G P       +    +A+
Sbjct: 393 NAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAF 452

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
              S+     FNWLL I+G++  FTW LI   HIRF +A+K +G S D++ +K++   W 
Sbjct: 453 CACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWG 512

Query: 492 AYYALFFMVVIILIQGFTAFAPTFSGV----DFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
           + YA   M++I++ Q +    P   G      F   Y+++ +FI ++LG +IW R  R+F
Sbjct: 513 SAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLF 572

Query: 547 HRLDEVDIDTDRR 559
            R  ++D+ + R 
Sbjct: 573 IRAKDIDLISHRH 585

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  293 bits (749), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 163/504 (32%), Positives = 268/504 (53%), Gaps = 15/504 (2%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
            E  ++   + + L  RH                     L++ GP   +I ++ ++T ++
Sbjct: 66  HEDDINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLF 125

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           +V+ +LGEMA   PV   F V+ +RF+ P+ G A    Y   W +   LEL      I++
Sbjct: 126 TVINALGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKY 185

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           W   +   AW+ IF+ ++ ++N+  VK +GE EF ++ IK++A++GF I  + + CG G 
Sbjct: 186 WNETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGP 245

Query: 248 TGPVGF-RYWRNPGAWGPGIISKDKNEG-RFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
            G     +YW +PG++         N G +F G  S  + AAF+Y G E+  ++A E+ +
Sbjct: 246 HGGFIGGKYWNHPGSF------VGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKD 299

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSG 363
           PR ++P+A K+  + I   Y  I   IG LVPY+DP+L S  S V  +SSP +IAIEN G
Sbjct: 300 PRTTIPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDG 359

Query: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFT 423
            K LP + NA++L +IIS  NS VY  SR M  +A I   P    R +  G P  A+ FT
Sbjct: 360 IKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFT 419

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
             FG L+++  S   A  F WL  ++G++  F W+ I+  HIRF Q++  +  S D+LPF
Sbjct: 420 LFFGLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPF 479

Query: 484 KAKFMPWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGAQI 539
            ++   W ++Y    + ++++   +T+  P    +     F   Y+S  + +A + G ++
Sbjct: 480 LSQTGVWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKL 539

Query: 540 WFRCRIFH-RLDEVDIDTDRRDIE 562
           + R R F   L ++D+DT RR ++
Sbjct: 540 YVRKREFMVGLADMDLDTGRRQVD 563

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  290 bits (743), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 160/477 (33%), Positives = 259/477 (54%), Gaps = 5/477 (1%)

Query: 70  GQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSV 129
           G  +EA + R L                       T L+  GP+   +AYLF  +++  V
Sbjct: 26  GSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFLAYLFTGSILAVV 85

Query: 130 VQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWT 189
           + SL EMA F P+   F+ + ++++ PAFG A+G+ Y+  +AI  +  L+  G +I +W 
Sbjct: 86  IFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWR 145

Query: 190 TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITG 249
             + +A W+T+ +    V N   V+Y+G+ E ++   K+  L+   I CL + CG G   
Sbjct: 146 PDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIVCLVITCGGGPDH 205

Query: 250 P-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
             +GFRYWR  G + P ++    N G+FLGW + +I + F + G+E++GI  GE ANPRK
Sbjct: 206 TTIGFRYWRESG-FLPYLV--KGNTGKFLGWWACVIQSIFGFMGSEMIGIIYGETANPRK 262

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLV-PYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           ++P+A + V+ RI VFY      +GL V P+N   +++  +  ++SPF+IAI  SG KVL
Sbjct: 263 TIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDANASPFVIAISTSGIKVL 322

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P   NA +L  I S+  +++Y+ SR +YGLAK   AP  F R N   +P       S  G
Sbjct: 323 PSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKHKIPMVGCVVGSLLG 382

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LAYM      A+ F ++ +   V G   W  I   +I + + +K  G+  D++PF+  F
Sbjct: 383 FLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKSHGVRLDEIPFRMPF 442

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCR 544
            P+ AY ALFF+ VI    G++AF   F+   F  +Y+ +F  + + LG +++++ +
Sbjct: 443 QPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSYIGIFANVLLVLGYKLYYKTK 499

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  293 bits (749), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 167/505 (33%), Positives = 272/505 (53%), Gaps = 15/505 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           V++  ++   + + L  RH                     LS  GP   +I ++ ++T +
Sbjct: 76  VQQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCL 135

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           ++V+ SLGE++   PV   F V+S RF+ P+F  A    Y   W +   LEL      I+
Sbjct: 136 FTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIK 195

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
           +W   +   AW+ IF+  + ++N+  VK +GE EF ++ IK++A++GF I  + + CG G
Sbjct: 196 YWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGG 255

Query: 247 ITGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
             G     +YW +PGA+    +  D    +F G  S  + AAF+Y G E+  ++A E+ N
Sbjct: 256 PHGGYIGGKYWNDPGAF----VGHDSGT-KFKGLCSVFVTAAFSYSGIEMTAVSAAESKN 310

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSG 363
           PR+++P+A K+  + I + Y  I   IG LVP NDP+L +  S V  +SSP +IAIEN  
Sbjct: 311 PRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGR 370

Query: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFT 423
            K LP + NA++L  ++S  NS VY  SR M  +A I   P F  R +  G P  A+  T
Sbjct: 371 IKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLT 430

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
             FG L+++  S   A  F WL  ++G++  F W+ I+  HIRF QA+K++  S D+LPF
Sbjct: 431 LFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPF 490

Query: 484 KAKFMPWLAYYALFFMVVIILIQGF--TAFAPTFSGVD---FAAAYVSVFLFIAIWLGAQ 538
            ++   W + Y  F ++ ++LI  F  + F    SG +   F   Y+S  + I  + G +
Sbjct: 491 ISQTGVWGSIYG-FVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYFGHK 549

Query: 539 IWFRC-RIFHRLDEVDIDTDRRDIE 562
           I+ R  R+  +L+++D+DT R+ ++
Sbjct: 550 IYTRDWRLLVKLEDMDLDTGRKQVD 574

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  293 bits (751), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 169/524 (32%), Positives = 281/524 (53%), Gaps = 19/524 (3%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +E +  +  +K+++K RH                  S  L+NAGP G +I Y  M + VY
Sbjct: 136 QEQEPKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVY 195

Query: 128 SVVQSLGEMAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
            ++Q+ GE+A  +  +   F  + S  + PA G +  +++   W     LEL      I+
Sbjct: 196 CIIQACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIK 255

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-A 245
           +WT  V    ++ IF+VL+ V N+F  K Y E +F+    K++ + GF I  + + CG A
Sbjct: 256 YWTVKVNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGA 315

Query: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
           G  G +G RYWR+PGA+       D +  RF G V++ + AAF +  +E + +TA E +N
Sbjct: 316 GTDGYIGSRYWRDPGAF-----RGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSN 370

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPY-NDPKLNSSDSYVSSSPFIIAIENSGT 364
           PRK++P A KK+++RIL  +      +G LVPY +D  L ++ S   +SP++IA+ + G 
Sbjct: 371 PRKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGV 430

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
           +V+PH  NAV+L +++S  NS  Y  SRI+  LAK   AP  F   +  G P  A+  ++
Sbjct: 431 RVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSA 490

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
            FG +A+   S      F WLL I+G++  FTW+ I   HIRF + +K +G S  ++ +K
Sbjct: 491 VFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYK 550

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAP-----TFSGVDFAAAYVSVFLFIAIWLGAQI 539
           ++   W + YA+  MV+ ++ Q + A +P       S   F   Y+++ + IA+++  ++
Sbjct: 551 SQVGVWGSAYAVVLMVLALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKV 610

Query: 540 WFRC-RIFHRLDEVDIDTDRR--DIEAVVWDDEPPKTLWDKFWN 580
           W R   +F   D++D+ + R   D E +  +DE  K   D+  N
Sbjct: 611 WKRDWSLFIPADKIDLVSHRNIFDEELLKQEDEEYK---DRLRN 651

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  292 bits (747), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 188/591 (31%), Positives = 290/591 (49%), Gaps = 23/591 (3%)

Query: 3   NAKQDVSEEGYELGNF-SGMNDEDSSSGQAGAINHRKKSVVSKTTAVXXXXXXXXXXXXX 61
           N K   +E G    N    ++  D S G  G +N +  +  +                  
Sbjct: 11  NEKLPATECGSSNSNLRESISSNDLSDGDRGFVNRKLHNFCNSFKRANSDTFDASQDLEG 70

Query: 62  XXXXFVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLF 121
                V+      ++ K+++K RH                     L   GP G LI Y  
Sbjct: 71  ASINSVRS----NSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSL 126

Query: 122 MATLVYSVVQSLGEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSV 180
           ++ + Y ++Q+ GEMA   P +   F V+SS F+S +FG A+ ++Y   W     LEL  
Sbjct: 127 VSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELIT 186

Query: 181 VGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLC 240
               I++W +++   A+I IF+ ++   + F    YGE EF  +  KV  + GFII  + 
Sbjct: 187 ASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIV 246

Query: 241 MVCGAGITGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGIT 299
           + CG   TG      YWRNPGA+  G        G F G    L+ A F+Y G EL  +T
Sbjct: 247 INCGGAGTGGYIGGEYWRNPGAFAGG-----SPIGHFKGIAYVLVTAYFSYGGMELFALT 301

Query: 300 AGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFII 357
             E ANPRK+VP A KK ++RIL+ Y    + IG LVPYN  +L  +S  S   +SP++I
Sbjct: 302 VNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHASPYVI 361

Query: 358 AIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPY 417
           A+ + G KV+PHI NAV+L +++S GNS +Y   R++  LA+   AP  F   + AG P 
Sbjct: 362 AVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPL 421

Query: 418 FAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGIS 477
            A+   S FG L+++  S      F WL  I G++  FTW  I   H+RF  A+KY+G S
Sbjct: 422 VALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYS 481

Query: 478 RDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDF-AAAYVSVFLFIAIWLG 536
             +L +K+K   W + YA+FF +++ + Q + A AP  +G    A A+   +L   IW+ 
Sbjct: 482 LSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWIS 541

Query: 537 AQIWFRC-----RIFHRLDEVDIDTDRRDIEAVVW---DDEPPKTLWDKFW 579
             + ++      ++   LDE+D+++ R   +  +    DDE  + L +  W
Sbjct: 542 CYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQEDDEHKEKLKNSGW 592

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  293 bits (751), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 168/516 (32%), Positives = 278/516 (53%), Gaps = 16/516 (3%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +E +  +  +K+++K RH                  S  L+NAGP G +I Y  M + VY
Sbjct: 136 QEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVY 195

Query: 128 SVVQSLGEMAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
            ++Q+ GE+A  +  +   F  +    + PA G +  +++   W     LEL      I+
Sbjct: 196 CIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIK 255

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-A 245
           +WTT+V    ++ IF+VL+ V N+F  K Y E +F+    K++ +VGF I  + + CG A
Sbjct: 256 YWTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGA 315

Query: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
           G  G +G +YWR+PGA+       D    RF G V++ + AAF +  +E + +TA E +N
Sbjct: 316 GTDGYIGSKYWRDPGAF-----RGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSN 370

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPY-NDPKLNSSDSYVSSSPFIIAIENSGT 364
           PRK++P A KK+++RIL  +      +G LVPY +D  L ++ S   +SP++IA+ + G 
Sbjct: 371 PRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGV 430

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
           +V+PH  NAV+L +++S  N   Y  SRI+  LAK   AP  F   +  G P  A+  ++
Sbjct: 431 RVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSA 490

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
            FG +A+   S      F WLL I+G++  FTW+ I   HIRF +A+K +G S  ++ +K
Sbjct: 491 LFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYK 550

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAA-AYVSVFLFIAIWLGAQIWFRC 543
           ++   W + YA+  MV+ ++ Q + A AP   G   +A ++   +L + IW+   I+++ 
Sbjct: 551 SQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKV 610

Query: 544 -----RIFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572
                 +F   D+VD+ + R   D E +  +DE  K
Sbjct: 611 WKKDWSLFIPADKVDLVSHRNIFDEELLKQEDEEYK 646

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  291 bits (746), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 175/501 (34%), Positives = 269/501 (53%), Gaps = 18/501 (3%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           +KR LK RH                     L   GP   +IA++   ++VYSVVQ+LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 137 ATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMA- 195
           A  +PV+ ++  + SRF+ P+FG A  Y Y     IT  LEL      + +W      A 
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYAD 208

Query: 196 AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT--GPVGF 253
           A++ +F++++   NLF VK YGE EF  + IKV A+VGFII  + +VCG G +  G +G 
Sbjct: 209 AFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGA 268

Query: 254 RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 313
           RYW NPG +  G          F G+ +  + +AF++ G+E+  + A E  NPRK +PRA
Sbjct: 269 RYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRA 318

Query: 314 IKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHIFN 372
            K+V +RI +FY      IG LVPY D  L  +S    S+SPF+IAI  +G K LP + N
Sbjct: 319 AKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVN 378

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
            V+L  ++S GN  VY  SR +  LA     P  FG  +  G P   +   + FG L+++
Sbjct: 379 VVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFL 438

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
             S+     F+W+L I+G+  FF W  I  CH+RF +AL  +G S D+L +KA+   W +
Sbjct: 439 SASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGS 498

Query: 493 YYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFH-R 548
            Y +  + +++  Q + A  P   + +   F +AY+S+ + I  +   +++ R   F  +
Sbjct: 499 LYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWTFLIK 558

Query: 549 LDEVDIDTDRRDIEAVVWDDE 569
             ++DIDT RR+++  +   E
Sbjct: 559 SSDIDIDTGRREMDLELLKQE 579

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  293 bits (750), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 168/514 (32%), Positives = 277/514 (53%), Gaps = 18/514 (3%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
           +  E  +K+++K RH                  +  L NAGP G +I Y  M + +Y ++
Sbjct: 136 KFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCII 195

Query: 131 QSLGEMAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWT 189
           Q+ GEMA  +  +   F  + S  + P FG A  ++Y   W     LEL      I++WT
Sbjct: 196 QAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWT 255

Query: 190 TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VCGAGIT 248
           T V   A++ IF+V++    +F  + Y E EF+    K++ ++GF I  + +   GAG  
Sbjct: 256 TTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGND 315

Query: 249 GPVGFRYWRNPGAW-GPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
           G +G +YW +PGA+ G   I       RF G +++ ++AAF +  TE + +TA E +NPR
Sbjct: 316 GYLGAKYWHDPGAFRGTNGIQ------RFKGIMATFVSAAFAFGATEFIALTAAEQSNPR 369

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTKV 366
           K++P A KKV++R++  +      +G LVP++ D  + +  S   +SP+++AI   G +V
Sbjct: 370 KAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRV 429

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           +PH  NAV+L ++ S  NS  Y  SR++ GLA+   AP FF   +  G P+ A+   + F
Sbjct: 430 VPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALF 489

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           G +A+   S      F WLL I+G++  FTW+ I   HIRF +A+  +G S  ++ FKA+
Sbjct: 490 GVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQ 549

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAA-----YVSVFLFIAIWLGAQIWF 541
              + +YYA   MV+ ++ Q + A AP  +  D  A      Y+++ + IA + G ++W 
Sbjct: 550 LGVYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWK 609

Query: 542 RC-RIFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           R  R+F R  ++D+D+ R+  D E +  +DE  K
Sbjct: 610 RDWRLFIRAKDIDLDSYRQVFDEELLKQEDEEYK 643

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  292 bits (748), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 166/492 (33%), Positives = 270/492 (54%), Gaps = 14/492 (2%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
           E+K ++K RH                   T L+N+GP G +I Y  M + +Y ++Q+ GE
Sbjct: 122 ELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGE 181

Query: 136 MAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPM 194
           MA  +  +   F  + S  + PA G +  ++Y   W     LEL      I++WTT V  
Sbjct: 182 MAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDP 241

Query: 195 AAWITIFWVLLTVSNLFP-VKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVG 252
             ++ IF+VL+ + N+      Y E EF+    K++ L+GF I  + ++CG AG  G +G
Sbjct: 242 DVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDGYIG 301

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
            RYW +PGA+       +    RF G VS+L+NAAF +  +E++G+TA E +NPRK++P 
Sbjct: 302 GRYWHDPGAF-----RGEHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPS 356

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTKVLPHIF 371
           A KK+++RI+  Y    V +G LVP+N D  L SS   V +SP+++A+   G +V+PH  
Sbjct: 357 AAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVPHFI 416

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           NAV+L +++S  NS  Y  SR++ GLA+   AP  F   +  G P   +   +    +++
Sbjct: 417 NAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISF 476

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
              S      F WLL I+G++  FTW  I   HIRF +A+  +G S  ++ FK++   W 
Sbjct: 477 CATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWG 536

Query: 492 AYYALFFMVVIILIQGFTAFAPTFSG-VDFAA---AYVSVFLFIAIWLGAQIWFRC-RIF 546
           ++YA   M++I++ Q + A AP   G +D  A    Y++  + IA++ G +I+ +  R+F
Sbjct: 537 SWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKDWRLF 596

Query: 547 HRLDEVDIDTDR 558
            R  ++D+D +R
Sbjct: 597 IRAKDIDLDINR 608

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  292 bits (747), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 169/515 (32%), Positives = 284/515 (55%), Gaps = 19/515 (3%)

Query: 73  HEAE-VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQ 131
           H+++ +K+ ++ RH                   T L +AGP G LI Y  M +++Y ++Q
Sbjct: 111 HKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQ 170

Query: 132 SLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
           + GEMA  +  +T  +  + S  +   FG A  ++Y   W     LEL      I++WTT
Sbjct: 171 ACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VCGAGITG 249
           +V    ++ IF+VL+   N+F  + Y E EF+    K++ + GF I  + + V GAG  G
Sbjct: 231 SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDG 290

Query: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
            +G +YW  PGA+  G+ + D    RF G V++L+ AAF + G+E + IT  E +NPRK+
Sbjct: 291 YIGGKYWHEPGAFN-GVHAID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKA 345

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
           +P A K++++RIL  +    + +G LVPYN D  L SS     +SP++IAI + G +V P
Sbjct: 346 IPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAP 405

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
           H  NAV+L +++S  NS+ Y  +R+   L++   AP  F   + AG P  A+  ++ F  
Sbjct: 406 HFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAV 465

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           +A+   S      F WLL I+G++  FTW  I   HIRF +A+K +G S  +L FK++  
Sbjct: 466 IAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTG 525

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAA----YVSVFLFIAIWLGAQIWFRC- 543
            W + Y+   M++I++ Q + A AP   G   A A    Y+++ + I +++G ++W +  
Sbjct: 526 VWGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDW 585

Query: 544 RIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKF 578
           ++F R D++D+ + R+     ++D+E  K   D++
Sbjct: 586 KLFIRADKIDLTSHRQ-----IFDEELIKQEDDEY 615

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  291 bits (745), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 163/501 (32%), Positives = 267/501 (53%), Gaps = 13/501 (2%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
            ++   + + L  RH                     L+  GP   +I ++ ++T +++V+
Sbjct: 82  DINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVI 141

Query: 131 QSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
            SLGE+A   PV   F V+ +RF+ P+F  A    Y   W +   LEL      I +W  
Sbjct: 142 NSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWND 201

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP 250
            +   AW+ IF+  + ++N+  VK +GE EF ++ +K++A++GF I  + + CG G  G 
Sbjct: 202 KINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGG 261

Query: 251 VGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
               +YW NPGA+            +F G  S  + AAF+Y G E+  ++A E+ NP+++
Sbjct: 262 YIGGKYWHNPGAF-----VGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKET 316

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSGTKVL 367
           +P+A K+  + I V Y  I   IG LVPYNDP+L +  S V  ++SP +IAIEN G K L
Sbjct: 317 IPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGL 376

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P + NA++L  I+S  NS VY  SR M  +A I   P F  + +  G P  A+  T  FG
Sbjct: 377 PSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFG 436

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            L+++  S      F WL  ++G++  F W+ I+   IRF  A+K +G S D++PF ++ 
Sbjct: 437 LLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQS 496

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC 543
             W A+Y +  + ++++   +T+  P    T S   F   Y+S+ + IA ++G ++W R 
Sbjct: 497 GTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRD 556

Query: 544 -RIFHRLDEVDIDTDRRDIEA 563
            R+   L E+D+D+ RR ++A
Sbjct: 557 WRLLVPLMEMDLDSGRRVLDA 577

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  290 bits (743), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 178/503 (35%), Positives = 279/503 (55%), Gaps = 12/503 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +  +K  LK RH                     L   GP   LI +  M T++Y++V +L
Sbjct: 82  QTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMAL 141

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GE+A   P++  FT +++RF+  +FG A+ + Y   W +T  LE+      + +W T   
Sbjct: 142 GELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPK 201

Query: 194 -MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI-TGPV 251
               ++ +FW+++   N+F VK YGE EF  + IKVI ++GFII  + + CG G   G +
Sbjct: 202 YRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYI 261

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           G +Y+ +PGA+     + D    +F G  S  + AAF++ G+ELVG+ A E+ +PRKSVP
Sbjct: 262 GGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVP 316

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
           +A K+V +RI +FY    + IGLLVPYND +L  +S    ++SPF+IAI   G K LP +
Sbjct: 317 KAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGLPSV 376

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V+L  ++S GNS ++  SR    LA+    P  F   +  G P   +  TSA G +A
Sbjct: 377 VNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIA 436

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S      FNWLL ++G++  FTW  I  CHIRF +AL  +G S D+L FK+    W
Sbjct: 437 FVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVW 496

Query: 491 LAYYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
            +Y+ LF +V++ + Q + A  P   + S   F  AY+S  L +A+++G +I+ R  ++ 
Sbjct: 497 GSYWGLFMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHKIYKRNWKLL 556

Query: 547 HRLDEVDIDTDRRDIEAVVWDDE 569
               E+DID+ RR+++  +   E
Sbjct: 557 IPAGEMDIDSGRREVDLELLKQE 579

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  290 bits (742), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 174/517 (33%), Positives = 285/517 (55%), Gaps = 16/517 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           E ++K+ +  RH                     L N GP G +I Y  M + +Y ++Q+ 
Sbjct: 87  ETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAA 146

Query: 134 GEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           GE+A ++  ++  F  + S  +  AFG +  ++Y   W     LEL      I++WTT+V
Sbjct: 147 GELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSV 206

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPV 251
               ++ IF+VL+ + N+F  + Y E EF+    KV+ ++GF I  + + CG AG  G +
Sbjct: 207 NPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYI 266

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           G RYW NPGA+        K    F G +S+++ AAF +  TE + +TA E ANPR+++P
Sbjct: 267 GGRYWNNPGAF-----YGTKPIHHFKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIP 321

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
            A KKVV+RIL+ +    V IG LVP+N P+L  S  S   +SP++IA+ + G +V+PH 
Sbjct: 322 SAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPHF 381

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            NAV+L +++S GNS  Y  SR++  LA    AP++    + +G P  A+  +  FG ++
Sbjct: 382 INAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLIS 441

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S    + F WLL I+G++  FTW+ I   HIRF +AL  +G    +L +K++    
Sbjct: 442 FVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVA 501

Query: 491 LAYYALFFMVVIILIQGFTAFAPTFSGV----DFAAAYVSVFLFIAIWLGAQIWFRC-RI 545
            +YYA F M  I++ Q + A AP  S       F   Y+++ LF+ ++ G +IW R  R+
Sbjct: 502 GSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKIWKRDWRL 561

Query: 546 FHRLDEVDIDTDRR--DIEAVVWDD-EPPKTLWDKFW 579
           +  L+++D+D+ R+  D E +  +D E  + + +K W
Sbjct: 562 YIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGW 598

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  290 bits (741), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 174/503 (34%), Positives = 281/503 (55%), Gaps = 12/503 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
            + +K  LK RH                     L  AGP G LI +    T++YS+V ++
Sbjct: 84  RSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAV 143

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW-TTAV 192
           GE+A   PV+  FT +++RF+  +FG A  + Y   W IT  LE+      + +W   A 
Sbjct: 144 GELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAK 203

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
               ++ +FWV   + NLF VK YGE EF  A IKV+ ++GFII  + ++CG G  G   
Sbjct: 204 YRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYI 263

Query: 253 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
             +YW +PGA+       D    +F G+ +  I A+F++ G+E+VG+   E+ NPRKSVP
Sbjct: 264 GAKYWHHPGAF-----VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVP 318

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
            A K+V +RI +FY    + IG+LVPYND +L  +S    ++SPF+IA+ N G + LP +
Sbjct: 319 GAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQGIRGLPSV 378

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V+L +++S GNS++Y+ SR +  LA+    P      +  G P  A+   SAFG +A
Sbjct: 379 INVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIA 438

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S+     FNWLL ++G++  F+W  I  CHIRF +AL  +G S D+LPF +     
Sbjct: 439 FVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIA 498

Query: 491 LAYYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
            +Y+ +F  V++++ Q +    P   + +  DF  AY+S  + +A ++  +IW +  +++
Sbjct: 499 GSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFHKIWKKNWKLY 558

Query: 547 HRLDEVDIDTDRRDIEAVVWDDE 569
            + +++DIDT RR+++  +   E
Sbjct: 559 IKAEDMDIDTGRREVDRDLLKQE 581

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  290 bits (742), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 172/507 (33%), Positives = 271/507 (53%), Gaps = 16/507 (3%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
           HE  +K+ +K RH                   T L + GP G  I +L M   VY V+Q+
Sbjct: 87  HE-NLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQA 145

Query: 133 LGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW--T 189
            GE+A  +  +   F  + S  + PA G A+ ++Y   W   F LEL      I+FW  +
Sbjct: 146 AGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGS 205

Query: 190 TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA-GIT 248
            +V    ++ IF+VL+ V N F  + Y E EF+    KV+ ++GF I  + +  GA G +
Sbjct: 206 RSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTS 265

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 308
           G +G +YWR+PG+ G        +   F G V++L+NAAF+   +E V +TA E ANPRK
Sbjct: 266 GYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRK 320

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVL 367
           S+P A KK++++I V +    + IG LVP +  +L  S+DS +  SP++IA+   G  V+
Sbjct: 321 SIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVV 380

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P   NAV+L +++S GNS  Y  SR+++ LA+   AP  F   + AG P  A+  +  FG
Sbjct: 381 PSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFG 440

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            + ++  S      F WLL I+G++  FTW  I   HIRF +AL  +G S D+L FKA+ 
Sbjct: 441 TICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQT 500

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFS----GVDFAAAYVSVFLFIAIWLGAQIWFRC 543
               +Y +   MV+ ++ Q + +  P  +       F   Y+++ +F+  + G +IW + 
Sbjct: 501 GIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWNKD 560

Query: 544 -RIFHRLDEVDIDTDRRDIEAVVWDDE 569
            R+F R D++D+ + RR  +A V   E
Sbjct: 561 WRLFIRADQIDLVSHRRIFDADVLKQE 587

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  288 bits (737), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 166/498 (33%), Positives = 275/498 (55%), Gaps = 19/498 (3%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
            + R L  RH                   + L+  GP   +IA+  ++T ++++V +LGE
Sbjct: 70  NLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNALGE 129

Query: 136 MATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMA 195
           +A   PV   F V+ +R + P+ G A    Y   WA+   LEL      I +W  +V   
Sbjct: 130 LAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYWNNSVNSD 189

Query: 196 AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG-ITGPVGFR 254
           AW+ +F+V + +++L  VK +GE EF ++ +K++A+ GF I  + ++CG G   G +G +
Sbjct: 190 AWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYIGAK 249

Query: 255 YWRNPGAW---GPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           YW +PG++    PG         +F G  S  + AAF+Y GTELVG++A E+ANPR ++P
Sbjct: 250 YWNDPGSFVGASPG--------SQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRYTLP 301

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSGTKVLPH 369
           +A K+  + I + Y  +   IG LV ++DPKL S+ S V  ++SP +IAIEN G + LP 
Sbjct: 302 KASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQGLPS 361

Query: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429
           + NA++L  IIS  NS+VY  SR M  +A+I   P  F   +  G P  A+ FT  FG L
Sbjct: 362 LMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLL 421

Query: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489
           +++  S      F WL  ++G++  F W+ I+  HIRF +AL  +G S D+LP+ +    
Sbjct: 422 SFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSMTGV 481

Query: 490 WLAYYALFFMVVIILIQGFTAFAPT-FSGVD---FAAAYVSVFLFIAIWLGAQIWFRC-R 544
             ++Y    ++++++   +T+  P   SG D   F   Y+S+ +F+  ++G +++ R   
Sbjct: 482 IGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKLYKRNWS 541

Query: 545 IFHRLDEVDIDTDRRDIE 562
              R +++D++T RR I+
Sbjct: 542 WMIRSNKIDVNTGRRMID 559

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  288 bits (736), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 183/506 (36%), Positives = 279/506 (55%), Gaps = 16/506 (3%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G+     +K+ L+ RH                   + L  AGP   LIAY  M  +V++
Sbjct: 51  DGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFT 110

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           V+  LGEMA +IP+   FT +++R+  PA G A G+ Y F + +    +L+    +I+FW
Sbjct: 111 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFW 169

Query: 189 TTA--VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
             A  V    WIT+   ++ V N   V+++GEFEFW++  KV+ ++  +I  L +  G G
Sbjct: 170 IPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGG 229

Query: 247 ITGP-VGFRYWRNPGAWGPGIISKDKNE-----GRFLGWVSSLINAAFTYQGTELVGITA 300
            T   +GFRYW +PGA+     SK         G+F+ ++S  + A F Y GTEL GI A
Sbjct: 230 PTHDRLGFRYWSDPGAFKE--YSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVA 287

Query: 301 GEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSS---PFII 357
            E  +PR++VPRAIK  ++RI+VFY      +G+ V YNDP L  + S   S+   P+++
Sbjct: 288 AECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVV 347

Query: 358 AIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPY 417
           AIEN+   VLP++FNA VLT + SA NS++YVGSR +YGLA    AP  F RTN  GVPY
Sbjct: 348 AIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPY 407

Query: 418 FAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGIS 477
            A+   + F  LAYM +S    +AF + +N+T + G  +WV I   +I F +A + +GI 
Sbjct: 408 NALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIP 467

Query: 478 RDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV-DFAAAYVSVFLFIAIWLG 536
           +  L + A   P+  + AL F + + LI+ F AF      V  F   Y+ + ++I  ++G
Sbjct: 468 KSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIG 527

Query: 537 AQIWFRCRIFHRLDEVDIDTDRRDIE 562
            +I  + +      EVD+ T +  I+
Sbjct: 528 YKIVHKTKWIPS-KEVDLFTFKEAID 552

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  287 bits (735), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 183/497 (36%), Positives = 277/497 (55%), Gaps = 14/497 (2%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           +KR LK RH                     L  AGP G LI +    T++Y +V ++GE+
Sbjct: 77  LKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGEL 136

Query: 137 ATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP-MA 195
           A   PV+  FT +++RF+  +FG A+ + Y   W +   LE+      + +W T      
Sbjct: 137 AVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 196

Query: 196 AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVGFR- 254
            ++ +F+V++   N+F VK YGE EF  +FIKVI ++GFII  + +VCG G  G      
Sbjct: 197 GFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGGA 256

Query: 255 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 314
            W NPGA+      K     RF G  S  + AAF++ G+ELVG+ + E ANPRKS+PRA 
Sbjct: 257 NWHNPGAFVGNTAGK-----RFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRAA 311

Query: 315 KKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHIFNA 373
           K+V +RI +FY      IGLLVPYND +L  +S    ++SPF++AI+N G K LP + N 
Sbjct: 312 KQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSVVNV 371

Query: 374 VVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYME 433
           V+L  ++S GNS V+  SR +  LA+    P  FG  +  G P   + FTS FG L+++ 
Sbjct: 372 VILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFIA 431

Query: 434 LSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAY 493
            S      F+WLL ++G++  FTW+ I  CH+RF +AL  +G S D+L F +    W + 
Sbjct: 432 ASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVWGSI 491

Query: 494 YALFFMVVIILIQGFTAFAPTFS---GVDFAAAYVSVFLFIAIWLGAQIWFRC-RIFHRL 549
           Y    +++I+  Q + A  P  S     DF  +Y+S+ + + +++G + + R  ++F R 
Sbjct: 492 YGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRNWKLFIRA 551

Query: 550 DEVDIDTDRR--DIEAV 564
           + +DIDT RR  DIEA+
Sbjct: 552 ENIDIDTGRREVDIEAL 568

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  288 bits (737), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 172/505 (34%), Positives = 276/505 (54%), Gaps = 16/505 (3%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
           E+K+ +K RH                   T L+N+GP G +I Y  M + +Y ++Q+ GE
Sbjct: 108 ELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGE 167

Query: 136 MAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPM 194
           +A  +  +T  F  + S  + PAFG A  ++Y   W     LEL      I++WTT V  
Sbjct: 168 LAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDP 227

Query: 195 AAWITIFWVL-LTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVG 252
             ++ IF+ L L ++ L     Y E EF+    K++ L GF I  + ++CG AG  G +G
Sbjct: 228 DVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIG 287

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
            R W NPG++       DK   RF G VS+L+NAAF +  +E +G+TA E +NPRK++P 
Sbjct: 288 TRLWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPS 342

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTKVLPHIF 371
           A KK+++RI+  Y      +G LVPY+ D  L SS +   +SP+++AI   G +V+PH  
Sbjct: 343 AAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLHGVRVVPHFI 402

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           NAV+L +++S GNS  Y  SR +  L+++  APSF    +  G P  A   ++  G +A+
Sbjct: 403 NAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAF 462

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
              S      F WLL I+G++  FTW  I   H+RF +A++ +G S  ++ FK++   + 
Sbjct: 463 CATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYG 522

Query: 492 AYYALFFMVVIILIQGFTAFAPTFSGVD----FAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
           + Y+   MV+I++ Q +TA  P   G      F   Y+++ +FI ++ G +IW +  R+F
Sbjct: 523 SLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLF 582

Query: 547 HRLDEVDIDTDRR--DIEAVVWDDE 569
            R +++D+ + R   D E +  +DE
Sbjct: 583 IRAEDIDLVSHREIFDEELLKQEDE 607

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  287 bits (735), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 160/511 (31%), Positives = 269/511 (52%), Gaps = 13/511 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           +++  ++   + + L  RH                     LS  GP   +I ++ ++T +
Sbjct: 76  IEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCL 135

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           ++V+ SLGE++   PV   F V+S RF+ P+F  A    Y   W +   LEL      I+
Sbjct: 136 FTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIK 195

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
           +W   +   AW+ IF+  + ++N+  VK +GE EF ++ IK+++++GF I  + + CG G
Sbjct: 196 YWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGG 255

Query: 247 ITGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
             G     +YW +PGA+         +  +F G  S  + AAF+Y G E+  ++A E+ N
Sbjct: 256 PHGGYIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKN 310

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSG 363
           PR+++P+A K+  + I   Y  I   IG LVP NDP+L +  S V  +SSP +IAIEN G
Sbjct: 311 PRETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGG 370

Query: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFT 423
            K LP + NA++L  ++S  NS VY  SR M  +A I   P F  R +  G P  A+  T
Sbjct: 371 IKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLT 430

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
             FG L+++  S   A  F WL  ++G++  F W+ I+  HIRF QA+K +  S D+LPF
Sbjct: 431 LFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPF 490

Query: 484 KAKFMPWLAYYALFFMVVIILIQGFTAFAPTFS----GVDFAAAYVSVFLFIAIWLGAQI 539
            ++     ++Y    + ++++   +T+  P  S       F   Y+S  + I  + G +I
Sbjct: 491 ISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKI 550

Query: 540 WFRC-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
           + R   +  +L+++D+DT R+ ++  +  +E
Sbjct: 551 YTRNWTLMVKLEDIDLDTGRKQVDLALRREE 581

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  287 bits (734), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 162/512 (31%), Positives = 269/512 (52%), Gaps = 15/512 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           V++  ++   + + L  RH                   T LS  GP   +I ++ + T +
Sbjct: 76  VEQVDINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCL 135

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           ++V+ SLGE++   PV   F V+  RF+ P+F  A    Y   W +   LEL      I+
Sbjct: 136 FTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIK 195

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
           +W   +   AW+ IF+  + ++N+  VK +GE EF ++ IK+++++GF I  + + CG G
Sbjct: 196 YWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGG 255

Query: 247 ITGPVGF-RYWRNPGAWGPGIISKDKNEG-RFLGWVSSLINAAFTYQGTELVGITAGEAA 304
             G     +YWRNPGA+         N G +F G  S  + AAF+Y G E+  ++A E+ 
Sbjct: 256 PHGGYIGGKYWRNPGAF------VGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESK 309

Query: 305 NPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENS 362
           NPR+++P+A K+  + I   Y  I   IG LVP NDP+L +  S V  +SSP +IAIEN 
Sbjct: 310 NPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENG 369

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
             K LP + NA++L  ++S  NS VY  SR M  +A I   P F  R +  G P  A+  
Sbjct: 370 RIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILL 429

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           T  FG L+++  S   A  F WL  ++G++  F W+ I+  HIRF +A+K +  S D+LP
Sbjct: 430 TLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELP 489

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAFAPT----FSGVDFAAAYVSVFLFIAIWLGAQ 538
           F ++     ++Y    + ++++   +T+  P      S   F   Y+S  + I  + G +
Sbjct: 490 FISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIVCYFGHK 549

Query: 539 IWFRC-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
           I+ R   +  +++++D+DT R+ ++  +  +E
Sbjct: 550 IYTRNWTLMVKIEDIDLDTGRKQVDLTLRREE 581

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  288 bits (738), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 165/516 (31%), Positives = 278/516 (53%), Gaps = 16/516 (3%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           +E +  +  +K+++K RH                  S  L+NAGP G +I Y  M + VY
Sbjct: 136 QEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVY 195

Query: 128 SVVQSLGEMAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
            ++Q+ GE+A  +  +   F  +    + PA G +  +++   W     LEL      I+
Sbjct: 196 CIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIK 255

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-A 245
           +WT  V    ++ IF+VL+ V N+F  K Y E +F+    K++ ++GF I  + + CG A
Sbjct: 256 YWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGA 315

Query: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
           G  G +G +YWR+PGA+       D    RF G V++ + AAF +  +E + +TA E +N
Sbjct: 316 GTDGYIGSKYWRDPGAF-----RGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSN 370

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPY-NDPKLNSSDSYVSSSPFIIAIENSGT 364
           PRK++P A KK+++RIL  +      +G LVPY +D  L ++ S   +SP++IA+ + G 
Sbjct: 371 PRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGV 430

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
           +V+PH  NAV+L +++S  NS  Y  SRI+  LAK   AP  F   +  G P  A+  ++
Sbjct: 431 RVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSA 490

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
            FG +A+   S      F WLL I+G++  FTW+ I   HIRF +A+K +G S  ++ +K
Sbjct: 491 LFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYK 550

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAA-----YVSVFLFIAIWLGAQI 539
           ++   W + YA+  M++ ++ Q + A AP   G   +A      Y+++ + IA+++  ++
Sbjct: 551 SQVGVWGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFKV 610

Query: 540 WFRC-RIFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           W     +F   ++VD+ + R   D E +  +DE  K
Sbjct: 611 WKNDWSLFIPANKVDLVSHRNIFDEELLKQEDEEYK 646

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  285 bits (728), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 169/508 (33%), Positives = 270/508 (53%), Gaps = 16/508 (3%)

Query: 68  KEGQVHEAE-----------VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGL 116
           + G+V+E +           ++R  KQRH                   T L   GP   L
Sbjct: 26  QNGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLL 85

Query: 117 IAYLFMATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFAL 176
           IA++F  +L+  V+ SL EMA+F P+  +F+ +++R++ PA G A+G+ Y+  +AI  A 
Sbjct: 86  IAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALAS 145

Query: 177 ELSVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFII 236
           ELS +G ++++W   + +A +I +F V+L   N   +K+YGE EFW A +K + L+   +
Sbjct: 146 ELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFV 205

Query: 237 YCLCMVCGAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTEL 295
             L + CG G +   +GFRYWR   A+ P ++      GRFLGW + +I + + Y G+E 
Sbjct: 206 TGLVLTCGGGPSKETIGFRYWREY-AFVPYLV--KGTTGRFLGWWACVIQSCYAYIGSET 262

Query: 296 VGITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSP 354
           +G+  GEA NP+K++P A + V+FRI  FY    + +GL++  +D  L N+  S  S SP
Sbjct: 263 IGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIISPHDKTLANAKTSDASGSP 322

Query: 355 FIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAG 414
           F+IA  N+G K LP   NA+++  I SA N+ +YV SR  YGLAK  +AP  F   N  G
Sbjct: 323 FVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYG 382

Query: 415 VPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYR 474
           VP+           L++M +S   +  F +L +   V G   W+ +   +I + +A  + 
Sbjct: 383 VPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFH 442

Query: 475 GISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIW 534
            + RD +PF+  F P+ AY  LFF+ +II   G++AF   F    F  +Y+ + +FI   
Sbjct: 443 DVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYKSFIVSYIGIAVFIGNT 502

Query: 535 LGAQIWFRCRIFHRLDEVDIDTDRRDIE 562
           L  + W +       D   I  +   +E
Sbjct: 503 LFWKFWKKSAATRPEDLRSIMVEEAIVE 530

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  288 bits (737), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 169/508 (33%), Positives = 273/508 (53%), Gaps = 17/508 (3%)

Query: 74  EAEVKRALKQ----RHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSV 129
           +A   +ALKQ    RH                   T L NAGP G +I Y  M +++Y +
Sbjct: 123 DANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCI 182

Query: 130 VQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
           +Q+ GEMA  +  +   + V+ S  +   FG A  ++Y   W     LEL      I++W
Sbjct: 183 IQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYW 242

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGI 247
           TT+V    ++ IF+ L+ + N+F  K Y E EF+    KV+ ++GF I  + +  G AG 
Sbjct: 243 TTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGN 302

Query: 248 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
            G +G  YW  PGA+       D +   F G   +L+ AAF Y GTE + +TA E +NPR
Sbjct: 303 DGYLGGLYWHTPGAF-----RGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPR 357

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSD-SYVSSSPFIIAIENSGTKV 366
            ++P A KKV++RI+  Y    + IG LVP++  +L  SD S  S+SP+++A    G +V
Sbjct: 358 AAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRV 417

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           +PH  NAV+L +++S GNS  Y  SR++  LA+   AP +F   +  G P  A+  ++ F
Sbjct: 418 VPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALF 477

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           G +A+   S      F WLL I+G++  FTW  I   HIRF  A+K +G S  ++ + A+
Sbjct: 478 GVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQ 537

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAPTFSG----VDFAAAYVSVFLFIAIWLGAQIWFR 542
              W ++YALF M +I + Q + A AP  SG     +F   Y+++ + I ++LG +I+++
Sbjct: 538 TGVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYK 597

Query: 543 C-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
              +  + +++D+ + R+  +  +  +E
Sbjct: 598 DWTLLIKAEDIDLQSHRQIFDEDLLKEE 625

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  286 bits (731), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 180/500 (36%), Positives = 266/500 (53%), Gaps = 19/500 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
            A +KR LK RH                     L+ AGP G LI +    T++Y +V ++
Sbjct: 73  NAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GE+A   P+   FT ++SRF+  +FG A   +Y   W +   LE+      + +W T   
Sbjct: 133 GELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDK 192

Query: 194 -MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
               ++ +F+V++   N F VK YGE EF  +FIKVI ++G+II  + +VCG G  G   
Sbjct: 193 YRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYI 252

Query: 253 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
             R W NPGA+  G          F G  S  + AAF++ G+ELVG+ A E ANPRKS+P
Sbjct: 253 GGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLP 302

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
            A K+V +RI +FY    + +GLLVPY   +L   S    ++SPF+I+I+N+G K LP +
Sbjct: 303 SAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSV 362

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V+L  ++S GNS V+  SR M  LA     P  FG  +  G P   +  T  FG L+
Sbjct: 363 INVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLS 422

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S      F+WLL ++G++  FTW  I  CHIR  +AL  +  +  +L F A    W
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVW 482

Query: 491 LAYYALFFMVVIILIQGFTAFAPTF---SGVDFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
            + Y    +++I++ Q + A  P     S   F  AY+S  + IA ++G +IW +  ++F
Sbjct: 483 GSVYGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLF 542

Query: 547 HRLDEVDIDTDRR--DIEAV 564
            R   +DIDT RR  DIEA+
Sbjct: 543 IRAKNIDIDTGRRETDIEAL 562

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  286 bits (732), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 176/511 (34%), Positives = 275/511 (53%), Gaps = 14/511 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           +++   HE ++K+ ++ RH                     L N GP G  + +  M T V
Sbjct: 80  LQDNNKHE-KLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCV 138

Query: 127 YSVVQSLGEMATFIPVTSA-FTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185
           Y V+Q+ GEMA   P  S  F  + S  + P FG A+ ++Y   W   F LEL      I
Sbjct: 139 YCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITI 198

Query: 186 EFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245
           ++WTTA+    ++ +F++L+ V N F  + Y E EF+    KV+ ++GF I  + +  GA
Sbjct: 199 KYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGA 258

Query: 246 -GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 304
            G  G +G +YWR PG++G G  + D     F G VS+L+NAAF+   +E V +TA E A
Sbjct: 259 AGNDGYIGAKYWREPGSFG-GHTAID----HFKGVVSTLVNAAFSLGCSEFVALTAAEQA 313

Query: 305 NPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSG 363
           NPRKSVP A KK+++++ V +      IG LVP N  +L  S+DS V  SP++IA+ + G
Sbjct: 314 NPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIAVASHG 373

Query: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFT 423
            +V+PH  NAV+L +++S GNS  Y  SR++  LA+   AP  F   +  G P  A+  +
Sbjct: 374 VRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVS 433

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
              G L ++  S    + F WLL I+G++  FTW  I   HIRF +AL  +G   D L F
Sbjct: 434 ITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGF 493

Query: 484 KAKFMPWLAYYALFFMVVIILIQGFTAFAPTFS----GVDFAAAYVSVFLFIAIWLGAQI 539
           KA+   W +YY+   M++  + Q +T   P  S       F   Y++  +F+A++ G +I
Sbjct: 494 KAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYFGYKI 553

Query: 540 WFRC-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
           + +  ++F   +++D+D  R+  +A V   E
Sbjct: 554 YNKNWQLFIPAEKIDLDLHRKIFDADVLKQE 584

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  285 bits (729), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 162/510 (31%), Positives = 274/510 (53%), Gaps = 28/510 (5%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
            +K  L+ RH                  S+ L+N GP   +I+Y+ ++T+VY ++   GE
Sbjct: 55  NLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGE 114

Query: 136 MATFIPVTS---------AFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           M  ++P            A+ V  S+++  + G A+ + Y++ + +  A E +    I+E
Sbjct: 115 MVCYLPGNDDDDESVGYCAYLV--SKYVDESLGFATSWNYYYCFIVLVATECTAASSIVE 172

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
           +WT+ +P A  I +F  ++ + N  PVK+YGE EFW A IK+  + G II    + CG  
Sbjct: 173 YWTSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGA 232

Query: 247 ITGP----VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAG 301
                   VGF YW+NP ++   +   + + G FL   ++LI  AF +  G ELV +T+ 
Sbjct: 233 PNNEDNSFVGFHYWKNPSSFRDYV--TNGSLGNFLDVYNALIKGAFAFILGPELVSLTSS 290

Query: 302 EAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY----VSSSPFII 357
           E  + R+++ +A ++ V+R++ FY   A+ I ++VPYNDP L ++ +       SSPF+I
Sbjct: 291 ECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVI 350

Query: 358 AIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPY 417
            I+N+G  +LPHI N  +LT+ +SAGN+ ++  +R +  + K   AP  F R N  GVPY
Sbjct: 351 GIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPY 410

Query: 418 FAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGIS 477
            A+  +     LA++  S   A  F W  NI+ ++GF  W      ++RF + + Y G+ 
Sbjct: 411 VALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL- 469

Query: 478 RDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTF-SGVDFAAAYVSVFLFIAIWLG 536
            D LPFK K   +L +Y+  F+ ++IL  G+    P F +  DF AAY+++ +F+ ++ G
Sbjct: 470 YDRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFG 529

Query: 537 AQI----WFRCRIFHRLDEVDIDTDRRDIE 562
             I    W + + +  +DE+D+ T   +IE
Sbjct: 530 HIIYSGRWRQRKWWKPVDEIDVVTGLEEIE 559

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  285 bits (728), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 166/504 (32%), Positives = 267/504 (52%), Gaps = 18/504 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
            + +KR LK RH                     L   GP   ++A++   ++VYSVVQ++
Sbjct: 81  RSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAI 140

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GE+   +PV+ ++  + SRF+ P+FG A  Y Y     +T  LE+      +++W     
Sbjct: 141 GELCVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHK 200

Query: 194 MA-AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI--TGP 250
            A  ++ +F+V + + N   VK YGE EF  + IKV+A+VGFII  + +VCG G   TG 
Sbjct: 201 YADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGY 260

Query: 251 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 310
           +G +YW NPG +  G          F G+ +  + +AF++ G+E+  + A E+ NPR+ +
Sbjct: 261 IGTKYWHNPGGFAHG----------FKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDL 310

Query: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPH 369
           P+A K+V +RI +FY      IG LVPY +  L  SS    S+SPF+IAI+ +G   LP 
Sbjct: 311 PKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPS 370

Query: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429
           + N V+L  ++S GN+ V+  SR    LA     P  F   +  G P   +  +  FG L
Sbjct: 371 VINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLL 430

Query: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489
           +++  S      F W+L ++G+  FFTW  I  CH+RF Q L+ +G S D+L FKA+   
Sbjct: 431 SFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGI 490

Query: 490 WLAYYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC-RI 545
           W + Y +  + V++  Q + A  P   + S   F   Y+S+ + I  ++G +++ R  R+
Sbjct: 491 WGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRNWRL 550

Query: 546 FHRLDEVDIDTDRRDIEAVVWDDE 569
                E+D+DT RR+++  +   E
Sbjct: 551 VIPAKELDLDTGRREVDLELLKQE 574

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  285 bits (729), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 185/591 (31%), Positives = 291/591 (49%), Gaps = 37/591 (6%)

Query: 4   AKQDVSEEGYELGNFSGMND------EDSSSGQ---AGAINHRKKSVVSKTTAVXXXXXX 54
           +K++ S E   + +FSG ND      E + SGQ   +  + HR  +   +          
Sbjct: 11  SKKEASPESISIRSFSGGNDFQISSREKAYSGQPSKSEKLIHRLANSFKRAEGSITKTRQ 70

Query: 55  XXXXXXXXXXXFVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVG 114
                         E    ++++K+++K RH                  +  L   GP  
Sbjct: 71  INENTSDLEDGI--ESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAA 128

Query: 115 GLIAYLFMATLVYSVVQSLGEMATFIPVTSA-FTVFSSRFLSPAFGAASGYMYWFSWAIT 173
            +I Y+ ++ + Y ++Q+ GEMA   P   A F  +SS F+S  FG A+ ++Y F W   
Sbjct: 129 LVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTV 188

Query: 174 FALELSVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVG 233
             LEL      I++W   +    +I IF++ L   ++F VK YGE EF     K++ + G
Sbjct: 189 LPLELITASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAG 248

Query: 234 FIIYCLCMVCG-AGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQG 292
           FII  + + CG AG  G +G  YW NPGA+     + D +  RF      L+   F++ G
Sbjct: 249 FIILSVVINCGGAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGG 303

Query: 293 TELVGITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVS 351
            EL  ++  E +NPRKS P A K+ ++RI++ Y    + IG  VPYND +L  +  S   
Sbjct: 304 MELFALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATH 363

Query: 352 SSPFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTN 411
           +SP+++A    G K++PHI NAV+L +++S  NS++Y G R++  L++   AP F    +
Sbjct: 364 ASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVD 423

Query: 412 AAGVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQAL 471
             G P  A+     FG +A++  S+     F WL  I G++  FTW  I   H+RF QA+
Sbjct: 424 REGRPLRALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAM 483

Query: 472 KYRGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFI 531
           K +G S D+L +KA    W + Y  FF +++ + Q + A AP   G D      SV  F 
Sbjct: 484 KVQGRSLDELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPL--GND---GRCSVESFF 538

Query: 532 AIWLGAQIW----FRCRIFHR-------LDEVDIDTDRR--DIEAVVWDDE 569
             +L A IW    F   I++R       LD++D+D  RR  D E +  +D+
Sbjct: 539 ESYLAAPIWLTFFFGYMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQ 589

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  285 bits (729), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 162/520 (31%), Positives = 280/520 (53%), Gaps = 27/520 (5%)

Query: 67  VKEGQVHEAEVKRALKQ----RHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFM 122
           + E  ++E   K  LKQ    RH                     L+  GP G + +YL +
Sbjct: 88  ISEELINEDGRKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLII 147

Query: 123 ATLVYSVVQSLGEMATFIPVTSAFTVFS-----SRFLSPAFGAASGYMYWFSWAITFALE 177
           +T+VY ++  LGEM  ++P   + +  S      R+L  +   A+G+ Y++ + +  A E
Sbjct: 148 STMVYPIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAE 207

Query: 178 LSVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIY 237
            +    ++E+WT  VP  AWI +F +++   N+ PV+ YGE EFW A  K++ +VG II 
Sbjct: 208 CTAASGVVEYWTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIIL 267

Query: 238 CLCMVCGAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTEL 295
              +  G G     +GFRYW  PG++   I   + + G FL     +I  AF++  G EL
Sbjct: 268 SFILFWGGGPNHDRLGFRYWITPGSFANTI--TNGSFGNFLDVYKGIILGAFSFILGPEL 325

Query: 296 VGITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSS----DSYVS 351
           V + + E ++PR+++ +A K+ ++R++ FY    + I ++V YNDP L+++         
Sbjct: 326 VVLPSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAG 385

Query: 352 SSPFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTN 411
           SSPF+I I+N+G  VLPHI N  +L +  S+GN+ ++  SR +  +A    AP   G+ N
Sbjct: 386 SSPFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKIN 445

Query: 412 AAGVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQAL 471
             GVPY AV  +     +AY+  S   +  F W  N++ ++GF  W+++S  ++RF +A+
Sbjct: 446 RFGVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAI 505

Query: 472 KYRGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV-DFAAAYVSVFLF 530
           +Y G+ +D LP+     P+L  Y+L   ++I +  GF    P    V DF AAY+++ +F
Sbjct: 506 EYHGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIF 564

Query: 531 IAIWLGAQIW--------FRCRIFHRLDEVDIDTDRRDIE 562
           + IW+G + +         +CR +++++++D+ T   +IE
Sbjct: 565 LMIWIGHKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIE 604

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  284 bits (727), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 174/507 (34%), Positives = 274/507 (54%), Gaps = 17/507 (3%)

Query: 75  AEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLG 134
           A + R LK RH                     L+ AGP G LI +   AT++  +  SLG
Sbjct: 81  APLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLG 140

Query: 135 EMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPM 194
           E+A   PV+  +  +++RF+  ++G A+ + Y     +   LE+      + +W T    
Sbjct: 141 ELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKY 200

Query: 195 A-AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPV-G 252
             A++ +FWV++   NLF V+ +GE E   + IKVI ++GFII  + ++ G G    V G
Sbjct: 201 KLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIG 260

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
            +YW +PG +  G    DK    F G  S  + AAF++ G+EL+G+ A E   PRKS+P+
Sbjct: 261 GKYWNDPGPF-VGNAPSDK----FKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPK 315

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY-VSSSPFIIAIENSGTKVLPHIF 371
           A K+V +RI +FY    + +GLLVP N+  L +      + SPF+IA++    +VLP I 
Sbjct: 316 AAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSII 375

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           N V+LT +IS GNS+VY  SR M  LA+    P  FG  +  G P FA+ FTS FG L +
Sbjct: 376 NVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCF 435

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
           +  +      F+WLL I+G++ FFTW+ I+  H+RF  ALK +G + ++L F +      
Sbjct: 436 VAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFIG 495

Query: 492 AYYALFFMVVIILIQGFTAFAPTF--------SGVDFAAAYVSVFLFIAIWLGAQIWFRC 543
           + YA+  + V+++ Q + A  P          S + F   Y+S  + I ++L  +IW R 
Sbjct: 496 SCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRN 555

Query: 544 -RIFHRLDEVDIDTDRRDIEAVVWDDE 569
            + F +  E+DIDT RR+++  ++ +E
Sbjct: 556 WKFFIKAKEMDIDTGRRELDLELFKEE 582

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  284 bits (726), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 158/503 (31%), Positives = 266/503 (52%), Gaps = 13/503 (2%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           ++  ++   + + L  RH                     LS  GP   +I ++ ++T ++
Sbjct: 77  EQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLF 136

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           +V+ SLGE++   PV   F V+S RF+ P+F  A    Y   W +   LEL      I++
Sbjct: 137 TVINSLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKY 196

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           W   +   AW+ IF+  + ++N+  VK +GE EF ++ IK+++++GF I  + + CG G 
Sbjct: 197 WNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGP 256

Query: 248 TGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
            G     +YW +PGA+         +  +F G  S  + AAF+Y G E+  ++A E+ NP
Sbjct: 257 HGGYIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNP 311

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSGT 364
           R+++P+A K+  + I   Y  I   IG LVP NDP+L +  S V  +SSP +IAIEN G 
Sbjct: 312 RETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGI 371

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
           K LP + NA++L  ++S  NS VY  SR M  +A I   P F  R +  G P  A+  T 
Sbjct: 372 KGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTL 431

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
            FG L+++  S   A  F WL  ++G++  F W+ I+  HIRF QA+K +  S D+LPF 
Sbjct: 432 FFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFI 491

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAPT----FSGVDFAAAYVSVFLFIAIWLGAQIW 540
           ++     ++Y    + ++++   +T+  P      S   F   Y+S  + I  ++G +++
Sbjct: 492 SQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLY 551

Query: 541 FRC-RIFHRLDEVDIDTDRRDIE 562
            R   +  +L+++D+DT R+ ++
Sbjct: 552 TRNWTLMVKLEDMDLDTGRKQVD 574

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  284 bits (726), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 167/521 (32%), Positives = 272/521 (52%), Gaps = 23/521 (4%)

Query: 67  VKEGQVHEA---EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMA 123
           +K  Q ++    ++++ ++ RH                     L NAGP G LI Y+ MA
Sbjct: 67  IKSDQFNDKLNNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMA 126

Query: 124 TLVYSVVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVG 182
           + +Y ++Q+ GEMA  ++ +   F  + S  +  A+  A  ++Y   W     LEL    
Sbjct: 127 SCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTAS 186

Query: 183 QIIEFWTTAVPMAAWITIFWVLLTVSNLFP-VKYYGEFEFWIAFIKVIALVGFIIYCLCM 241
             I++W   V    ++TIF++L+   NLF   + Y E EF+    K++ + GF I  + +
Sbjct: 187 MTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIIL 246

Query: 242 VCG-AGITGPVGFRYWRNPGAW---GPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVG 297
           +CG AG +G +G  YW NPGA+    PG         RF G VS+L+ AAF++  TE + 
Sbjct: 247 ICGGAGTSGYIGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLA 298

Query: 298 ITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFI 356
           ITA E +NPRK++P A KKV++R L  Y    + +G LVPYN P+L  S  S   +SP++
Sbjct: 299 ITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYV 358

Query: 357 IAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVP 416
           IA+ + G ++ PH  NAV+L +++S  NS+ Y  SR++  LAK   AP  F   +  G P
Sbjct: 359 IAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRP 418

Query: 417 YFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGI 476
            F +   S    +A+   S      F+WLL I+G++  FTW  I   HIRF +A+K +G 
Sbjct: 419 LFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGR 478

Query: 477 SRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSG----VDFAAAYVSVFLFIA 532
           S ++L +K++   W + YA   M +I++ Q + A  P  S      +F   Y+++ + + 
Sbjct: 479 SLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLL 538

Query: 533 IWLGAQIWFRC-RIFHRLDEVDIDTDRRDIEAVVWDDEPPK 572
            + G + W +   +F R  ++D+ + R   +  V   E  +
Sbjct: 539 FYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  282 bits (721), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 172/501 (34%), Positives = 265/501 (52%), Gaps = 20/501 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
            + VKRALK RH                     L+  GP+  L+ +  +  + +S+++S+
Sbjct: 39  HSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESI 98

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GE+ T  P    F   + RF S    A SGY Y   +    A E + +  I++FW   VP
Sbjct: 99  GELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVP 158

Query: 194 MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITG--PV 251
           +  +  IFW    V  L  V  +GE E+W+A+ K++ LV F I+ +  + G GI G  P+
Sbjct: 159 IYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSG-GIPGKPPI 217

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           GF+YW+NPGA   G          F G     +  +  Y GTE V + A E+ NPRK+VP
Sbjct: 218 GFQYWKNPGALSHG----------FRGIAVVFVFCSTFYSGTESVALAATESRNPRKAVP 267

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIF 371
            A+++  +RIL+ Y  I+ F G+ VPYNDP L +    + S P  IA+  +G     H+ 
Sbjct: 268 LAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQTKSLKS-PISIALSRAGWAGGVHLV 326

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           NA +L T ISA NS++Y+GSR +  LA   LAP     T+  GVP  A+   +A G ++ 
Sbjct: 327 NAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISL 386

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
           M +S G ++A+N+++N++GV  F  W  IS  H+RF +A   +G S  +LP++A F PW 
Sbjct: 387 MNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWT 446

Query: 492 AYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDE 551
             ++L   + + LIQG+T+  P F   DF  AY+ +     +++G   W + R F  ++ 
Sbjct: 447 TIFSLAANIFLALIQGWTSLVP-FVAKDFVDAYILLPAAGLLYVGINFW-KNRNFKTVNI 504

Query: 552 VDIDTD---RRDIEAVVWDDE 569
             I+ +   RRD++    DDE
Sbjct: 505 HGINLEEGQRRDLDEDS-DDE 524

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  281 bits (720), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 167/504 (33%), Positives = 269/504 (53%), Gaps = 17/504 (3%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           VKRALK RH                     L   GP+  L+ ++ +  + ++V++S+GEM
Sbjct: 32  VKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIGIIAFAVMESIGEM 91

Query: 137 ATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMAA 196
            T  P    FT  + RF S A  A  GY Y   +    A E + +  I++FW   VP+ A
Sbjct: 92  ITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSSILQFWGPQVPLYA 151

Query: 197 WITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPV-GFRY 255
           +  IFW++  +  L  V  +GE E+W++ +K++ L+ + I+ +  + G     P  GF Y
Sbjct: 152 YTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMSGGVRNKPAFGFHY 211

Query: 256 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 315
           W++PG+   G          F G     +  +  Y GTE V +TA E+ NP KSVP A++
Sbjct: 212 WKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVALTATESKNPTKSVPYAVR 261

Query: 316 KVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFNAVV 375
           + ++RI+V Y  IA+F G  VP+NDP L S ++ V  SP  IAI  +G     H+ NA +
Sbjct: 262 QTLWRIVVVYIGIAIFYGSTVPFNDPNL-SVNTKVLKSPIAIAISRAGWAGGSHLVNAFI 320

Query: 376 LTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYMELS 435
           L + ISA N ++Y+GSR +  LA   LAP F   T+  GVP  A+   +A G ++ M +S
Sbjct: 321 LFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITIFNALGLISLMNMS 380

Query: 436 TGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAYYA 495
            G ++A+++++N++GV  F  W +IS  H+R  +A   +G   ++LP+KA F PW   ++
Sbjct: 381 VGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELPYKALFYPWTPIFS 440

Query: 496 LFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEVDID 555
           L   + + LIQG+T+  P F   +F  AY+ +   I +++G  + F+   F  +D   ++
Sbjct: 441 LISNIFLALIQGWTSLVP-FKAPEFVDAYILLPAAIILYVGVCV-FKNHNFRIVDLTSVN 498

Query: 556 TD---RRDIEAVVWDDEPPKTLWD 576
            D   R+D+E    D E   + +D
Sbjct: 499 LDEGRRKDMENDQSDQESILSSFD 522

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  281 bits (720), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 166/512 (32%), Positives = 274/512 (53%), Gaps = 16/512 (3%)

Query: 69  EGQV---HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATL 125
           EGQ     E ++K+ +  RH                     L N GP G  I Y  M + 
Sbjct: 68  EGQPVAPRETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSC 127

Query: 126 VYSVVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQI 184
           +Y ++Q+ GEMA ++  ++  F  + S  + PA G +  ++Y   W     LEL      
Sbjct: 128 IYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATIT 187

Query: 185 IEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG 244
           I++WTTAV    ++ IF+VL  + NLF  + Y E EF+    KV+ + GF I  + + CG
Sbjct: 188 IKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCG 247

Query: 245 -AGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303
            AG  G +G +YW +PGA     +   K    F G +++++ AAF +  TE + +TA E 
Sbjct: 248 GAGNDGYLGGKYWHDPGA-----LYGTKPIHHFKGIIATMVTAAFAFGATEFIALTAAEQ 302

Query: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENS 362
           ANPR+++P A KK+V+R+L+ +    + +G LVPYN D  + S  S   +SP++IAI + 
Sbjct: 303 ANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASH 362

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G KV+PH  NAV+L +++S GNS  Y  SR++  L++   APS+    +  G P  A+  
Sbjct: 363 GVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLV 422

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           +  FG +A++  S    + F WLL I+G++  FTW+ I   HIRF +AL  +G S  +L 
Sbjct: 423 SCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELG 482

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAFAPT----FSGVDFAAAYVSVFLFIAIWLGAQ 538
           +K++     +YYA   M  ++  Q + A AP         +F   Y+++ + IA++ G +
Sbjct: 483 YKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYR 542

Query: 539 IWFRC-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
           +W R  +++  L+++D+ + R+  +  +   E
Sbjct: 543 VWKRDWKLYIPLEQIDLVSHRKVFDEDLLKQE 574

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  280 bits (717), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 177/499 (35%), Positives = 264/499 (52%), Gaps = 21/499 (4%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           VKRALK RH                     LS  GP+  L+ +  +  + ++V++S+GEM
Sbjct: 44  VKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEM 103

Query: 137 ATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMAA 196
            T  P  S F+  S RF S A  A SGY Y   +    A E + +  I++FW   VP+  
Sbjct: 104 ITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYG 163

Query: 197 WITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPV-GFRY 255
           +I IF V   V  +  V  +GEFE+W+A+ K+I L+ + I+ +  + G     P  GF Y
Sbjct: 164 YILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGFHY 223

Query: 256 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 315
           W NPGA   G          F G     +  +  Y GTE V + A E+ NP K+VP AIK
Sbjct: 224 WNNPGALADG----------FKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPIAIK 273

Query: 316 KVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFNAVV 375
           +  +RI++ Y  IAVF G  VPYND  L +    + S P  IAI  +G +   H+ NA +
Sbjct: 274 QTFWRIIIVYLGIAVFYGATVPYNDTSLGAHTKALKS-PIAIAITRAGWEGGVHLVNAFI 332

Query: 376 LTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYMELS 435
           L T +SA N ++Y+GSR +  LA   LAP F   T+  GVP  A+   +A G ++ M +S
Sbjct: 333 LITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLMNVS 392

Query: 436 TGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAYYA 495
            G ++A+++++N++GV  F  W +IS  H+RF +A   +G S  +LP+K+   PW   ++
Sbjct: 393 VGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPIFS 452

Query: 496 LFFMVVIILIQGFTAFAPTFSGVDFAAAYV----SVFLFIAIWLGAQIWFRCRIFHRLDE 551
           L   + + LIQG+T F P FS  DF  AY+    +V L+I I L     F+      L  
Sbjct: 453 LAANIFLGLIQGWTTFVP-FSAKDFVDAYILLPAAVILYIVISLVKIGGFKLV---DLRT 508

Query: 552 VDIDTDRR-DIEAVVWDDE 569
           VD++  RR D+++   D++
Sbjct: 509 VDLEEGRREDLDSDGTDED 527

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  281 bits (720), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 157/512 (30%), Positives = 273/512 (53%), Gaps = 13/512 (2%)

Query: 66  FVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATL 125
            + +  +  + + + L  RH                     L+  GP   +I ++ ++T 
Sbjct: 78  MLSKEDIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTA 137

Query: 126 VYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185
           +++V+ SLGE+A   PV   F+V+ +RF+ P+   +    Y   W +   LEL      I
Sbjct: 138 LFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITI 197

Query: 186 EFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245
            +W   +   AW++IF+ ++ + N+  VK +GE EF ++FIK++A++GF I  + + CG 
Sbjct: 198 RYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGG 257

Query: 246 GITGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 304
           G  G     +YW +PGA+            +F G  S  + AAF+Y G E++ ++A E+ 
Sbjct: 258 GPVGGYIGGKYWHDPGAF-----VGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESI 312

Query: 305 NPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFIIAIENS 362
           +PRK++P A K+  + I   Y  I   IG LVPY+DP+L   SS   V+SSP +IAIEN 
Sbjct: 313 DPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIENG 372

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G K LP + NA++L  ++S  NS VY  SR M  +A I   P   GR +  G P  A   
Sbjct: 373 GIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLV 432

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           T  FG ++++  S   A  F WL  ++G++  F W+ I+  HIRF +A+  +G S +++P
Sbjct: 433 TLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMP 492

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFS----GVDFAAAYVSVFLFIAIWLGAQ 538
           + ++   + ++Y    + ++++   +T+  P  S       F   Y+S+ + +A ++G +
Sbjct: 493 YLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHK 552

Query: 539 IWFRC-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
            +F+  R+F   +E+D+D+ +RDI+  +  +E
Sbjct: 553 FYFKNWRLFTPYNEIDLDSGKRDIDLELLREE 584

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  281 bits (720), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 163/511 (31%), Positives = 271/511 (53%), Gaps = 14/511 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           +KE  +H + + + L  RH                     L+  GP   +I +  ++T +
Sbjct: 77  IKE-DIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTAL 135

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           ++V+ SLGE+A   PV   F V+ +RF+ P+F  +    Y   W +   LEL      I 
Sbjct: 136 FTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIR 195

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC-GA 245
           +W   +   AW+ IF+ L+ ++NL  VK +GE EF ++ +K++A++GF I  + + C G 
Sbjct: 196 YWDDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGG 255

Query: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
              G +G +YW +PGA+       D    +F G  S  + AAF+Y G E++ ++A E+ N
Sbjct: 256 PKGGYIGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQN 310

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFIIAIENSG 363
           PRK++P A K+  + I   Y  I   +G LV YND +L   SS   V++SP +IAIEN G
Sbjct: 311 PRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGG 370

Query: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFT 423
            K LP + NA++L  I+S  NS VY  SR M  +A I   P      +  G P  A+F T
Sbjct: 371 IKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTT 430

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
             FG L+++  S      F WL  ++G++  F W+ I+  HIRF QA+  +  S D++P+
Sbjct: 431 LFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPY 490

Query: 484 KAKFMPWLAYYALFFMVVIILIQGFTAFAPT-FSGVD---FAAAYVSVFLFIAIWLGAQI 539
            ++   + +YY    + ++++   +T+  P    G D   F   Y+S  + IA ++G ++
Sbjct: 491 LSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKL 550

Query: 540 WFRC-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
           +F+  RI   L+E+D+ T R++++  +  +E
Sbjct: 551 YFKNWRIMTPLEEIDLLTGRKEVDIDILKEE 581

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  280 bits (716), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 172/500 (34%), Positives = 267/500 (53%), Gaps = 17/500 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +  VKRALK RH                     L+  GP+  L+ +  +  + +SV++S+
Sbjct: 46  QTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESI 105

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GEM T  P    FT  + RF S A  A  GY Y   +    A E + +  I++FW   VP
Sbjct: 106 GEMITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVP 165

Query: 194 MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPV-G 252
           +  +I IFW    +  L  V  +GE E+W+A++K++ LV + I+ +  + G     P  G
Sbjct: 166 LYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFG 225

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
           F YW +PGA   G          F G     +  +  Y GTE V + A E+ NP K+VP 
Sbjct: 226 FHYWNSPGALSHG----------FKGIAIVFVFCSTFYSGTESVALAATESKNPGKAVPL 275

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFN 372
           A+++ ++RILV Y  IAVF G  VP++DP L++S + V  SP  IAI  +G     H+ N
Sbjct: 276 AVRQTLWRILVVYIGIAVFYGATVPFDDPNLSAS-TKVLKSPIAIAISRAGWAGGAHLVN 334

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           A +L T ISA N ++Y+GSR +  LA   LAP     T+  GVP  A+   +A G ++ M
Sbjct: 335 AFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLM 394

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
            +S G A+A+++++N++GV  F  W +IS  H+R  +A   +G S ++LP++A F PW  
Sbjct: 395 NVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEALFYPWTP 454

Query: 493 YYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEV 552
             +L   + + LIQG++ F P F   +F  AY+ + + I +++G  + F+   F  +D  
Sbjct: 455 VLSLAANIFLALIQGWSYFVP-FDAGNFVDAYILLPVGILLYIGICV-FKSNHFRTVDLR 512

Query: 553 DIDTD---RRDIEAVVWDDE 569
            I+ D   R+D+EA + D E
Sbjct: 513 SINLDEGRRKDMEADLSDQE 532

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  281 bits (720), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 170/524 (32%), Positives = 280/524 (53%), Gaps = 24/524 (4%)

Query: 75  AEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLG 134
           A +KR +K RH                     L+  GP G  I Y  M + +YS++Q+ G
Sbjct: 100 ASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAG 159

Query: 135 EMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           E+A   P +T  F  + S  + PA   A+  +Y   W   F LE+      I++W T++ 
Sbjct: 160 ELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSIN 219

Query: 194 MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVG 252
              W  IF+V++   N+     Y E +F+    K++   GF I  + + CG AG +  +G
Sbjct: 220 PNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIG 279

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
            +YW +PGA+     + D    RF   VS+L+ AAF +  +E V +TA E ANPRK++P 
Sbjct: 280 GKYWNDPGAF-----NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPS 334

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHIF 371
           A K+V++RI+  Y    + +G LVPYN P+L  S  S V SSP++IA+ + G KV+P   
Sbjct: 335 AAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFI 394

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           NAV+L +++S GN + Y  SRI+  L++I  AP FF   +  G P +A+   +  G + +
Sbjct: 395 NAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICF 454

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
           +  S+   S F WL+ ++G++  FTW  I   H+RF +A++ +  S  +L F+++   W 
Sbjct: 455 VSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWG 514

Query: 492 AYYALFFMVVIILIQGFTAFAPTFSGVD------FAAAYVSVFLFIAIWLGAQIWFRC-R 544
           +YY +F M+++ + Q + A  P   G D      F A Y+++ +F+A++ G +IW +  R
Sbjct: 515 SYYGIFMMILVFIGQFWVALFPV-GGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWR 573

Query: 545 IFHRLDEVDIDTDRR--DIEAVVWDDEPPK------TLWDKFWN 580
           ++    E+D+ + R+  D E +  +DE  K      ++W K  N
Sbjct: 574 LYIPASEIDLISHRKIFDEEILKQEDEEYKIKMKHASIWVKLSN 617

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  281 bits (720), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 169/530 (31%), Positives = 281/530 (53%), Gaps = 23/530 (4%)

Query: 67  VKEGQVHEA--EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMAT 124
             +G  +E   ++K+ +K RH                     LS AGP   +I Y  M T
Sbjct: 108 TNKGHQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGT 167

Query: 125 LVYSVVQSLGEMAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQ 183
            +Y ++Q+ GE+A  +  +   F  + S  + PA G +  ++Y   W     LEL     
Sbjct: 168 CLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASM 227

Query: 184 IIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC 243
            I++WTT V    ++ IF+VL+   N F  + Y E EF+    KV+ + GF I  + +  
Sbjct: 228 TIKYWTTKVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITA 287

Query: 244 G-AGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 302
           G AG  G +G +YW +PGA+     + DK+  RF G + + + AAF +  TE + +TA E
Sbjct: 288 GGAGNDGYLGAKYWHDPGAF-----NGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAE 342

Query: 303 AANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIEN 361
            +NPRK++P A KKV++RI+  +      IG LVPYN D  L S  S + +SP++IA+ +
Sbjct: 343 QSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSS 402

Query: 362 SGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVF 421
            G +V+PH  NAV+L +++S GNS  Y  SR++  LA+   AP +F   +  G P+ A+ 
Sbjct: 403 HGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAML 462

Query: 422 FTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDL 481
            ++ FG +A+   S      F+WLL I+G++  FTW+ I   HIRF +A++ +G S  ++
Sbjct: 463 MSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEV 522

Query: 482 PFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV----DFAAAYVSVFLFIAIWLGA 537
            + ++   + + YA   + + ++ Q + A AP   G     +F   Y+++ + IA + G 
Sbjct: 523 GYLSQSGVYGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGY 582

Query: 538 QIWFRC-RIFHRLDEVDIDTDRR--DIEAVVWDDEPPKT------LWDKF 578
           ++W R  ++F R  ++D+DT R+  D   +  +DE  K       +W +F
Sbjct: 583 RVWKRDWKLFIRAKDIDLDTHRQIFDENILRQEDEEYKEKLRNGPMWRRF 632

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  280 bits (717), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 167/514 (32%), Positives = 262/514 (50%), Gaps = 26/514 (5%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G  H   +KR LK RH                     L++ GP+  +I +    T +  
Sbjct: 77  DGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVG 136

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            +  LGE+    PV  AF  +S+RFL P+       +Y   W     LE+      I++W
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYW 196

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
             ++    W+ IF+ ++   NLF  + +GE EF  + IKVI ++GFII C+ ++CG G  
Sbjct: 197 NQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPD 256

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
              VG RYW +PG    G          F G +S L+ A+++  GTE+V + +GE  NPR
Sbjct: 257 HDFVGARYWHDPGCLSHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-NPR 305

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           + +P AIK+  +RIL F+      IG LVPY +P L    S V++SPF+IAI+    K L
Sbjct: 306 E-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS-VNNSPFVIAIKLHHIKAL 363

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P I NAV+L +I+S GNS ++  SR +  +A   L P FFG  + AG P   +   S FG
Sbjct: 364 PSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFG 423

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++  S+     F+WL+ I G+A    W+ I+  HIRF  A+K +G S D+L F +  
Sbjct: 424 LLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAV 483

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVD-------FAAAYVSVFLFIAIWLGAQIW 540
             W + Y+     +I++ Q + A  P     D       F  +Y+   +   +++  +++
Sbjct: 484 GMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKVF 543

Query: 541 FRCRI-----FHRLDEVDIDTDRRDIEAVVWDDE 569
           +R +         LD++D++TDR++I+  V   E
Sbjct: 544 YRYKTGKWWAIMDLDKIDLETDRKNIDIDVLKQE 577

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  282 bits (721), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 170/514 (33%), Positives = 271/514 (52%), Gaps = 15/514 (2%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           E Q   A++K+ +K RH                   TPL+ AGP   +I Y  M T +Y 
Sbjct: 142 EQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYC 201

Query: 129 VVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           ++Q+ GE+A  +  V  +F  F S  + P F  A  ++Y   W     LEL      I++
Sbjct: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA-G 246
           WTT V    ++ IF+VL+ + N F  K Y E EF+    KV+ ++GF I  +C+  GA G
Sbjct: 262 WTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321

Query: 247 ITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
             G +G +YW +PGA+      + K E RF G + + + AAF +  TE + +TA E +NP
Sbjct: 322 TDGYIGAKYWNDPGAFR----GQTKIE-RFKGVMDTFVTAAFAFGATEFIALTAAEQSNP 376

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTK 365
           RK++P A KKV +RIL+ +    + IG LVPYN D  + SS    S+SP+++A    G  
Sbjct: 377 RKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVH 436

Query: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425
           V+ H  NAV+L +++S  NS  Y  SR++ GLA++  AP +F   +  G P  ++   + 
Sbjct: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAI 496

Query: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485
              +A+   S      F WLL I+G++  FTW  I   HIRF + ++ +G S  +L F+A
Sbjct: 497 IAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556

Query: 486 KFMPWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGAQIWF 541
           +     +YYA   + + ++ Q + A  P    T    +F   Y+++ + +A+++G ++W 
Sbjct: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616

Query: 542 RC-RIFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           R  R+F R   +D+ + R   D E +  +DE  K
Sbjct: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYK 650

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  282 bits (721), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 157/510 (30%), Positives = 275/510 (53%), Gaps = 13/510 (2%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
            E  +   ++ + L  RH                   + L+  GP   +I ++ ++T ++
Sbjct: 132 DEETLLATDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALF 191

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           +V+ SLGE+A   PV   F+V+  +F+ P+F  A    Y   W +   LEL      I +
Sbjct: 192 TVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRY 251

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           W +++   AW++IF+V + ++N+  VK +GE EF ++ +K++A++GF I  + + CG G 
Sbjct: 252 WNSSINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGP 311

Query: 248 TGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
           +   +G +YW +PGA+  G  S  K    F G  S  + AAF++ G E+  ++A E+ NP
Sbjct: 312 SHEYIGGKYWHDPGAF-VGTTSGSK----FKGLCSVFVTAAFSFSGIEMTAVSAAESRNP 366

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSGT 364
           R+++P+A K+  + I   Y  I   +G LVPYNDP+L +  S V  +SSP +IAIEN   
Sbjct: 367 RETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHI 426

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
             LP + NA++L  I+S  NS+VY  SR M  ++KI+  P  F + +  G P  A+ F  
Sbjct: 427 HGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVL 486

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
            FG L+++  S   A  F WL  ++G++  F W+ I+ CHIRF Q +  + IS D+LPF 
Sbjct: 487 FFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFL 546

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAPTFS----GVDFAAAYVSVFLFIAIWLGAQIW 540
           ++   W + Y +  + ++++   +T+  P  S       F   Y+S  + +  ++  +++
Sbjct: 547 SQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVY 606

Query: 541 FRC-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
           F+  R +    ++D+ + R+ ++  V  +E
Sbjct: 607 FKNWRWYIPASKMDLHSGRKQVDLEVVREE 636

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  280 bits (715), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 184/500 (36%), Positives = 273/500 (54%), Gaps = 19/500 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
            A +KR LK RH                     L+ AGP G LI +    T++Y +V ++
Sbjct: 73  NAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW-TTAV 192
           GE+A   PV   +T ++SRF+  +FG A   +Y   W IT  LE+      + +W T A 
Sbjct: 133 GELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAK 192

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
              A++ +F+V++   NLF VK YGE EF  +FIKVIA++GFII  + +VCG G  G   
Sbjct: 193 YRDAFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYI 252

Query: 253 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
             R W NPGA+  G          F G  S  + AAF++ G+ELVG+ A E ANPRKS+P
Sbjct: 253 GGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIP 302

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
            A K+V +RI +FY    + +GLLVPY   +L   S    ++SPF+I+I+N+G K LP +
Sbjct: 303 SAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSV 362

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N V+L  ++S GN  V+  SR M  LA     P  FG  +  G P   +  T  FG L+
Sbjct: 363 INVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLS 422

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S      F+WLL ++G++  FTW  I  CHIR  +AL  +  +  +L F A    W
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVW 482

Query: 491 LAYYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
            + Y+L  +++I++ Q + A  P     S   F  AY+S  ++I  ++G +IW +  ++F
Sbjct: 483 GSVYSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLF 542

Query: 547 HRLDEVDIDTDRR--DIEAV 564
            +  ++DID+ RR  DIEA+
Sbjct: 543 IKASDIDIDSGRRETDIEAL 562

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  280 bits (716), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 167/508 (32%), Positives = 270/508 (53%), Gaps = 16/508 (3%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
            +K+++K RH                  +  L  AGP   +I Y+ ++ + Y +VQ+ GE
Sbjct: 85  RLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGE 144

Query: 136 MATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPM 194
           M    P +   F  ++S F+S +FG A+ +++   W     LEL      I++W   +  
Sbjct: 145 MGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKINS 204

Query: 195 AAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVGF 253
             +I IF+V L   + F VK YGE EF  +  K++ + GFII  + + CG AG+ G +G 
Sbjct: 205 DVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGG 264

Query: 254 RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 313
           +YWR+PG++  G         RF G    L+ A F++ G EL  ++  E +NPRKS P A
Sbjct: 265 KYWRDPGSFAEG-----NGATRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVA 319

Query: 314 IKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVS-SSPFIIAIENSGTKVLPHIFN 372
            K+ V+RIL+ Y    + IG  VP+N+ +L  S S  + +SP+++A      +V+PHI N
Sbjct: 320 AKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVVPHIIN 379

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           AV+L ++IS  NS +Y   R+M  LA+   AP F    +  G P  A+F     G + ++
Sbjct: 380 AVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFV 439

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
             S     AF WL  I G++  FTW  I   HIRF +A+K +G S D++ +KA    W +
Sbjct: 440 ACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGS 499

Query: 493 YYALFFMVVIILIQGFTAFAPTFSGVD-----FAAAYVSVFLFIAIWLGAQIWFRCRIF- 546
           YY +FF +++ + Q + A +P  +G       F  +Y++  L++ ++LG  ++ R   F 
Sbjct: 500 YYGVFFNILVFMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLYERDFTFL 559

Query: 547 HRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           + LD++D+D  RR  D E +  ++E  K
Sbjct: 560 NPLDKIDLDYHRRVYDPEIIRQENEENK 587

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  281 bits (719), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 161/521 (30%), Positives = 272/521 (52%), Gaps = 18/521 (3%)

Query: 66  FVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATL 125
           F    +  +  +++ +K RH                   + L  AGP G +I Y  M + 
Sbjct: 120 FAPHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSC 179

Query: 126 VYSVVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQI 184
           +Y ++Q+ GEMA  +  +   F  + S  +  AFG +  ++Y   W     LEL      
Sbjct: 180 LYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMT 239

Query: 185 IEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VC 243
           I++WTT V    ++ IF+VL+   N+F  K Y E EF+    KV+ + GF I  + +   
Sbjct: 240 IQYWTTTVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTG 299

Query: 244 GAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303
           GAG  G +G +YW NPGA+       DK+  RF   +S+   AAF +  +E + I A E 
Sbjct: 300 GAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQ 354

Query: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVS-SSPFIIAIENS 362
           +NPR+++P A K +++RIL  +      +G LVPYN  +L  S S  + +SP++IA+ + 
Sbjct: 355 SNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASH 414

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422
           G +V+PH  NAV+L +++S  NS  Y   RI+Y L++   APS+F   +  G P  A+  
Sbjct: 415 GVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIM 474

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           ++ F  +A+   S+     F WLL I+G++  FTW+ I   HIRF +A+K +G S D++ 
Sbjct: 475 SALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIG 534

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAFAPT----FSGVDFAAAYVSVFLFIAIWLGAQ 538
           FK++   W + YA   M + ++ + + + AP         +F   Y+++ + I ++ G +
Sbjct: 535 FKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYK 594

Query: 539 IWFRC-RIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKF 578
           I  R  ++F R  ++D+ + R+     ++D E  K   ++F
Sbjct: 595 ICKRDWKLFIRAKDIDLVSHRK-----IYDGELIKQEEEEF 630

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  282 bits (721), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 169/513 (32%), Positives = 267/513 (52%), Gaps = 18/513 (3%)

Query: 70  GQVHE---AEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           GQ  E   AE+++ +K RH                  + PL+ AGP   +I Y  M T +
Sbjct: 149 GQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCI 208

Query: 127 YSVVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185
           Y ++Q+ GEMA  +  +T +F  F S  + P F  A  ++Y   W     LEL      I
Sbjct: 209 YCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTI 268

Query: 186 EFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245
           ++WTT V    ++ IF+VL+ + N F  K Y E EF     KV+ + GF I  +C+  GA
Sbjct: 269 QYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGA 328

Query: 246 -GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 304
            G  G +G +YW +PGA+      + K E RF G + + + AAF +  TE + +TA E +
Sbjct: 329 AGTDGYIGAKYWNDPGAFR----GQTKIE-RFKGVMDTFVTAAFAFGATEFIALTAAEQS 383

Query: 305 NPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSG 363
           NPRK++P A KK+++R+LV +    + IG LVPY+ D  L S  S   +SP+++AI   G
Sbjct: 384 NPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHG 443

Query: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFT 423
            +V  H  NAV+L ++IS GNS  Y  SR++  LA+   AP  F   +  G P  A+  +
Sbjct: 444 VRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCS 503

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
           +    +A+   S      F WL+ I G++  FTW  I   H+RF +A+K +G S  ++ +
Sbjct: 504 AVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGY 563

Query: 484 KAKFMPWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGAQI 539
            ++     + YA   M++ ++ Q + A  P    T     F + Y+++ + I  + G +I
Sbjct: 564 LSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKI 623

Query: 540 WFRC-RIFHRLDEVDIDTDRR--DIEAVVWDDE 569
           W R  R+F R  ++D+ + R   D E +  +DE
Sbjct: 624 WKRDWRLFIRAKDIDLISHRTIYDEELLRQEDE 656

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  280 bits (715), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 169/508 (33%), Positives = 267/508 (52%), Gaps = 16/508 (3%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
            +K+++K RH                  +  L  AGP   +I Y+ ++ + Y +VQ+ GE
Sbjct: 85  HLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAAGE 144

Query: 136 MATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPM 194
           M    P +   F  ++S F+S +FG A+ +++   W     LEL      I++W   +  
Sbjct: 145 MGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDTINA 204

Query: 195 AAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVGF 253
             +I IF+V L   + F VK YGE EF     K++ + GFII  + + CG AG+ G +G 
Sbjct: 205 DVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDGYIGG 264

Query: 254 RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 313
            YWRNPG++  G      +  RF G    L+ A F++ G EL  ++  E ANPRKS P A
Sbjct: 265 EYWRNPGSFADG-----SSATRFKGICFILVTAYFSFGGIELFVLSINEQANPRKSTPVA 319

Query: 314 IKKVVFRILVFYYPIAVFIGLLVPY-NDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFN 372
            K+ ++RIL+ Y    + IG  VP+ ND  + S  S   +SP+++A    G KV+PHI N
Sbjct: 320 AKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATHASPYVLAASIHGVKVIPHIIN 379

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           AV+L ++IS  NS +Y   R+M  LA+   AP F    +  G P  A+   S  G + ++
Sbjct: 380 AVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSFVGLVGFV 439

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
             S+    AF WL  I G++  FTW  I   HIRF +A+K +G S D++ +K+    W +
Sbjct: 440 ACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGS 499

Query: 493 YYALFFMVVIILIQGFTAFAPTFSG-----VDFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
           YY + F +++ + Q + A +P  S        F  +Y++  L+I ++LG  I+ +   + 
Sbjct: 500 YYGVIFNILVFMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLGYMIYNKDFTLL 559

Query: 547 HRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           + LD++D+D  RR  D E +  +DE  K
Sbjct: 560 NPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  280 bits (715), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 170/510 (33%), Positives = 265/510 (51%), Gaps = 16/510 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           ++++K+++K RH                  +  L   GP   +I Y+ ++ + Y ++Q+ 
Sbjct: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAA 147

Query: 134 GEMATFIPVTSA-FTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           GEMA   P   A F  +SS F+S  FG A+ ++Y F W     LEL      I+FW   +
Sbjct: 148 GEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDKI 207

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPV 251
               +I IF+V L   + F VK YGE EF     K++ + GFI+  + + CG AG  G +
Sbjct: 208 NPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYI 267

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           G  YW  PGA+     + D +  RF      L+ A F++ G EL  ++  E  NPRKS P
Sbjct: 268 GGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTP 322

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
            A K+ ++RI+V Y    + IG  VPYND +L  +  S   +SP+++A    G +++PHI
Sbjct: 323 VAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIHGVRIVPHI 382

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            NAV+L +++S  NS++Y G R++  LA+   AP F    +  G P  A+      G +A
Sbjct: 383 INAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVIA 442

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S+     F WL  I G++  FTW  I   H+RF QA+K +G S ++L +KA    W
Sbjct: 443 FVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGIW 502

Query: 491 LAYYALFFMVVIILIQGFTAFAPTFSGVDF-AAAYVSVFLFIAIWL----GAQIWFRC-R 544
            + Y  FF +++ + Q + A AP  +G    A A+   +L   IWL    G  I+ R   
Sbjct: 503 GSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIYNRDFT 562

Query: 545 IFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           + + LD++D+D  RR  D E +  +DE  K
Sbjct: 563 LLNPLDKIDLDFHRRVYDPELMRQEDEENK 592

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  279 bits (714), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 181/509 (35%), Positives = 282/509 (55%), Gaps = 18/509 (3%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
           +   + ++  LK RH                     L  AGP G LI +    T+++++V
Sbjct: 82  KTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMV 141

Query: 131 QSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
            +LGE+A   PV+  F  +++RF+  +FG A+ + Y F W +   LE+      +++W T
Sbjct: 142 MALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWET 201

Query: 191 AVPMA-AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITG 249
            V     ++ +FW+++ + N+F V+ YGE EF  + IKVIA++GFII  + +VCG G  G
Sbjct: 202 PVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVG 261

Query: 250 PVGF-RYWRNPGAWG---PGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
                RYW +PGA+    PG         RF G+ S  + AAF++ G+ELVGI + E+ N
Sbjct: 262 GYVGGRYWHDPGAFAGHSPG--------RRFKGFCSVFVTAAFSFAGSELVGIASAESKN 313

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGT 364
           PRKSVP+A K+V +RIL+FY    + +GLLVPY DP+L  SS    S+SPF+IAI   G 
Sbjct: 314 PRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGI 373

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
             LP + N V+L +++S GNS++Y  SR +  L++    P      +  G P   +   S
Sbjct: 374 SGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICS 433

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
            FG +A++  S      FNWLL I+G++ F TW  I  CHIRF  ALK  G S D+LPFK
Sbjct: 434 GFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFK 493

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAPTFS---GVDFAAAYVSVFLFIAIWLGAQIWF 541
           +      +Y+ +   V++++ Q + A  P  S     DF +AY++  + +A ++  ++W 
Sbjct: 494 SPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWK 553

Query: 542 RC-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
           R  ++   L ++DIDT RR+ +  +   E
Sbjct: 554 RNWKLLIPLKDIDIDTGRRETDINLLKQE 582

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  279 bits (714), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 168/508 (33%), Positives = 270/508 (53%), Gaps = 16/508 (3%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
            +K+++K RH                  +  LS AGP   +I Y+ ++ + Y +VQ+ GE
Sbjct: 85  HLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGE 144

Query: 136 MATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPM 194
           M    P +   F  ++S F+S +FG A+ +++   W     LEL      +++W   +  
Sbjct: 145 MGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINA 204

Query: 195 AAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVGF 253
             +I IF+V L   + F VK YGE EF     K++ + GFII  + + CG AG+ G +G 
Sbjct: 205 DVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGG 264

Query: 254 RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 313
           +YWR+PG++  G         RF G    L++A F++ G EL  ++  E +NPRKS P A
Sbjct: 265 KYWRDPGSFAEG-----SGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVA 319

Query: 314 IKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHIFN 372
            K+ V+RIL+ Y    + IG  VP+N+ +L  S  S   +SP+++A      +V+PHI N
Sbjct: 320 AKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIIN 379

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           AV+L ++IS  NS +Y   R+M  LA+   AP F    +  G P  A+   S  G + ++
Sbjct: 380 AVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFV 439

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
             S     AF WL  I G++  FTW  I   HIRF +A+K +G S D++ +KA    W +
Sbjct: 440 ACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGS 499

Query: 493 YYALFFMVVIILIQGFTAFAPTFSGVD-----FAAAYVSVFLFIAIWLGAQIWFRCRIF- 546
           YY +FF +++ + Q + A +P  +G       F  +Y++  L+I +++G  ++ R   F 
Sbjct: 500 YYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFL 559

Query: 547 HRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           + LD++D+D  RR  D E +  +DE  K
Sbjct: 560 NPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  278 bits (711), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 160/493 (32%), Positives = 267/493 (54%), Gaps = 13/493 (2%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
            + + L  RH                   T L+  GP   +I ++ +++ +++V+ +LGE
Sbjct: 77  NLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGE 136

Query: 136 MATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMA 195
           +A   P+   F V+ +RF+ P+F  A    Y   W ++  LEL      I +W   +   
Sbjct: 137 LAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREINSD 196

Query: 196 AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VCGAGITGPVGFR 254
           AW+TIF+V + + N+  VK++ E EF ++ IK++A+VGF I  + + V G    G +G +
Sbjct: 197 AWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGK 256

Query: 255 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 314
           YW +PGA+       D    RF G  S  + AAF+Y G E+  ++A E+ NPRK++P+A 
Sbjct: 257 YWNDPGAF-----HGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKAT 311

Query: 315 KKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSGTKVLPHIFN 372
           K+  + I   Y  I   IG+LVPYND +L S  S V  S+SP +IAIEN+G K LP + N
Sbjct: 312 KRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMN 371

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           A++L  ++S  NS VYV SR+M  +A     P  F + +  G P +++F T   G L+++
Sbjct: 372 AIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFI 431

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
             S      F WL  I G++  F W+ I+  HIRF  ALK++  S D+L + ++   W +
Sbjct: 432 AASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGS 491

Query: 493 YYALFFMVVIILIQGFTAFAPT-FSGVD---FAAAYVSVFLFIAIWLGAQIWFRC-RIFH 547
           +Y +  +V++++   + +  P   S  D   F   Y+S  + IA ++G +++ +  +   
Sbjct: 492 WYGVIILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVI 551

Query: 548 RLDEVDIDTDRRD 560
            L+E+DID  +++
Sbjct: 552 PLEEIDIDLGKKN 564

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  277 bits (709), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 170/499 (34%), Positives = 261/499 (52%), Gaps = 21/499 (4%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           VKRALK RH                     L+  GP+  L+ +  +  + ++V++S+GE+
Sbjct: 49  VKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESIGEI 108

Query: 137 ATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMAA 196
            T  P    FT  + RF   A  A  GY Y   +    A E + +  I++FW   VP+  
Sbjct: 109 ITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYG 168

Query: 197 WITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPV-GFRY 255
           +I IFW    +  L  V  +GE E+W+++ K++ LV + I+ +  + G     P  GF Y
Sbjct: 169 YILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFGFHY 228

Query: 256 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 315
           W +PG+   G          F G     +  +  Y GTE V + A E+ NP K+VP A++
Sbjct: 229 WNSPGSLSHG----------FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAVPLAVR 278

Query: 316 KVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFNAVV 375
           + ++R+L+ Y  IAVF G  VP++DP L S+ + V  SP  IAI  +G     H+ NA +
Sbjct: 279 QTLWRVLIVYIGIAVFYGATVPFDDPNL-SATTKVLKSPISIAISRAGWAGGAHLVNAFI 337

Query: 376 LTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYMELS 435
           L T ISA N ++Y+GSR +  LA   LAP     T+  GVP  A+   +A G ++ M +S
Sbjct: 338 LVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVS 397

Query: 436 TGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAYYA 495
            G + A+++++N++GV  F  W +IS  H+R  +A   +G S ++LP+KA   PW   ++
Sbjct: 398 VGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTPIFS 457

Query: 496 LFFMVVIILIQGFTAFAPTFSGVDFAAAY----VSVFLFIAIWLGAQIWFRCRIFHRLDE 551
           L   V + LIQG+T+F P F   +F  AY    V++ L++AI +     FR      L  
Sbjct: 458 LIANVFLALIQGWTSFVP-FDAGNFVDAYILLPVAIVLYVAICVFKNHHFRIV---DLKS 513

Query: 552 VDIDTDRR-DIEAVVWDDE 569
           VD+D  RR DI+A   D E
Sbjct: 514 VDLDEGRRKDIDADFSDQE 532

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  277 bits (709), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 163/507 (32%), Positives = 267/507 (52%), Gaps = 24/507 (4%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
            +++K+ +K RH                   T L+ AGP G +I Y   + ++Y ++Q+ 
Sbjct: 61  SSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAA 120

Query: 134 GEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           GE+   +  +T  +T +SS  + PA G +  ++Y   W   F L+L      I++WT   
Sbjct: 121 GELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWTDTN 180

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPV 251
           P   ++ I + L+   NLF  K Y E EF     KV+ +VGF+I  + + CG AG  G +
Sbjct: 181 P-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYI 239

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           G RYW  PGA+  G          F G       AAF Y G E++ +TA E  NPRKS+P
Sbjct: 240 GARYWHTPGAFSTG----------FKGVCYVFCYAAFAYGGIEVMVLTASEQENPRKSIP 289

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIF 371
            A KKV++RIL+ Y    + +  LVPY+ P+L S+ S   +SPF+IAI + G  V+PHI 
Sbjct: 290 SACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRASPFVIAIASHGISVVPHII 349

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           NAV+L  ++S GNS++Y   R++  L++   AP  F   +  G P          G LA+
Sbjct: 350 NAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLLAF 409

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
           +  S      F+WLL I+G++  F W+ I   H+RF  A+K +G S  ++ +K++   W 
Sbjct: 410 IAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTGYWG 469

Query: 492 AYYALFFMVVIILIQGFTAFAP-----TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC-RI 545
           +++A+   + +++ Q + A AP       S  DF  +Y++  + I I+ G +I+++  R+
Sbjct: 470 SWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYKDWRL 529

Query: 546 FHRLDEVDIDTDRRDIEAVVWDDEPPK 572
                EVD+++ R+     ++D++  K
Sbjct: 530 CIPATEVDLNSHRK-----IFDEDELK 551

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  276 bits (707), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 162/526 (30%), Positives = 278/526 (52%), Gaps = 21/526 (3%)

Query: 72  VHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQ 131
           ++   + + L  RH                   T LS+ GP   ++ ++ ++T +++V+ 
Sbjct: 38  LNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVIN 97

Query: 132 SLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTA 191
           SLGE+A   P+   F V+ +RF+ P+ G A    Y   W +   LEL      I++W   
Sbjct: 98  SLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 192 VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPV 251
           +   AW+ IF+V + ++N+  VK +GE EF ++ +K++A++GF I  + +  G G +G  
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 252 G-FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 310
             F+YW NPGA+  G      N  +F G  S  + AAF++ G E++ ++A E+ NPRK +
Sbjct: 218 LGFKYWNNPGAFVGG-----TNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVI 272

Query: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSGTKVLP 368
           P+A K+  + +   Y  I   +G LVPYND +L ++ + V  ++SP +IAIEN G K LP
Sbjct: 273 PKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLP 332

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
            + NA++L  I+S  NS VY  SR M  +A I   P    + +  G P  A+  T  FG 
Sbjct: 333 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGL 392

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           L+++  S      F WL  ++G++  F W+ I+   IRF +A++ +  S D+LP+ ++  
Sbjct: 393 LSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTG 452

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWL----GAQIWF--R 542
            W A+Y +  + ++I+   +T+  P  S    A ++   FL + I L    G +++F   
Sbjct: 453 IWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARN 512

Query: 543 CRIFHRLDEVDIDTDRR--DIEAVVWDDEPPKTLWD-----KFWNI 581
            R+    +E+DID+ R+  D E +  + E  +   +     KFW++
Sbjct: 513 WRLQIGAEEMDIDSGRKIIDEEGLKQEREEEEKAMNSSFLIKFWHV 558

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  277 bits (709), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 169/509 (33%), Positives = 266/509 (52%), Gaps = 16/509 (3%)

Query: 75  AEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLG 134
           + +K+A+K RH                  ++ LS  GP   +I Y+ ++ + Y ++Q+ G
Sbjct: 73  SHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAG 132

Query: 135 EMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           EMA   P +   F  ++S F+S  FG A+ ++++  W   F LEL      I++W   + 
Sbjct: 133 EMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKIN 192

Query: 194 MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVG 252
              +I IF+V L   + F VK YGE EF     KV+ + GFII  + + CG AG  G +G
Sbjct: 193 ADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIG 252

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
            +YWR+PG++  G    D  E +F G    L+ A F+Y G EL  ++  E  NPRKS P+
Sbjct: 253 AKYWRDPGSFAEG----DSVE-KFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQ 307

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHIF 371
           A K+ ++RIL+ Y    + IG  VP+N+ +L  S  S   +SP+++A    G KV+PH  
Sbjct: 308 AAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFI 367

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           NAV+L ++IS  NS +Y   R+M  LA+   AP F    +  G P  A+   + FG + +
Sbjct: 368 NAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGF 427

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
           +  S+     F WL  I G++  FTW  I   H+RF Q +K  G S +++ F+A    W 
Sbjct: 428 VSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWG 487

Query: 492 AYYALFFMVVIILIQGFTAFA-PTFSGVDFAAAYVSVFLFIAIWL----GAQIWFRCRIF 546
           + Y + F +++ + Q + A A P+  G   A ++   +L   IWL    G  ++ R   F
Sbjct: 488 SMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRDFTF 547

Query: 547 H-RLDEVDIDTDRR--DIEAVVWDDEPPK 572
              LD++D++  RR  D E +  +DE  K
Sbjct: 548 LVPLDKIDLNFHRRIYDPELIRQEDEENK 576

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  277 bits (708), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 168/511 (32%), Positives = 275/511 (53%), Gaps = 13/511 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           +KE      ++ + L  RH                     LS+ GP   +I ++ ++T +
Sbjct: 86  MKEDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCL 145

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           ++VV SLGE+A   PV   F V+ +RF+ P+FG A    Y   W +   LEL      I 
Sbjct: 146 FTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIR 205

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
           +W   +   AW+ IF+  +  +N+  VK +GE EF ++ IK++A+VGF I  + + CG G
Sbjct: 206 YWNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGG 265

Query: 247 ITGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
             G     +YW +PGA+       + +  +F G  S  + AAF+Y G EL  ++A E+ N
Sbjct: 266 PKGGYIGGKYWHDPGAF-----VGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAESLN 320

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIENSG 363
           PR+++P+A K+  + I + Y  I   IG LVPYN+PKL +  S V  +SSP +IAIEN G
Sbjct: 321 PRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIENGG 380

Query: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFT 423
            + LP + NA++L  I+S  NS VY  SR M  +A+I+  P F GR +  G P  A   T
Sbjct: 381 IRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLT 440

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
             FG L+++  S      F WL  ++G++  F W+ I+  HIRF QA+ ++GIS D+LP+
Sbjct: 441 LFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPY 500

Query: 484 KAKFMPWLAYYALFFMVVIILIQGFTAFAPT-FSGVD---FAAAYVSVFLFIAIWLGAQI 539
            +      ++Y +  + ++++   +T+  P    G D   F   Y+S  + I  ++G ++
Sbjct: 501 ISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKL 560

Query: 540 WFR-CRIFHRLDEVDIDTDRRDIEAVVWDDE 569
           + R  R+   + ++D+ +DR+ ++  V  +E
Sbjct: 561 YIRKKRLLIDVADMDLVSDRKVVDVEVCREE 591

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  275 bits (702), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 169/514 (32%), Positives = 265/514 (51%), Gaps = 20/514 (3%)

Query: 72  VHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQ 131
           V +  +K+A+K RH                  +  L  +GP   +I Y+ ++ + Y ++Q
Sbjct: 48  VTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQ 107

Query: 132 SLGEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
           + GEMA   P +  +F  ++S F+S  FG A+ ++++  W   F LEL      +++W  
Sbjct: 108 AAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWND 167

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITG 249
            +    +I IF+  L   + F VK YGE EF     KV+ + GFII  + + CG AG  G
Sbjct: 168 KINADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDG 227

Query: 250 PVGFRYWRNPGAW--GPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
            +G +YW +PG++  GP I        RF G    L++A F+Y G EL  ++  E  NPR
Sbjct: 228 YIGAKYWHDPGSFADGPPIT-------RFKGVCFILVSAYFSYGGAELFSLSVNEQENPR 280

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTKV 366
           KS P A K+ ++RIL+ Y    + IG  VP+N D  + +  +   +SP+++A      KV
Sbjct: 281 KSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKV 340

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           +PH  NAV+L ++IS  NS +Y   R+M  LA+   AP F    +  G P   +   + F
Sbjct: 341 VPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALF 400

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           G + ++  S+     F WL  I G++  FTW  I   HIRF QA+K+ G S D++ FKA 
Sbjct: 401 GVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAV 460

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDF-AAAYVSVFLFIAIWL----GAQIWF 541
              W +YY   F +++ + Q + A +P  SG    A A+   +L   IWL    G  I+ 
Sbjct: 461 TGIWGSYYGCAFNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYK 520

Query: 542 RC-RIFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           R   I + L+++D+D  RR  D + +  +DE  K
Sbjct: 521 RDFTILNPLEKIDLDFHRRIYDPDFIKQEDEENK 554

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  276 bits (706), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 165/508 (32%), Positives = 273/508 (53%), Gaps = 15/508 (2%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           V +   + +++ + L  RH                     L+  GP   LIA+  ++T +
Sbjct: 99  VCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCL 158

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           +++V SLGE+A+  PV   F V+ +RF+ P+FG A    Y   WA+   LEL+     I+
Sbjct: 159 FTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIK 218

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
           +W   +   AW+ IF+V + ++N+  VK +GE EF ++ +K++A+ GF I    ++CG G
Sbjct: 219 YWNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGG 278

Query: 247 ITGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
             G     +YW +PGA+       D    +F G  S  + AAF+Y GTELVG++A E+ N
Sbjct: 279 PVGGFIGAKYWHDPGAF-----VGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESIN 333

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFIIAIENSG 363
           PR ++PRA K+  + I   Y  +    G LVP NDP+L    S   V++SP +IAIEN G
Sbjct: 334 PRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGG 393

Query: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFT 423
            + +P + NA++L  IIS  NS+VY  SR M  +A++   P  F   +  G P  A+  T
Sbjct: 394 IRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILAT 453

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
             FG L+++  S    + F WL  ++G++  F W  I+  HIRF +A+  +  S D+LP+
Sbjct: 454 LVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPY 513

Query: 484 KAKFMPWLAYYALFFMVVIILIQGFTA-FAPTFSG---VDFAAAYVSVFLFIAIWLGAQI 539
            +      ++Y    ++ ++++  +T+ F P  SG     F   Y+S  +F+  ++  ++
Sbjct: 514 LSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISHKL 573

Query: 540 WFRC-RIFHRLDEVDIDTDRR--DIEAV 564
           + R  R+F    ++D+D+ RR  DIE +
Sbjct: 574 YKRDWRLFIPAGQIDVDSGRRALDIEEL 601

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  275 bits (703), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 165/508 (32%), Positives = 263/508 (51%), Gaps = 14/508 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +  +K+A+K RH                  +  L   GP   +I Y  ++ + Y ++Q+ 
Sbjct: 88  DTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAA 147

Query: 134 GEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           GEMA   P +   F  ++S F+S  FG A+ +++   W     LEL     II++WT  V
Sbjct: 148 GEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWTEKV 207

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPV 251
               ++ IF+V L   +   VK YGE EF     K++ + GFII+ + + CG AG  G +
Sbjct: 208 NADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYI 267

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           G +YW +PGA+     +      RF G    L++  F+Y GTEL  ++  E  NPRKS P
Sbjct: 268 GGKYWHSPGAF-----AGTNAAERFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKSTP 322

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
            A K+ ++RILV Y    + IG  VP+ND +L  +  S   +SP+++A    G +V+PHI
Sbjct: 323 IAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHASPYVLAASIHGVRVVPHI 382

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            NAV+L  +IS  NS++Y   R++  LA+   AP F    +  G P +A+   + FG +A
Sbjct: 383 INAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFGVIA 442

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           +   S      F WL  I G++  FTW  I   H+RF QA+K +G   +++ + A    W
Sbjct: 443 FSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTGYW 502

Query: 491 LAYYALFFMVVIILIQGFTAFAPTFSGV---DFAAAYVSVFLFIAIWLGAQIWFRCRIF- 546
            + Y + F +++ + Q + A AP  S +    F  +Y++  ++IA + G  IW +   F 
Sbjct: 503 GSVYGVVFNILVFIAQFWVALAPPKSPITAQSFFESYLAFPIWIAFYFGYMIWNKDYTFL 562

Query: 547 HRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           + LD++D+D  RR  D E +  +D   K
Sbjct: 563 NPLDKIDLDHHRRIYDPEVLKQEDMENK 590

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  274 bits (701), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 166/516 (32%), Positives = 266/516 (51%), Gaps = 19/516 (3%)

Query: 67  VKEGQV---HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMA 123
           +++G+V   H  ++K+ +K RH                  ++ L   GP G LI Y F++
Sbjct: 58  LEDGEVTSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVS 117

Query: 124 TLVYSVVQSLGEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVG 182
            + Y ++Q+ GEMA   P +   F  +SS F+S  FG A+ +++   W     LEL    
Sbjct: 118 IISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSS 177

Query: 183 QIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMV 242
            ++++WTT +    ++ IF++ +   +    + YGE EF     KV+ + GFII  + + 
Sbjct: 178 IVVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILIN 237

Query: 243 CGA-GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAG 301
           CGA G  G +G +YW  PGA+  G         RF G    L+ A F+Y G EL  ++  
Sbjct: 238 CGAVGDDGYIGGKYWHEPGAFAAG-----SGIDRFKGIAYVLVTAYFSYGGMELYALSVN 292

Query: 302 EAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIE 360
           E  NPRK++P A  K V+RIL+ Y    V IG LVP++  KL  S  S V  SP+++A+ 
Sbjct: 293 ELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALS 352

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
             G K++PHI NAV+L ++IS GNS +Y G R++  LA+   AP      +  G P  A+
Sbjct: 353 LHGIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMAL 412

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
              S FG +A++  S      F WL  I+G++  FTW  I   H RF +A+K +G S + 
Sbjct: 413 IICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLET 472

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYV-SVFLFIAIWLGAQI 539
           L +++    W + YA+ F V +++ Q + A  P  +G  F+   +    L + +WL   +
Sbjct: 473 LGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSCLALPLWLSMAV 532

Query: 540 WFRC-----RIFHRLDEVDIDTDRR--DIEAVVWDD 568
            +        I + L  + +D+ RR  D+E +  +D
Sbjct: 533 GYMIVTKNWTILNPLSSISVDSHRRSYDVEVMKQED 568

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  274 bits (700), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 162/510 (31%), Positives = 268/510 (52%), Gaps = 16/510 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +  +K  +K RH                     L   GP G +I Y+  +T++Y VVQ+ 
Sbjct: 65  QQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQAC 124

Query: 134 GEMAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
            E+   +  +   +  + +  +   FG A   +Y   WA    LEL      +++WT++V
Sbjct: 125 CELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSV 184

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
               ++ IF+V L   + F  + Y E EF    +KV+ + GFII  + +  GA   G +G
Sbjct: 185 NPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIG 244

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
            +YW +PGA+G      D+   RF G  S  + AAF Y G+E + +TA E ANPR+SVP+
Sbjct: 245 GQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPK 299

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSD--SYVSSSPFIIAIENSGTKVLPHI 370
           A K+ ++R++V +    + IG LVP+N  +L S++  S   +SPF+IA    G +V+PHI
Sbjct: 300 ATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHI 359

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            N ++LT++IS GNS +Y   RI+  LA+  + P  F   +  G P   + F S FG +A
Sbjct: 360 INFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIA 419

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S    + F WL  I G++  FTW  I+  H+RF +A++ +G S  +L ++A     
Sbjct: 420 FVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGAL 479

Query: 491 LAYYALFFMVVIILIQGFTAFA--PTFSGVD---FAAAYVSVFLFIAIWLGAQIWFRC-R 544
            +YYA+FF V++++ Q + A A  P    +D   F   Y++  + +  +LG ++W R  R
Sbjct: 480 GSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFR 539

Query: 545 IFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           +     EVD+ + R+  D E ++ ++   K
Sbjct: 540 LVIPSSEVDLLSHRQIFDEEVLLQEEAERK 569

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  273 bits (698), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 164/501 (32%), Positives = 256/501 (51%), Gaps = 13/501 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           ++ VKR LK RH                     L+  GP+  L+ +  +  L + +++S+
Sbjct: 53  DSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESI 112

Query: 134 GEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           GEM T  P    FT  + RF S A  A  GY Y   +    A E + +  I++FW   VP
Sbjct: 113 GEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVP 172

Query: 194 MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPV-G 252
           +  +I IFW    V  L  V  +GE E+W+A+ K++ L+ + I+ +  + G     P  G
Sbjct: 173 LYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFG 232

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
           F+YW +PGA   G          F G  +  +  +  Y GTE V + A E+ NPR++VP 
Sbjct: 233 FQYWNDPGALSNG----------FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPI 282

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFN 372
           AI++  +RIL+ Y  I++F G+ VPYND  LN + + V  SP  IAI  +G     H+ N
Sbjct: 283 AIRQTFWRILIVYLGISIFYGVTVPYNDENLNFA-TKVLKSPIAIAISRAGWPAGVHLVN 341

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           A +L T ISA N ++Y+GSR +  LA   LAP     T+  GVP  A+   +A G ++ M
Sbjct: 342 AFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLM 401

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
            +S     A+N+++N++GV  F  W +IS  H+RF +A K +G +RD+LP+KAK  P   
Sbjct: 402 NVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFP 461

Query: 493 YYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEV 552
             ++   + + L+QG++ F P F   +F  AY+ +   I ++LG   W        +D  
Sbjct: 462 IVSIIANIFLGLVQGWSYFKP-FDAKNFVDAYILIPAGIILYLGVSYWKTKGFLTAVDLS 520

Query: 553 DIDTDRRDIEAVVWDDEPPKT 573
           +++         +  D P  T
Sbjct: 521 EVNLLFGQRLPTISQDMPSST 541

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  275 bits (702), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 165/512 (32%), Positives = 267/512 (52%), Gaps = 21/512 (4%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           K    H+ E K+ +K RH                     LS AGP   +IAY  ++ + Y
Sbjct: 85  KTTTAHQ-EQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTY 143

Query: 128 SVVQSLGEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
            ++Q+ GEMA   P +  +F  ++S F+S  FG A+ +++   W     LEL      I+
Sbjct: 144 FMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIK 203

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-A 245
           +W T++    ++ IF+V L   + F V+ YGE EF     K++ + GFII+ + + CG A
Sbjct: 204 YWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGA 263

Query: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
           G  G +G +YW +PGA+     +      RF G   +L+NA F+Y G EL  ++  +  N
Sbjct: 264 GKDGYIGGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKN 318

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFIIAIENSG 363
           PRKS P A K  V+RI+V Y    + IG +VP+N  +L   S  + + +SP+++A    G
Sbjct: 319 PRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHG 378

Query: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFT 423
            KV+PHI NAV+L  +IS  NS++Y G R++  LA+   AP F    +  G P  A+  +
Sbjct: 379 IKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLS 438

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
           +  G + +   S      F WL  I+G++  FTW  I   HIRF +A+K +  S D L +
Sbjct: 439 ALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGY 498

Query: 484 KAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSG-----VDFAAAYVSVFLFIAIWLGAQ 538
           KA    W +Y+ + F +++   Q + A +P  SG       F A+Y+++ +++  + G  
Sbjct: 499 KANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYM 558

Query: 539 IWFRC-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
            W++   +   L++VD+D  R+     V+D E
Sbjct: 559 CWYKDFTVLTDLNQVDLDNHRK-----VYDPE 585

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  275 bits (702), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 165/504 (32%), Positives = 271/504 (53%), Gaps = 18/504 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           E  +K+ +K RH                   + L  AGP G +  Y  M T VY ++QS 
Sbjct: 107 EDNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSA 166

Query: 134 GEMAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           GEMA  +  +   F  + +  + P F         F+     +  +       ++WTT V
Sbjct: 167 GEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTRV 226

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VCGAGITGPV 251
               ++ IF+VL+ V N+F  + Y E EF+    KV+ + GF I  + + V GAG  G +
Sbjct: 227 DPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYL 286

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           G  YWRNPGA+       DK    F G V++L+ AAF + GTE + +TA E +NPRK++P
Sbjct: 287 GNIYWRNPGAF-----RGDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIP 341

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPHI 370
            A KKV++RI++ Y    + IG LVP+  P+L  S  +  ++SP++IA+ + G +V+PH 
Sbjct: 342 SAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAASPYVIAVASHGVRVVPHF 401

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            NAV+L +++S GNS  Y  SR++  L+K   AP +F   +  G P  A+  ++ FG +A
Sbjct: 402 INAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIA 461

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           +   S      F WLL I+G++  FTW+ I   HIRF  A+K +G S  ++ FKA+   W
Sbjct: 462 FCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIW 521

Query: 491 LAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC-RI 545
            +YY++F M++ ++ Q + A AP      S  +F   Y+++ + I  + G +IW +   +
Sbjct: 522 GSYYSIFLMILTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWKKDWTL 581

Query: 546 FHRLDEVDIDTDRRDIEAVVWDDE 569
           + + +++D+ + R+     ++D+E
Sbjct: 582 YIKAEDIDLISHRQ-----IFDEE 600

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  274 bits (700), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 148/465 (31%), Positives = 264/465 (56%), Gaps = 13/465 (2%)

Query: 107 LSNAGPVGGLIAYLFMATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMY 166
           L++ GP   +I ++ ++T +++V+ +LGE+A   PV   F V+ +RF+ P+   A    Y
Sbjct: 122 LASGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNY 181

Query: 167 WFSWAITFALELSVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFI 226
              W +   LEL      I++W   +   AW+ IF+ ++ ++N+  VK +GE EF ++ +
Sbjct: 182 LAQWLVLLPLELVAASITIKYWNDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMV 241

Query: 227 KVIALVGFIIYCLCMVCGAGITGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLIN 285
           K++A++GF I  + + CG G  G      YW +PG++       DK   +F G  S  + 
Sbjct: 242 KILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSF-----VGDKPGTQFKGLCSVFVT 296

Query: 286 AAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNS 345
           AAF+Y G EL  ++A E+ +PRK++P+A K+  + +   Y  I   IG LVP++DP+L +
Sbjct: 297 AAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLN 356

Query: 346 SDSYV--SSSPFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLA 403
             S V  ++SP +I+I+N+G K L  + NA++L +I+S  NS VY  SR M  +A I   
Sbjct: 357 GSSSVDAAASPLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNL 416

Query: 404 PSFFGRTNAAGVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISAC 463
           P    R +  G P  A+  T  FG L+++  S   A  F WL  ++G++  F W+ I+  
Sbjct: 417 PKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYS 476

Query: 464 HIRFMQALKYRGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSG----VD 519
           HIRF  A+K +  + D+LP+ ++     ++Y +  + ++++   +T+  P  SG      
Sbjct: 477 HIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTS 536

Query: 520 FAAAYVSVFLFIAIWLGAQIWFR-CRIFHRLDEVDIDTDRRDIEA 563
           F   Y+S+ + IA ++G +++ R  ++  +L+++D++T R+ I+A
Sbjct: 537 FFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDA 581

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  273 bits (698), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 167/506 (33%), Positives = 260/506 (51%), Gaps = 20/506 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +  ++R+++ RH                     L   GP G +I Y  ++ + Y ++Q+ 
Sbjct: 76  DGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQAA 135

Query: 134 GEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           GEMA   P +   F  +SS F+S  FG AS ++Y   W   F LEL      I++WT +V
Sbjct: 136 GEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWTDSV 195

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPV 251
               +I IF+V +   + F  + YGE EF     KV+ + GF+I  + + CG AG +G +
Sbjct: 196 NADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSGYI 255

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           G RYW +PGA+  G         +F G+   L+   F+Y GTEL  +T  E ++PR+++ 
Sbjct: 256 GARYWHDPGAFAVG-----DPASKFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRAIH 310

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSS--DSYVSSSPFIIAIENSGTKVLPH 369
            A K+ ++RILV Y    V IG LVP+   +L  S   S   +SP+++A+   G KV+PH
Sbjct: 311 SATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGVKVVPH 370

Query: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429
           I NAV+L  ++S GNS +Y G R++  LA+   AP F    + AG P  A+   S  G L
Sbjct: 371 IVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVIGLL 430

Query: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489
           A++  S      F WL  I G++  FTW  I   HIRF QA+KY G S   L +K+    
Sbjct: 431 AFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSITGL 490

Query: 490 WLAYYALFFMVVIILIQGFTAFAPTFSG-----VDFAAAYVSVFLFIAIWLGAQIWF-RC 543
           W + Y + F +++ + Q + A AP  +      + F  +Y++  L+   +LG  ++    
Sbjct: 491 WGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMVYSGEW 550

Query: 544 RIFHRLDEVDIDTDRRDIEAVVWDDE 569
            I   L ++DI+  R      V+D+E
Sbjct: 551 MILRPLKDIDINHFR-----CVYDEE 571

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  273 bits (698), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 168/501 (33%), Positives = 269/501 (53%), Gaps = 13/501 (2%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           +K+ +K RH                     L N GP   LI Y  ++T++Y V+QS  E+
Sbjct: 87  LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASEL 146

Query: 137 AT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMA 195
           A  +  ++  F  + +  +  AF  +  ++Y   W     LEL      I++W  ++   
Sbjct: 147 AIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPD 206

Query: 196 AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVGFR 254
           A++ IF+V+L V N      Y E EF+    KV+ L+GF I  + + CG AG  G +G  
Sbjct: 207 AFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSV 266

Query: 255 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 314
           YW +PGA+       +    RF G V+ L+NAAF Y G E   +TA E  NP+KS+  A 
Sbjct: 267 YWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSAS 321

Query: 315 KKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVS-SSPFIIAIENSGTKVLPHIFNA 373
           KK+V+RI+  Y   A  +G LVPYN P+L  S S  + +SPF+IAI + G KV+PHI NA
Sbjct: 322 KKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHIINA 381

Query: 374 VVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYME 433
           V+L +++S  NS +Y  SRI+  L++   AP  F   +  G P   +  +  FG L ++ 
Sbjct: 382 VILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVA 441

Query: 434 LSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAY 493
            S    + F WLL I+G++  FTW  IS  H+RF +++  +G S D+L +++    W AY
Sbjct: 442 ASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAY 501

Query: 494 YALFFMVVIILIQGFTAFAPTFSGV----DFAAAYVSVFLFIAIWLGAQIWFRC-RIFHR 548
           YA+  +++I++ Q + A +P  S      +F   Y+++ + I ++LG ++W+R  R+   
Sbjct: 502 YAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIP 561

Query: 549 LDEVDIDTDRRDIEAVVWDDE 569
            +EVD+ + R+  +A +   E
Sbjct: 562 ANEVDLVSHRKIFDAEIMQSE 582

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  272 bits (696), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 166/515 (32%), Positives = 274/515 (53%), Gaps = 18/515 (3%)

Query: 67  VKEGQVHEAE---VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMA 123
           +++G+++  +   +++ ++ RH                  +  L   GP G LI YL ++
Sbjct: 50  LEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVS 109

Query: 124 TLVYSVVQSLGEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVG 182
            + Y ++ + GEMA   P +   F  +SS F+S  FG A+ +++   W   F LEL    
Sbjct: 110 IVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITAT 169

Query: 183 QIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMV 242
            +I++W  +V    ++ IF++ +   + F  + YGE EF     KV+ +VGF+I  + + 
Sbjct: 170 IVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILIN 229

Query: 243 CGA-GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAG 301
            GA G TG +G RYWRNPG++  G    DK +G        L+ A F++ G EL  ++  
Sbjct: 230 VGAIGDTGYIGDRYWRNPGSFVSGT-PLDKLKGT----AYVLVTAYFSFGGMELYALSVN 284

Query: 302 EAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY-VSSSPFIIAIE 360
           E  NP+ ++P A KK V+RIL+ Y    + IG LVP++  +L  S S  V  SP+++AIE
Sbjct: 285 ELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIE 344

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
             G KVLPHI NAV+L ++IS GNS +Y   R++  LA+   AP      +  G P  ++
Sbjct: 345 MHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISL 404

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
              + FG +A+   S      F WL  I G++  FTW  I   H RF QA+K +G S + 
Sbjct: 405 ILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLET 464

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLG 536
           L ++A    W + YA+FF +++ + Q + A  P        + F   Y++  L++ ++LG
Sbjct: 465 LGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLG 524

Query: 537 AQIWFRC-RIFHRLDEVDIDTDRR--DIEAVVWDD 568
             ++ R   + + LD++D+DT RR  D+E +  ++
Sbjct: 525 YMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEE 559

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  272 bits (696), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 157/505 (31%), Positives = 263/505 (52%), Gaps = 14/505 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           + ++K+ +K RH                     L   GP G +I Y+  +T++Y V+Q+ 
Sbjct: 73  QKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQAC 132

Query: 134 GEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
            E+  ++  +   +  + S  +   F  A  ++Y   WAI   LEL      I++W  ++
Sbjct: 133 CELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSI 192

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
               ++ IF+  +   + F  + Y E EF     KV+ +VGFII  + + CGA  +G +G
Sbjct: 193 NPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKSGYIG 252

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
            +YW  PGA+       +K    F G  S  + +AF Y G+E + +TA E  NPRKSVP+
Sbjct: 253 GKYWHTPGAF-----VGEKAIDHFKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPK 307

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSS--SPFIIAIENSGTKVLPHI 370
           A K+ ++R+L+ +    + +G LVPY+ P L  S    +S  SPF+IA  + G KV+PHI
Sbjct: 308 ATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHI 367

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            NAV+L ++IS GNS  Y   RI+  LA+  + P  F   +  G P   + F + FG ++
Sbjct: 368 INAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLIS 427

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S    + F WL  I  ++  FTW  IS  HIRF  A+K +G S  +L +KA    W
Sbjct: 428 FVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYW 487

Query: 491 LAYYALFFMVVIILIQGFTAFAPTFSG-----VDFAAAYVSVFLFIAIWLGAQIWFRC-R 544
            ++YA+ F ++++  Q + A AP  +G      +F   Y++  + +  + G ++W+R  +
Sbjct: 488 GSWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRDWK 547

Query: 545 IFHRLDEVDIDTDRRDIEAVVWDDE 569
           +F   D+VD+++ R+  +A +   E
Sbjct: 548 LFIPADKVDLESHRKIFDADLIKQE 572

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  272 bits (696), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 159/506 (31%), Positives = 273/506 (53%), Gaps = 17/506 (3%)

Query: 69  EGQVHEAEVKRALKQ----RHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMAT 124
           +  V + ++ ++L +    RH                     L++ GP   +I ++ ++T
Sbjct: 66  QSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIIST 125

Query: 125 LVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQI 184
            +++V+ SLGE+A   PV   F V+ +RF+ P+F  A    Y   W +   LEL      
Sbjct: 126 CLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASIT 185

Query: 185 IEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC- 243
           I++W + +   AW+ IF+ ++T++N+  VK +GE EF ++ +K++A++GF I  + + C 
Sbjct: 186 IKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCG 245

Query: 244 GAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303
           G    G +G +YW NPGA+  G  S  K    F G  S  + AAF+Y G E+  ++A E+
Sbjct: 246 GGPKGGYLGGKYWHNPGAF-VGHTSGTK----FKGLCSVFVTAAFSYSGIEMTAVSAAES 300

Query: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV--SSSPFIIAIEN 361
            +PRK++P+A K+  + I   Y  I   +G LVPY+DP+L S  S V  ++SP +IAIEN
Sbjct: 301 KDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIEN 360

Query: 362 SGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVF 421
            G K L  + NA++L +IIS  NS VY  SR M  +A I   P   G+ +  G P  A  
Sbjct: 361 GGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATL 420

Query: 422 FTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDL 481
            T  FG L+++  S      F WL  ++G++  F W+ I+  HIRF QA+  +  S D++
Sbjct: 421 VTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEM 480

Query: 482 PFKAKFMPWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGA 537
           P+ ++   W + Y +  + ++++   +T+  P    +     F   Y+S+ + I  ++G 
Sbjct: 481 PYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGH 540

Query: 538 QIWFRC-RIFHRLDEVDIDTDRRDIE 562
           +++F+       L+E+D+DT R+ ++
Sbjct: 541 KLYFKNWSWVVTLEEMDLDTGRKALD 566

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  271 bits (694), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 158/515 (30%), Positives = 263/515 (51%), Gaps = 26/515 (5%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           ++G  H   +K++LK RH                     L+  GP+  +I +    + + 
Sbjct: 69  EDGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIV 128

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
             +  LGE+    PV  AF  +++RFL P+       +Y   W     LE+      +++
Sbjct: 129 GTIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQY 188

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           W  ++    ++ IF+ ++   NLF  + +GE EF  + +K+I + GFII C+ ++ G G 
Sbjct: 189 WNDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGGP 248

Query: 248 TGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
               +G +YW NPG+   G          F G +S L+ A+++  GTE+  + +GE  +P
Sbjct: 249 DHEYIGAKYWHNPGSLAHG----------FKGVLSVLVVASYSLGGTEMTCLASGET-DP 297

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKV 366
            K +P AIK+V +RIL F+      +G LVPY +P L    S V +SPF+IAI+    KV
Sbjct: 298 -KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSS-VDNSPFVIAIKIHNIKV 355

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           LP I NAV+L +I+S GNS ++  SR +  +A   L P +FG  + AG P   +   S F
Sbjct: 356 LPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIIINSLF 415

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           G LA++  S+     F+WL+ I G+A    W+ I+ CH+RF  A+K +  + D+L F + 
Sbjct: 416 GLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELEFVSA 475

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAP----TFSGV---DFAAAYVSVFLFIAIWLGAQI 539
              W + Y+     +I++ Q + A  P    T SG     F   Y+   + I +++G +I
Sbjct: 476 VGIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVLFIGHKI 535

Query: 540 WFRCRIFH-----RLDEVDIDTDRRDIEAVVWDDE 569
           ++R    H      L ++D+DTDR++++  +   E
Sbjct: 536 YYRVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQE 570

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  271 bits (694), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/508 (32%), Positives = 268/508 (52%), Gaps = 16/508 (3%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
            +K+++K RH                  +  L  AGP   +I Y+ ++ + Y +VQ+ GE
Sbjct: 85  HLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAAGE 144

Query: 136 MAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPM 194
           M   +  +   F  ++S F+S +FG A+ +++   W     LEL      I++W  ++  
Sbjct: 145 MGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDSINA 204

Query: 195 AAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVGF 253
             +I IF+V L   + F VK YGE EF     K++ + GFII  + + CG AG+ G +G 
Sbjct: 205 DVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGG 264

Query: 254 RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 313
           +YWR+PG++  G      N  RF G    L+ A F++ G EL  ++  E +N RKS P A
Sbjct: 265 KYWRDPGSFADG-----SNATRFKGICFILVTAYFSFGGIELFVLSINEQSNARKSTPLA 319

Query: 314 IKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVS-SSPFIIAIENSGTKVLPHIFN 372
            K+ V+RIL+ Y    + IG  VP+N+ +L  S S  + +SP+++A      +V+PHI N
Sbjct: 320 AKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVIPHIIN 379

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           AV+L ++IS  NS +Y   R+M  LA+   AP F    +  G P  A+   +  G + ++
Sbjct: 380 AVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGVVGFV 439

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
             S     AF WL  I G++  FTW  I   HIRF +A+K +G S  +L +KA    W +
Sbjct: 440 ACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKANTGIWGS 499

Query: 493 YYALFFMVVIILIQGFTAFAPTFSGVD-----FAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
           YY +FF +++ + Q + A +P  +G       F   Y++  L+I ++LG  ++ +   + 
Sbjct: 500 YYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYMLYNKDFTLL 559

Query: 547 HRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           + LD++D+D  RR  D E +  +DE  K
Sbjct: 560 NPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  269 bits (687), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 165/503 (32%), Positives = 263/503 (52%), Gaps = 17/503 (3%)

Query: 67  VKEGQVH--EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMAT 124
           +K+G +H    ++K+ LK RH                     L   GPVG LIAY+ +  
Sbjct: 34  IKQGVLHNDRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGI 93

Query: 125 LVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFAL----ELSV 180
           +V     ++ E+A+F+P T A    S +F+  A G      + F W  T++     ELS 
Sbjct: 94  VVGCNQIAIAEVASFMPATGATIRHSEQFIDEAVG------FTFGWISTYSSLMPGELSA 147

Query: 181 VGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLC 240
              ++ +WT   P A +ITIF VL  ++N++ +++YGE E++  ++K+  +   II  L 
Sbjct: 148 TAVVMTYWTDLSP-AIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLV 206

Query: 241 MVCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITA 300
           +  G      +GF YWRNPG +   ++  D   G+F+G+ ++L +  ++Y G + + I A
Sbjct: 207 IDLGGTKQERLGFHYWRNPGPFAEYLVGGDT--GKFVGFWAALSSVVYSYSGIQNIAILA 264

Query: 301 GEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIE 360
           GE  N R ++    K V  RI++ Y      + L+VPYND  + +      SSPF+IA+E
Sbjct: 265 GETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLIATGSGNARSSPFVIAME 324

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
            +G KVLPHI NA++LT+  SAGN  +  GSR ++ LA    AP  F +T+  G+P+  V
Sbjct: 325 RAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGV 384

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
            F S+F  LAYM  S   A+ F+W   +        W+LISA HI   +AL+ +G SR D
Sbjct: 385 LFISSFLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKD 444

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAFAP-TFSGVDFAAAYVSVFLFIAIWLGAQI 539
           LP+     P+ A+++     + +L  GF  F    F    F + Y  + L IA++   ++
Sbjct: 445 LPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKL 504

Query: 540 WFRCRIFHRLDEVDIDTDRRDIE 562
           + + R + R  EVD+ +   DI 
Sbjct: 505 FKKTR-YLRPHEVDLQSIFEDIR 526

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  270 bits (689), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 166/521 (31%), Positives = 276/521 (52%), Gaps = 18/521 (3%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
           EV R LK RH                   T LS+ GP   LI+Y  M+  V++++  + E
Sbjct: 63  EVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTE 122

Query: 136 MATFIPVT--SAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           M   IP++  S+    +  +L+       G+  +++ ++    E++    +IE+WT A  
Sbjct: 123 MVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWTDA-N 181

Query: 194 MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP--V 251
            A ++TIF +L T+ +L PVK +GE EF ++ IK++ ++G I+  + +  G G      +
Sbjct: 182 AAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVL 241

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKSV 310
           GF YW  PGA+   ++    + G FL    ++I + F +    E+    + EAA PRK++
Sbjct: 242 GFHYWNTPGAFNSYLV--KGSTGAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNM 299

Query: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLN----SSDSYVSSSPFIIAIENSGTKV 366
           PRA ++ V+R+ VFY    + IG++V Y++  LN    S  +  ++SPF+I I+ +G ++
Sbjct: 300 PRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRI 359

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           LPHI NA +LT+  S   S +Y  SR+++ LA    AP FF + N  GVPY++V  TS F
Sbjct: 360 LPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLF 419

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           G LAY+  S      FNWL NI  ++GF  WV +S  ++RF +   Y  I+ D +P++ +
Sbjct: 420 GVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKIN-DRVPYRRR 478

Query: 487 FMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRI 545
               LAY +  F  ++ +  GF  F A  ++  DF   YV++     +++G+ I+++   
Sbjct: 479 GQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYKEWT 538

Query: 546 FHRLD----EVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIV 582
           F  +D    E+    D+ D E       PPK   ++ W IV
Sbjct: 539 FRDMDVVGREIMPKIDQADQEEKEEYLPPPKNWVERVWRIV 579

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  270 bits (689), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 166/510 (32%), Positives = 265/510 (51%), Gaps = 24/510 (4%)

Query: 68  KEGQVH--------EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAY 119
           KEGQ          + ++K  +K RH                     L   GP G LI Y
Sbjct: 54  KEGQEEYATGLNKTQQKLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPGGLLIGY 113

Query: 120 LFMATLVYSVVQSLGEMAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALEL 178
           L  +T++Y VVQ+  E+   +  +   +  + +  +   FG A   +Y   WAI   LEL
Sbjct: 114 LTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIVLPLEL 173

Query: 179 SVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYC 238
                 I++WT +V    ++ IF++ +   + F  + Y E EF    +KV+ + GFII  
Sbjct: 174 VTASMTIKYWTESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMAGFIIMG 233

Query: 239 LCMVCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGI 298
           + + CGA   G +G +YW NPG +     + +++     G  S  + +AF Y G+E + +
Sbjct: 234 ISLNCGASKLGYIGAKYWSNPGTF-----AGERSINHLKGICSVWVQSAFAYGGSEFIAL 288

Query: 299 TAGEAANPRKSVPRAIKKVVFRILV-FYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPF 355
           TA E ANPR+SVP A K+ ++R++V F  PIA+ I  LVPY   +L  +S  S   +SPF
Sbjct: 289 TAAEQANPRESVPSATKRWLYRVVVVFLIPIAL-ICFLVPYTSDQLLSSSGASASHASPF 347

Query: 356 IIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGV 415
           +IA    G K++PHI NA++LT++IS GNS +Y   RI+  LA+  L P  F   + AG 
Sbjct: 348 VIAAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTYVDRAGR 407

Query: 416 PYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRG 475
           P   + F   FG L+++  S    S F WL  I G++  FTW  I+  HIRF  A+K +G
Sbjct: 408 PLATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRAAMKVQG 467

Query: 476 ISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAP-----TFSGVDFAAAYVSVFLF 530
            S  +L + +      +YYA+FF +V+++ Q + A AP           F   Y++  + 
Sbjct: 468 RSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAPIDKHGELDAESFFKNYLAFAVL 527

Query: 531 IAIWLGAQIWFR-CRIFHRLDEVDIDTDRR 559
           +  ++G +IW+R  ++   +D++D++T R+
Sbjct: 528 VLFYVGYKIWYREVQLLIPVDKIDLETHRQ 557

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  270 bits (690), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 162/510 (31%), Positives = 264/510 (51%), Gaps = 14/510 (2%)

Query: 72  VHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQ 131
           + E+ +K+++K RH                  ++ L  +GP   ++AY  ++ + Y ++Q
Sbjct: 96  ISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQ 155

Query: 132 SLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
           + GEMA T+  +   F  + S F+S  FG A+ +++   W     LEL      I++W  
Sbjct: 156 AAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWND 215

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITG 249
            +    ++ IF+V L   + F V+ YGE EF     K++ + GFII+ + + CG AG  G
Sbjct: 216 KINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDG 275

Query: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
            +G +YW +PGA+     +   N GRF G    L+ A F+Y GTEL  ++  E  NPRKS
Sbjct: 276 YIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKS 330

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPY-NDPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
            P+A K+ ++RI+V Y    + IG  VP+ ND  + S  S   +SP+++A    G +++P
Sbjct: 331 TPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVP 390

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
           H  NAV+L ++IS  NS++Y   R++  LA+   AP F    +  G P  A+   S FG 
Sbjct: 391 HFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGV 450

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           + +   S      F WL  I G++  FTW  I   H+RF QA+K +G   ++L +KA   
Sbjct: 451 IGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSG 510

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFS---GVDFAAAYVSVFLFIAIWLGAQIWFRCRI 545
            W + Y +FF +++   Q + A AP  S    + F  +Y++  +F   + G  +W +   
Sbjct: 511 VWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWNKDFT 570

Query: 546 FH-RLDEVDIDTDRR--DIEAVVWDDEPPK 572
           F   L+ +D+D  RR  D E +  + E  K
Sbjct: 571 FLIPLESIDLDFHRRVYDPEFIRQEREEKK 600

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  270 bits (691), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 161/507 (31%), Positives = 269/507 (53%), Gaps = 14/507 (2%)

Query: 72  VHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQ 131
           + + E+KR + QRH                  ++ L++AGP G LI Y  M T VY V+Q
Sbjct: 112 IKKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQ 171

Query: 132 SLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
           + GE+  T+  +   F  + +  ++P+F  + G++Y   W     LEL      I++WTT
Sbjct: 172 AAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTT 231

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITG 249
            V    ++ IF++L+ + N F  K Y E +F+   +K+  + GF I  + + CG AG  G
Sbjct: 232 KVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDG 291

Query: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
            +G +YW NPGA+       +K    F G  S  + +AF + G+E V ++A E ANPRKS
Sbjct: 292 YLGGKYWHNPGAF-----RGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKS 346

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPH 369
           +P A K +++RI+  Y      +G LVP++ P+L  S     +SP+++AI   G KV+PH
Sbjct: 347 IPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYVVAIAMHGVKVVPH 406

Query: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429
           + NAV+L  ++S  NS  +  SR++  L++   AP +F   +  G P  A+  ++ FG +
Sbjct: 407 LINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVI 466

Query: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489
            +   S      F+WLL I+G++  FT+  I   HIR   A+K +G S  +L F+++   
Sbjct: 467 CFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGT 526

Query: 490 WLAYYALFFMVVIILIQGFTAFAPTFSGV----DFAAAYVSVFLFIAIWLGAQIWFRC-R 544
           + ++YA   +V+ ++ + + A AP   G      F   Y++  + I  + G  IW +  R
Sbjct: 527 YGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFR 586

Query: 545 IFHRLDEVDIDTDRR--DIEAVVWDDE 569
           IF R  ++D+D  R+  D + +  +DE
Sbjct: 587 IFIRSKDIDLDFKRQVFDEDLIKQEDE 613

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  268 bits (686), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 166/506 (32%), Positives = 256/506 (50%), Gaps = 24/506 (4%)

Query: 69  EGQVHEAE-------VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLF 121
           EG+ H A        VKRALK RH                     L+  GP+  L+ +  
Sbjct: 36  EGKNHNASLYDPKTGVKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSI 95

Query: 122 MATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVV 181
           +  + +++++S+GEM T  P    FT  + RF S +  A  GY Y   +    A E + +
Sbjct: 96  IGIIAFTIMESIGEMITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTL 155

Query: 182 GQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM 241
             I +FW   VP+  +I IFW       +  V  +GE E+W+++ K++ LV F I+    
Sbjct: 156 SSIFQFWGPQVPLYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIY 215

Query: 242 VCGAGITGPV-GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITA 300
           + G     P  GF YW NPGA   G          F G     +  +  Y GTE V  +A
Sbjct: 216 ISGGIKDRPAFGFHYWNNPGALSHG----------FKGIAEVFVFCSTFYSGTESVAYSA 265

Query: 301 GEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIE 360
            E+ NP +++P AI++  +RILV Y  I  F G+ VPYND  LN+    + S P  IAI 
Sbjct: 266 SESKNPNRAIPLAIRQTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKALKS-PISIAIT 324

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
            +G +   H+ NA +L T ISA N ++++GSR +  LA   LAP F   T+  GVP  A+
Sbjct: 325 RAGWEGGTHLVNAFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAI 384

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
              +A G ++ M +S G ++A+++++N++GV  F  W  I   H+RF +A   +G +  +
Sbjct: 385 TLFNALGLVSLMNVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKE 444

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIW 540
           LP+KA F P+     +   + + LIQG+T+F P F   DF  AYV +     +++G  + 
Sbjct: 445 LPYKALFYPYTQIIGIAANIFLALIQGWTSFVP-FKAGDFVDAYVLLPAAAVLYIGISL- 502

Query: 541 FRCRIFHRLDEVDIDTD---RRDIEA 563
            +   F  +D + ID D   R D++A
Sbjct: 503 LKTHSFKTVDLLTIDLDEGRRVDLDA 528

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  269 bits (688), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 165/510 (32%), Positives = 260/510 (50%), Gaps = 16/510 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +  +K+A+K RH                  +  L  AGP   +I Y  ++ + Y V+Q+ 
Sbjct: 74  DDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAA 133

Query: 134 GEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           GEMA   P +   F  ++S F+S  FG A+ +++   W     LEL      I++W   +
Sbjct: 134 GEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKI 193

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPV 251
               ++ I +V L   + F V+ YGE EF     K++ + GF+I  + + CG AG+ G +
Sbjct: 194 NADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYI 253

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           G +YWR+PGA+     + D    RF G    L+ A F+Y G EL  ++  E  NPR+S P
Sbjct: 254 GGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTP 308

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTKVLPHI 370
            A K+ ++RIL+ Y    + IG  VP+N D  + +  S   +SP+++A+   G KV+PHI
Sbjct: 309 AAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHI 368

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            NAV+L ++ S  NS +Y   R++  LA+   AP +F   +  G P  A+   S FG +A
Sbjct: 369 INAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIA 428

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           +   S      F WL  I G++  FTW  I   H+RF  A+K +G S ++L + +    W
Sbjct: 429 FCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIW 488

Query: 491 LAYYALFFMVVIILIQGFTAFAPTFS-GVDFAAAYVSVFLFIAIW----LGAQIWFRCRI 545
            + Y  FF V++ + Q + A +P  S GV  A A+   +L   +W    LG  ++ R   
Sbjct: 489 GSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFT 548

Query: 546 F-HRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           F   L ++D+D  RR  D E +  +DE  K
Sbjct: 549 FLTDLKKIDLDNHRRLYDPELLRQEDEETK 578

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  268 bits (686), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 161/508 (31%), Positives = 262/508 (51%), Gaps = 14/508 (2%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +  +K+A+K RH                  +  LS  GP   +I Y+ ++ + Y ++Q+ 
Sbjct: 63  DRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAA 122

Query: 134 GEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           GEMA   P +  +F  ++S F+S   G A+ +++   W     LEL      I++W  ++
Sbjct: 123 GEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYWNDSI 182

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VCGAGITGPV 251
               WI IF+V L   ++F VK YGE EF     K++ + GFII+ + +   GAG  G +
Sbjct: 183 NADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYI 242

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           G +YW+NPG++     +   + GRF      L+ A F+Y GTEL  ++  E ANPR+S P
Sbjct: 243 GAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTP 297

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPY-NDPKLNSSDSYVSSSPFIIAIENSGTKVLPHI 370
           +A K+ ++RIL+ Y    + IG  VP+ ND  + +  S   +SP+++A    G KV+PHI
Sbjct: 298 KAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPYVLAASIHGVKVVPHI 357

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            NAV+L  + S GNS++Y   R+   LA+   AP      +  G P  A+   +  G +A
Sbjct: 358 INAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVIA 417

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           +   S+     F WL  I  ++  FTW  I   HIRF  A+K +G   ++L +KA    W
Sbjct: 418 FAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGVW 477

Query: 491 LAYYALFFMVVIILIQGFTAFAP---TFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIF- 546
            + +   F V++ + Q + A +P   T S   F  +Y++  L++  +    +W R   F 
Sbjct: 478 GSMWGFGFCVLVFIAQFWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYMLWKRDFTFL 537

Query: 547 HRLDEVDIDTDRR--DIEAVVWDDEPPK 572
            +L+++D+D  RR  D E +  +DE  K
Sbjct: 538 TKLEDIDLDAHRRIYDPEFLRQEDEERK 565

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  270 bits (689), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 161/507 (31%), Positives = 258/507 (50%), Gaps = 19/507 (3%)

Query: 78  KRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEMA 137
           K  +K RH                  +  L  +GP G ++ Y  ++ + Y VVQ+ GEMA
Sbjct: 155 KGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMA 214

Query: 138 TFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMAA 196
              P +   F  + S F+S  FG A+ +++  +W     LEL      +++WTT++    
Sbjct: 215 IAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELITSSITVKYWTTSINPDI 274

Query: 197 WITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVGFRY 255
           ++ IF++ L   +   ++ Y E EF+    K++ + GFII+ + + CG AG  G +G +Y
Sbjct: 275 FVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGGKY 334

Query: 256 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 315
           W +PG +     + D    RF      LINA F+Y GTEL  ++  E  NPRK+VP A K
Sbjct: 335 WHDPGPF-----ASDNGAARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVAAK 389

Query: 316 KVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFNAVV 375
             V+R+ + Y    + IG  VPYN P L  + +   +SP+++A +  G K++PH  NAV+
Sbjct: 390 TSVYRVAIIYLLTMILIGFNVPYNSPDLMGNANSKDASPYVLAAQIHGVKIVPHFINAVI 449

Query: 376 LTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYMELS 435
           L ++IS  NS ++ G R++  LA+   AP F    + AG P  A+   S FG +A+   S
Sbjct: 450 LLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAFAATS 509

Query: 436 TGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAYYA 495
                 F WL  I G++  F W  I   HIRF  A+KY G S D++ +KA    W +YY 
Sbjct: 510 KKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIWGSYYG 569

Query: 496 LFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLD---- 550
           LFF +++++ Q + A  AP   G   A ++   +L   IW+    ++ C + +  D    
Sbjct: 570 LFFNLLVLIAQFWVALSAPGSGGQVTAISFFESYLAFVIWV---FFYLCYMIYNKDWTIL 626

Query: 551 ----EVDIDTDRRDIEAVVWDDEPPKT 573
               ++D+D  RR  +A     E  ++
Sbjct: 627 IPLKDIDVDYQRRIYDADFLRQEKEES 653

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  268 bits (684), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 159/514 (30%), Positives = 261/514 (50%), Gaps = 26/514 (5%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G      +KR+LK RH                     ++  GP+  +I +    + +  
Sbjct: 77  DGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIG 136

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            +  LGE+    PV  AF  +S+RFL P+       +Y   W     LE+      +++W
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYW 196

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
             ++    W+ IF+  +   NLF  + +GE EF  + +KV+ + GFII C+ ++CG G  
Sbjct: 197 NQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPD 256

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
              VG +YW +PG    G          F G +S L+ A+++  GTE+V + +GE  +P 
Sbjct: 257 HDFVGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-DP- 304

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K +P AIK+  +RIL F+      IG LVPY +  L    S V++SPF+IAI+    KVL
Sbjct: 305 KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS-VNNSPFVIAIKLHQIKVL 363

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P I NAV+L +I+S GNS ++  SR +  +A   L P FFG  + AG P   +   S FG
Sbjct: 364 PSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFG 423

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++  S+  +  F+WL+ I G+A    W+ I+  HIRF  A+K +G S D+L F +  
Sbjct: 424 LLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAV 483

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAP-------TFSGVDFAAAYVSVFLFIAIWLGAQIW 540
             W + Y+     +I++ Q + A  P       +     F  +Y+   + I +++G +I+
Sbjct: 484 GIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIF 543

Query: 541 FRCRI-----FHRLDEVDIDTDRRDIEAVVWDDE 569
           +R +         L+++D++TDR++I+  +   E
Sbjct: 544 YRYKTGKWWSMLPLNKIDLETDRKNIDIEILKQE 577

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  267 bits (682), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 160/515 (31%), Positives = 261/515 (50%), Gaps = 28/515 (5%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G      +KR LK RH                     L+  GP+  LI +    T +  
Sbjct: 60  DGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVG 119

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            +  LGE+    PV  AF  +S+RFL P+       +Y   W     LE+      +EFW
Sbjct: 120 TIHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFW 179

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           TT+V    W+ +F+ L+   NLF V+++G+ +F  + IK++ + GFII CL ++ G G T
Sbjct: 180 TTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPT 239

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
              +G RYW +PGA   G          F G  + ++ A+++  G+E+  + +GE  +P 
Sbjct: 240 HEFIGARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP- 287

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPY-NDPKLNSSDSYVSSSPFIIAIENSGTKV 366
           K +P AIK++ +RI+ F+      +G LVPY ND  L  S+  V++SPF+IAI+    +V
Sbjct: 288 KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSN--VNNSPFVIAIKMHNIRV 345

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           LPHI N V+L +I+S GNS ++  SR +  +A   L P  FG  + AG P   +   S F
Sbjct: 346 LPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLF 405

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           G LA++  S+   + F WL+ + G+A    W+ I+  HIRF  A+K +G S D+L F + 
Sbjct: 406 GLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSA 465

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAPTFSGVD-------FAAAYVSVFLFIAIWLGAQI 539
              W + Y+    VV+++ Q + +  P     D       F   Y+   + + +++  +I
Sbjct: 466 VGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKI 525

Query: 540 WFRCRIFH-----RLDEVDIDTDRRDIEAVVWDDE 569
           ++R           L E+D+++ R++I+  V   E
Sbjct: 526 YYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHE 560

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  267 bits (683), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 160/523 (30%), Positives = 270/523 (51%), Gaps = 23/523 (4%)

Query: 68  KEGQVH-------EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYL 120
           K  Q+H       +A ++++++ RH                   + LS AGP   +I Y 
Sbjct: 103 KSKQLHGQKNGDDDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYG 162

Query: 121 FMATLVYSVVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELS 179
            M + +Y ++Q+ GEMA  +  +   F  + S  +         ++Y   W     LEL 
Sbjct: 163 IMGSCLYCIIQACGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELV 222

Query: 180 VVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCL 239
                I++WTT V    ++ IF+VL+T+ N F  K Y E EF+    KV+ + GF I  +
Sbjct: 223 TASMTIDYWTTKVNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAI 282

Query: 240 CM-VCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGI 298
            +   GAG  G +G +YW NPGA+       DK+  RF   +S+   AAF +  +E + I
Sbjct: 283 VINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAI 337

Query: 299 TAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFI 356
            A E +NPR+++P A K +++RIL  +      +G LVPY+  +L  +   +   +SP++
Sbjct: 338 GASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPYV 397

Query: 357 IAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVP 416
           IA+ + G +V+PH  NAV+L +++S  NS  Y   RI+Y LA+   AP +F   +  G P
Sbjct: 398 IAVASHGVRVVPHFINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRP 457

Query: 417 YFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGI 476
             A+  T+ FG +A+   S      F WLL+I G++  FTW  I   HIRF +A+K +G 
Sbjct: 458 ARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGR 517

Query: 477 SRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPT----FSGVDFAAAYVSVFLFIA 532
           S D++ FK++   W + YA   M++ ++ + + + AP         +F   Y+++ + I 
Sbjct: 518 SVDEIGFKSQVGVWGSGYAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIV 577

Query: 533 IWLGAQIWFRC-RIFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           ++ G +I+ +  ++F R  ++D+ + R   D E V  ++E  K
Sbjct: 578 LYFGYKIYKKDWKLFIRAKDIDLISHRTIFDGELVRQEEEEYK 620

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  265 bits (678), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 166/518 (32%), Positives = 265/518 (51%), Gaps = 17/518 (3%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           +  +K+A+K RH                     L+ AGP   ++ Y  ++ + Y ++Q+ 
Sbjct: 75  DDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAA 134

Query: 134 GEMATFIPVTSA-FTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           GEMA   P   A F  ++S F+S  FG A+ +++   W     LEL      I++W   +
Sbjct: 135 GEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDTI 194

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPV 251
               +I IF+V L   + F VK YGE EF     K++ + GFII  + + CG AG  G +
Sbjct: 195 NPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYI 254

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311
           G +YW NPGA+     + +    RF G    L+   F+Y GTEL  ++  E  NPRKS P
Sbjct: 255 GNKYWINPGAF-----ASESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTP 309

Query: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTKVLPHI 370
            A K+ ++RIL+ Y    + IG  VP++ D  + +  S   +SP+++A    G KV+PH 
Sbjct: 310 AAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASLHGVKVVPHF 369

Query: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430
            NAV+L +++S  NS +Y   R+M  LA+   AP +F   +  G P  A+     FG + 
Sbjct: 370 INAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIG 429

Query: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490
           ++  S     AF WL  I G++  FTW  I   HIRF  A+K +G S ++L ++A    W
Sbjct: 430 FVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIW 489

Query: 491 LAYYALFFMVVIILIQGFTAFAPTFSGVDFAA-----AYVSVFLFIAIWLGAQIWFRCRI 545
            + Y++FF +++ + Q + A +P  S   + A     +Y++  L++  + G  I+ R   
Sbjct: 490 GSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFT 549

Query: 546 F-HRLDEVDIDTDRR--DIEAVVWDD-EPPKTLWDKFW 579
           F   LD++D+D  RR  D E +  +D E  + L +  W
Sbjct: 550 FLTPLDKIDLDFHRRIYDPELLRQEDAETKERLRNSGW 587

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  264 bits (675), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 169/521 (32%), Positives = 267/521 (51%), Gaps = 20/521 (3%)

Query: 67  VKEGQVH--EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMAT 124
           VK G +H    ++K+ LK+RH                     L   GPVG LIAYLF+  
Sbjct: 37  VKRGVLHNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGI 96

Query: 125 LVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFAL----ELSV 180
           +V     ++ E+A+F+P T A    + +F+  + G      + F W  T++     ELS 
Sbjct: 97  VVGCNQIAIAEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSA 150

Query: 181 VGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLC 240
              I+ +WT   P A +IT+F +L  V+N++ +++YGE E+   ++K++ +   II  L 
Sbjct: 151 TAVIMRYWTDVSP-AVFITVFGILFVVTNIYTIRFYGELEYIFGWLKLVLIFILIISGLV 209

Query: 241 MVCGAGITGP--VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGI 298
           +  G G  G   +GF YWR PG +   ++    + G+F+G+ +++ +  ++Y G + + I
Sbjct: 210 IDLG-GTKGQERLGFHYWREPGPFANYLVGG--HIGKFVGFWAAISSVVYSYSGIQNIAI 266

Query: 299 TAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIA 358
            AGE  N R ++    K V  RI+V Y      + L+VPYND  + +      SSPF+IA
Sbjct: 267 LAGETKNSRHAIFHGAKNVFLRIIVLYLVTVFILTLIVPYNDKLIATGTGTARSSPFVIA 326

Query: 359 IENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYF 418
           +  +G KVLPHI NA++LT+  SAGN  +  GSR ++ LA    AP  F RT+  G+PY 
Sbjct: 327 MNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYV 386

Query: 419 AVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISR 478
            V F S+F  LAYM  S   A+ F W   +        W+LISA HI   +ALK +G SR
Sbjct: 387 GVIFISSFLPLAYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSR 446

Query: 479 DDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAP-TFSGVDFAAAYVSVFLFIAIWLGA 537
            DLP+     P+ A+++     + +L  GF  F    F    F   Y  + L I ++   
Sbjct: 447 SDLPYSTPMGPFAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFW 506

Query: 538 QIWFRCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKF 578
           +++ + + + R  EVD+++   DI+         K  W +F
Sbjct: 507 KLFKKTK-YLRPHEVDLESIFDDIKENPEHIVKTKNAWARF 546

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  266 bits (680), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 153/512 (29%), Positives = 267/512 (52%), Gaps = 11/512 (2%)

Query: 72  VHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQ 131
           + E   +R L  R                    T +   GP   LIA+   + +   + +
Sbjct: 112 LEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSK 171

Query: 132 SLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTA 191
            +  M T++PVT +F  F+ RF+  + G A G+ Y+   A     E++ V  ++E+WT  
Sbjct: 172 CMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTDK 231

Query: 192 VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPV 251
           +P AA I++  +L    NL+ V ++GE EF+++  KV+  +G II+ + ++ G      V
Sbjct: 232 IPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTV 291

Query: 252 -GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 310
            GF+ W NPGA+   I   D + GRF G++S L+ A + + G + +G  A EA NPRK +
Sbjct: 292 LGFKNWSNPGAFAEYI--SDGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVI 349

Query: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL----NSSDSYVSSSPFIIAIENSGTKV 366
           P + +KV  R+++FY   A+ +G+L+PYNDP +            +SP++ A++  G +V
Sbjct: 350 PSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRV 409

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           LPHI N ++LT+IISAGNS++Y  SR+++ LA    AP  F  T   GVP +        
Sbjct: 410 LPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVI 469

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
             LAY+ +S    +   W LN+   A    ++ I   +++F +    + +    LP+ + 
Sbjct: 470 CGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSS 529

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAP-TFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRI 545
            +P+LA+++LF++V+++L+ G+T F   ++    F  +Y  +  F+    G +++   + 
Sbjct: 530 SLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTKS 589

Query: 546 FHRLDEVDIDTDRRDI--EAVVWDDEPPKTLW 575
              L E+D+ T   ++  E   W + PP   W
Sbjct: 590 VRPL-EMDLFTGIEELADEDRYWAENPPTLNW 620

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  265 bits (676), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 160/529 (30%), Positives = 277/529 (52%), Gaps = 28/529 (5%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           EGQ H+  V R LK RH                     LS  GP   LI+Y+ M+  V+ 
Sbjct: 61  EGQEHQ--VARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWC 118

Query: 129 VVQSLGEMATFIPVTSAFTVF--SSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           ++  L EM   +P++   ++F  +  +L+       G   +++ ++    E++    +I+
Sbjct: 119 IMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQ 178

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
           +WT A   A +I+IF V+     + PV ++GE EFW++ IK+  + G +I  + +  G  
Sbjct: 179 YWTDA-NSAIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGA 237

Query: 247 ITGP--VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGT-ELVGITAGEA 303
                 +GF YW++PGA+ P ++    N G+FL   +++I + F+Y    E+V   A EA
Sbjct: 238 PNQDKVLGFHYWKHPGAFNPHLVPG--NTGKFLACWTAIIKSGFSYVLVPEVVVSCAAEA 295

Query: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL----NSSDSYVSSSPFIIAI 359
            +PR+++PR  ++ V+R+ +FY   ++ IG++V Y++ +L     + +S  ++SPF+I I
Sbjct: 296 KDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGI 355

Query: 360 ENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFA 419
           +  G +VLPHI NA +LT+  S G S +Y  SR+++ +A     P  F  TN  G PY++
Sbjct: 356 QEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYS 415

Query: 420 VFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRD 479
               S F  LAY+  S   +  F WL NI  ++GF  W+L+   ++RF + +++  ++ D
Sbjct: 416 TAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLT-D 474

Query: 480 DLPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQ 538
            +PF+ +FM  LAY +  F  ++ L  G+  F A  ++  DF A Y ++ L   +++GA 
Sbjct: 475 KMPFRKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYIGAA 534

Query: 539 IWFRCRIFHRLDEVDIDTDRRDIEAVVWDDEP--------PKTLWDKFW 579
           I+++      LDEV  +     I  +   DE         PK   +K W
Sbjct: 535 IYYKTIKLRDLDEVAAEI----IPKIAMADEEEKGEVPIVPKNWLEKVW 579

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  263 bits (673), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 156/507 (30%), Positives = 262/507 (51%), Gaps = 27/507 (5%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
           ++K+++K RH                     L+ AGP G +I Y   + ++Y ++Q+ GE
Sbjct: 69  KMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAGE 128

Query: 136 MA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPM 194
           +   +  +   +T +SS  + PA G +  ++Y   W     L+L      + +WT A P 
Sbjct: 129 LGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWTNANP- 187

Query: 195 AAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVGF 253
             ++ +F+V++ V N+F  K Y E EF     KV+ + GF+I  + + CG AG +G +G 
Sbjct: 188 DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYIGA 247

Query: 254 RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 313
           +YW +PG++  G          F G       AAF+Y G E++ +TA E  NPRKS+P A
Sbjct: 248 KYWHSPGSFAAG----------FKGVCYVFCYAAFSYGGIEVMVLTASEQENPRKSIPNA 297

Query: 314 IKKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFIIAIENSGTKVLPHIF 371
            KKV++RIL+ Y    + +  LVPYN  +L  +S +S   +SP +IA+ + G K++PHI 
Sbjct: 298 CKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVIAVASHGVKIVPHII 357

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           NAV+L ++IS GNS++Y   R++  L++   AP F    +  G P      T     +A+
Sbjct: 358 NAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALIAF 417

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
           +  S      F WLL I+G++  F W  I   H+RF  A+  +G+S   + +K++   W 
Sbjct: 418 VAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGYWG 477

Query: 492 AYYALFFMVVIILIQGFTAFAPT-FSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHR-- 548
           +++A+   V++++ Q + A AP    G   A  +   +L   I LGA  +F  +++H+  
Sbjct: 478 SWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGA--YFGYKVYHKDW 535

Query: 549 -----LDEVDIDTDRR--DIEAVVWDD 568
                  EVD+ + R   D E +  +D
Sbjct: 536 RLCIPASEVDLSSHRNISDEEILRQED 562

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  263 bits (673), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 157/514 (30%), Positives = 259/514 (50%), Gaps = 26/514 (5%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G    + +KR LK RH                     ++  GP+G +I +    + +  
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIG 129

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            +  LGE+    PV  AF  + +RFL P+       +Y   W     LE+      +++W
Sbjct: 130 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
            +++    W+ IF+ ++   NLF V+ +GE EF  + IK I + GFII C+ ++CG G  
Sbjct: 190 NSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPD 249

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
              +G +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P 
Sbjct: 250 HEFIGAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP- 297

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K +P AIK+V +RIL F+      +G LVPY +  L    S V +SPF+IAI+    K L
Sbjct: 298 KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKAL 356

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P I NAV+L +++S GNS ++  SR +  +A   L P +FG  + AG P   +   S FG
Sbjct: 357 PSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 416

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++  S   +  FNWL+ I G+A    W+ I+  HIRF  A+K +G S D+L F +  
Sbjct: 417 LLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAV 476

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPT---FSGVD----FAAAYVSVFLFIAIWLGAQIW 540
             W + Y+     +I++ Q + +  P     SG +    F   Y+   + + I++  +I+
Sbjct: 477 GIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIY 536

Query: 541 FRCRI-----FHRLDEVDIDTDRRDIEAVVWDDE 569
           ++C+         L ++D++TDR+DI+  +   E
Sbjct: 537 YKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQE 570

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  262 bits (670), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 163/521 (31%), Positives = 276/521 (52%), Gaps = 16/521 (3%)

Query: 69  EGQ---VHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATL 125
           EGQ   + E   +R L  R                    T + + GP   LIA+   + +
Sbjct: 34  EGQAPSLEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVV 93

Query: 126 VYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185
              + Q +  M T++PVT +F  F+ RF+  + G + G+ Y+   A     E++ V  ++
Sbjct: 94  FIGLSQCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVV 153

Query: 186 EFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245
           EFWT  +P AA I+I   L    NLF V  +GE EF+++  KVI  +G I + + ++ G 
Sbjct: 154 EFWTDKIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGG 213

Query: 246 GITGPV-GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 304
                V GF+ W NPGA+    ISK  + G+F G++S LI A + + G + +G  A EA 
Sbjct: 214 NPQHKVLGFKNWSNPGAFAE-YISKG-SAGKFHGFMSCLIFALYVFWGVDYLGNAASEAM 271

Query: 305 NPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY----VSSSPFIIAIE 360
           NPRK +P + +KV  R+++FY   A+ +G+LVP+ND  +  + S       +SP++ A++
Sbjct: 272 NPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMK 331

Query: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420
             G  VLPHI N ++LT+IISAGNS++Y  SR+++ LA    AP  F +    GVP +  
Sbjct: 332 TLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLF-KITKRGVPIYCC 390

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
                   LAY+ +S    +   W LN+   A    ++ I   +++F +  K + I    
Sbjct: 391 VAVLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKT 450

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQI 539
           LP+ + F+P+L +++LF++V+++ + G+  F   ++    F  +Y  +  FI ++ G ++
Sbjct: 451 LPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKL 510

Query: 540 WFRCRIFHRLDEVDIDTDRRDI--EAVVWDDEPPK-TLWDK 577
           + + R F +  E+D+ +   ++  E   W++ PPK  L DK
Sbjct: 511 YKKTR-FVKPVEMDLFSGIAELAEEDAYWEENPPKMNLLDK 550

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  262 bits (670), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 171/536 (31%), Positives = 283/536 (52%), Gaps = 25/536 (4%)

Query: 67  VKEGQVHEAE-----VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLF 121
           V +G V + E     + R LK RH                     LS  GP   LIAY  
Sbjct: 36  VSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAV 95

Query: 122 MATLVYSVVQSLGEMATFIPVTSAFTVFS--SRFLSPAFGAASGYMYWFSWAITFALELS 179
           M+  V+SV+  + EM T IP+    T++S    +++       G+  +++ A+    E++
Sbjct: 96  MSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVT 155

Query: 180 VVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCL 239
               ++++WT A P A +I+IF VL     + PVK +GE EFW++ IK++ +VG II  +
Sbjct: 156 ACALLVQYWTDANP-AIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGV 214

Query: 240 CMVCGAGITGP--VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGT-ELV 296
            +  G G      +GF YW+ PGA+ P ++  +   G+FL + +++I + F++    E+V
Sbjct: 215 VIFFGGGPAQEHVLGFHYWKKPGAFKPYLV--EGGTGKFLAFWTAIIKSGFSFVLVPEIV 272

Query: 297 GITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPY-NDPKLNSSDSYVSSS-- 353
              A EA  PR+++PRA K+ ++R+ +FY    + +G++V Y ND  LN+  S  SS+  
Sbjct: 273 SSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAA 332

Query: 354 -PFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNA 412
            PF+I I+ +G +VLPHI NA +LT+  S G   +Y  SR ++ +A    AP      N 
Sbjct: 333 SPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNK 392

Query: 413 AGVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALK 472
            GVPY+    TS F  LAY+  S   +  FNWL NI  ++GF +WVL+S  +IRF   + 
Sbjct: 393 YGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVID 452

Query: 473 YRGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAP-TFSGVDFAAAYVSVFLFI 531
              ++ D +PF+  +   LAY A+ F  ++ L  GF  F    +   +F AAY+++   +
Sbjct: 453 VLKLN-DRIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVL 511

Query: 532 AIWLGAQIWF---RCRIFHRLDEVDI--DTDRRDIEAVVWDDEPPKTLWDKFWNIV 582
            +++G+ I++   RCR    +++ DI       + E   +D   P+   +K W ++
Sbjct: 512 VLFVGSTIYYKEWRCRDIAEIEQ-DILPKITLAEAEEYEYDIPVPRNWLEKIWMVI 566

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  263 bits (673), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 167/515 (32%), Positives = 271/515 (52%), Gaps = 19/515 (3%)

Query: 72  VHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQ 131
           V  A +K+ALK RH                     LSNAGP   LI Y  ++   Y +VQ
Sbjct: 94  VSNAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVSVNTYFMVQ 153

Query: 132 SLGEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
           + GE+A   P +  +F  ++S+ +S  FG A+ ++++  W   F +EL  +   + FWTT
Sbjct: 154 AAGELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMTFAVRFWTT 213

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITG 249
            V    ++ IF+V L + +   V+ YGE EF++   KV+ ++GF+I+ +C+  G AG +G
Sbjct: 214 RVDADVFVLIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAICVAAGGAGDSG 273

Query: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
            +G +YW +PGA+          EGRF G    L++A F+Y GTEL  ++  E  NPRK+
Sbjct: 274 YIGAKYWHDPGAF-----VSHTAEGRFKGVCYVLVSAYFSYGGTELFVLSVNEQENPRKT 328

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSS----DSYVSSSPFIIAIENSGTK 365
           +P A K  ++RI+  Y    V +G  VP N P+L  S    +   S SP+++A      +
Sbjct: 329 IPTATKTTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVLAASYHHVR 388

Query: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425
           VLPH  NAVV+  ++S  NS +Y   R++  LA+    P +F   +  G P  A+     
Sbjct: 389 VLPHFINAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGRPTRALVLCFI 448

Query: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485
            G +A+   S    + F+WL  I G++  FTW  I   H+RF  A+K +G   ++L +K+
Sbjct: 449 IGVIAFASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQGKDINELGYKS 508

Query: 486 KFMPWLAYYALFFMVVIILIQGFTAFAPTFSG-----VDFAAAYVSVFLFIAIWLGAQIW 540
               W + Y +FF +++   Q + A +   SG      DF  +Y+++ +++  ++G  +W
Sbjct: 509 NTGVWGSAYGVFFSLLVFAAQFWVALSAPNSGGKCSASDFFQSYLALPIWLTFYVGFMLW 568

Query: 541 FRCRIFH-RLDEVDIDTDRR--DIEAVVWDDEPPK 572
            R   F   L++VD+D+ RR  D E +  +DE  K
Sbjct: 569 TRDFTFLIPLNKVDLDSYRRYYDPELLRQEDEEHK 603

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  262 bits (669), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 167/496 (33%), Positives = 267/496 (53%), Gaps = 20/496 (4%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
              ++ E+ + R+L  RH                  +  L   GP    I Y  M  +VY
Sbjct: 49  DHDKIRES-LNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVY 107

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
             +  LGEM+TF+P++ +F  ++ +F   +F  A    YWF+ A++ A +L+ +  ++++
Sbjct: 108 LTMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDY 167

Query: 188 WTTA---VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG 244
           W ++    P  A   +FWV L   N+  V+ YGE E+W+A +KVIA+V F I  + +  G
Sbjct: 168 WKSSQHNFPYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVG 227

Query: 245 AGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303
                  +GF+YW    A  P +         F G+V+  +++AF+Y GTE + +TAGEA
Sbjct: 228 HNPDHEYIGFKYWSYKEA--PFV-------NGFKGFVTIFVSSAFSYGGTESITLTAGEA 278

Query: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSG 363
            NP ++ PR +K V +RIL+FY     FI + +PY+ P L++    V +SPF I  + +G
Sbjct: 279 RNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNLSTKS--VMTSPFTIIFQMAG 336

Query: 364 TKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLA-PSFFGRTNAAGVPYFAVFF 422
           TK      NAV+LT+I+SAGN  ++ GSR++Y +       P    +TN    PY AV  
Sbjct: 337 TKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVIL 396

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           T A G L +     G  + + WL NI GV+    W+ I+   IRF + L  +G ++ +L 
Sbjct: 397 TWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ-ELQ 455

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFR 542
           FK    P+  Y+ + F+ +IIL+QG++AF P +S  DF + Y+ +F+F   WL   I+ R
Sbjct: 456 FKNWTYPYGPYFLVIFVTLIILVQGWSAFDP-WSTSDFFSYYLELFVFPTCWLIWWIFKR 514

Query: 543 CRIFHRLDEVDIDTDR 558
            R F + +++D  TDR
Sbjct: 515 DR-FVKPEDMDFITDR 529

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  265 bits (676), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 160/515 (31%), Positives = 270/515 (52%), Gaps = 22/515 (4%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
           E+K+ +K RH                   + L  AGP G +I +  M + +Y ++Q++GE
Sbjct: 157 ELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGE 216

Query: 136 MA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPM 194
           +A  +  +   F  + S  +  AF  A  ++Y   W     LEL      I++WTT V  
Sbjct: 217 LAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDP 276

Query: 195 AAWITIFWVLLTVSNLFP-VKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVG 252
             ++ IF++L+   NL      Y E EF     K++ ++GF I  + ++CG AG  G +G
Sbjct: 277 DIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIG 336

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
            +YW +PGA     +  D +  RF G +++L+NAAF +  +E +G+TA E +NPRK++P 
Sbjct: 337 AKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPS 391

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTKVLPHIF 371
           A KK+++RIL  +      +G LVPYN D  L S+ S V +SP+++AI   G +V+PH  
Sbjct: 392 AAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPHFI 451

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           NAV+L +++S  NS  Y  SR++  LA+   AP  +   +  G P   +   + FG +A+
Sbjct: 452 NAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAF 511

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
              S      F WLL I+G++  FTW+ I   HIRF +A+  +G S  +L F+++   + 
Sbjct: 512 CATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYG 571

Query: 492 AYYALFFMVVIILIQGFTAFAP-------TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC- 543
           + YA   M +I++ Q + A  P            +F   Y+++ + +A + G +IW +  
Sbjct: 572 SAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKDW 631

Query: 544 RIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKF 578
           ++F R   +D+ + R      ++D+E  K   D++
Sbjct: 632 KLFIRAKNIDLISHRN-----IFDEELIKQEEDEY 661

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  262 bits (670), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 160/515 (31%), Positives = 257/515 (49%), Gaps = 26/515 (5%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           ++G    + +K+ LK RH                     L+  GP+  +I +    + + 
Sbjct: 77  EDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQII 136

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
             +  LGE+    PV  AF  +S+RFL P+       +Y   W     LE+      +++
Sbjct: 137 GTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQY 196

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           W  ++    W+ IF+V +   NLF V+ +GE EF  + IKVI + GFI+ C+ ++ G G 
Sbjct: 197 WNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGGP 256

Query: 248 TGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
               VG RYW NPG    G          F G +S ++ A+++  GTE+  + +GE  +P
Sbjct: 257 DHVYVGSRYWHNPGCLANG----------FPGVLSVMVVASYSLGGTEMTCLASGET-DP 305

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKV 366
            K +P AIK+V +RIL F+      +G LVPY +  L    S V +SPF+IAI+    KV
Sbjct: 306 -KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKIHHIKV 363

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           LP I NAV+L +I+S GNS ++  SR +  +A   L P +FG  + AG P   +   S F
Sbjct: 364 LPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLF 423

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           G LA++  S   +  F+WL+ I G+A    W+ I+  HIRF  A+K +G S ++L F + 
Sbjct: 424 GLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSA 483

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAP-------TFSGVDFAAAYVSVFLFIAIWLGAQI 539
              W + Y+     +I++ Q + +  P             F  +Y+   + + IW+G +I
Sbjct: 484 VGIWGSVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCIWIGHKI 543

Query: 540 WF-----RCRIFHRLDEVDIDTDRRDIEAVVWDDE 569
           ++     +   F  L E+D+D  R++I+  V   E
Sbjct: 544 YYWRQTGKIWAFTPLAEIDLDEGRKNIDLDVLKQE 578

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  263 bits (672), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 158/518 (30%), Positives = 274/518 (52%), Gaps = 22/518 (4%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
             +++K+ +K+RH                  +  L +AGP G +I Y  M + +Y ++Q+
Sbjct: 113 ENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQA 172

Query: 133 LGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTA 191
            GE+A  +  + S F ++ +  +  AFG A  ++Y   W     LEL      I++WTT+
Sbjct: 173 CGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 232

Query: 192 VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGP 250
           V    +++IF+VL+ V N F  + Y E EF+    KV+ + GF I  + + CG AG +G 
Sbjct: 233 VNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGY 292

Query: 251 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 310
           +G +YW +PGA+     + ++    F G +++   AAF +  +E + +TA E +NPRK++
Sbjct: 293 IGAKYWHSPGAF-----NGNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAI 347

Query: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLPH 369
           P+A K +++RIL  +      IG LVPYN P L  S      +SP+++A+ + G +V+PH
Sbjct: 348 PKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHGVRVVPH 407

Query: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429
             NAV+L +++S GNS  Y  SR++  LA+   AP  F   +  G P  A+  ++ F  +
Sbjct: 408 FINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTI 467

Query: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489
           A+   S      F WLL I+G++  FTWV I   H+RF +ALK +G S  ++ FK++   
Sbjct: 468 AFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGI 527

Query: 490 WLAYYALFFMVVIILIQGFTAFAPT----FSGVDFAAAYVSVFLFIAIWLGAQIWFRCRI 545
           + + YA   +++ ++ Q + A AP         +F   Y+++ + + ++ G +I  R   
Sbjct: 528 YGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKIRKRDWK 587

Query: 546 F----HRLDEV------DIDTDRRDIEAVVWDDEPPKT 573
           F    HR+D V      D D  ++++  +  + +   T
Sbjct: 588 FWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEKKNLST 625

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  261 bits (666), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 170/498 (34%), Positives = 263/498 (52%), Gaps = 20/498 (4%)

Query: 66  FVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATL 125
           F  E  + E ++ RAL  RH                  +  L N GP    + Y  +  +
Sbjct: 36  FDPEQNIRE-DLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGV 94

Query: 126 VYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185
           VY  +  LGEM+TF+P++ +F  ++ +F S +F  A  + YWF+ A++ A +L+ +  ++
Sbjct: 95  VYLTMLCLGEMSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVL 154

Query: 186 EFWTTA---VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMV 242
           ++W TA    P      IFW  +   N+  V+ YGE E+W+A +KVIA+V F I  + + 
Sbjct: 155 DYWHTADHHFPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVN 214

Query: 243 CGAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAG 301
            G       +GF+ W +  A  P +         F G+ S  ++A F Y GTE + +T G
Sbjct: 215 VGKNPQHEYIGFKNWTHGEA--PFV-------NGFKGFASLFVSACFAYGGTESITLTGG 265

Query: 302 EAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIEN 361
           EA+NP ++ P+ +K V +RIL+FY     FIG+ +PY+ P L++    V +SPF +  + 
Sbjct: 266 EASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYDYPGLSTKS--VMTSPFTLVFQM 323

Query: 362 SGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAP-SFFGRTNAAGVPYFAV 420
           +GT+      NAV+LT++ISA N  ++ GSRIMY +A     P    GRTN    PY AV
Sbjct: 324 AGTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAV 383

Query: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480
             T A G L       G  + + WL NI GV+    W+ I    IRF + L+ +G   D 
Sbjct: 384 LITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQG-KTDL 442

Query: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIW 540
           L FK    P+  Y+ + F V IILIQG+ AF P +S  DF + Y+ +F+F  +++   +W
Sbjct: 443 LQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDP-WSVTDFFSVYLELFVFPFVYIIWWLW 501

Query: 541 FRCRIFHRLDEVDIDTDR 558
            R   F + +++D  TDR
Sbjct: 502 KR-DWFVKYEDMDFVTDR 518

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  261 bits (668), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 153/514 (29%), Positives = 257/514 (50%), Gaps = 26/514 (5%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G    + +KR LK RH                     ++  GP+G ++ +    + +  
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 129

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            V  LGE+    PV  AF  + +RFL P+       +Y   W     LE+      +++W
Sbjct: 130 TVHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
            +++    W+ IF+ ++   NLF  + +GE EF  + +K I + GFII C+ ++CG G  
Sbjct: 190 NSSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPD 249

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
              +G +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P 
Sbjct: 250 HEFIGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP- 297

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K +P AIK+V +RI+ F+      +G LVPY +  L    S V +SPF+IAI+    KVL
Sbjct: 298 KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVL 356

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P I NAV+L +++S GNS ++  SR +  +A   L P +FG  + AG P   +   S FG
Sbjct: 357 PSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 416

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++  S   +  FNWL+ I G+A    W+ I+  H+RF  A+K +G S D+L F +  
Sbjct: 417 LLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAV 476

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVD-------FAAAYVSVFLFIAIWLGAQIW 540
             W + Y+     +I++ Q + +  P             F   Y+   + + I++  +I+
Sbjct: 477 GIWGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIFVIHKIY 536

Query: 541 FRCRI-----FHRLDEVDIDTDRRDIEAVVWDDE 569
           +RC++        L ++D++TDR+DI+  +   E
Sbjct: 537 YRCQMGKWWGVKELKDIDLETDRKDIDIEIVKQE 570

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  261 bits (667), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 155/504 (30%), Positives = 253/504 (50%), Gaps = 26/504 (5%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G  H   +K++LK RH                     L+  GP+  +I +    T +  
Sbjct: 65  DGSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVG 124

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            +  LGE+    PV  AF  + +RFL P+       +Y   W     LE+      +E+W
Sbjct: 125 TIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYW 184

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
            ++VP  AW+ IF+  + + NL  V+ +GE EF  + IKV+ ++GFII C+ ++CG G  
Sbjct: 185 GSSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPK 244

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
              VG +YW +PG    G          F G  +  + A+++  GTE+  + +GE  +P 
Sbjct: 245 HEFVGAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMACLASGET-DP- 292

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K +P AIK+V +RI+ F+      +G LVPY +  L    S V +SPF+IAI   G K L
Sbjct: 293 KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSS-VDNSPFVIAIRLHGIKAL 351

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P + NAV+L +++S GNS ++  SR +  +A   L P  FG  + AG P   +    AFG
Sbjct: 352 PSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFG 411

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++  S+     F WL+ I G+A    W+ I+  HIRF  A+K +G+S D+L F +  
Sbjct: 412 LLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAV 471

Query: 488 MPWLAYYALFFMVVIILIQGFTAF-------APTFSGVDFAAAYVSVFLFIAIWLGAQIW 540
             + + Y+    V+I++ Q + +        +P+    +F   Y+   + + ++ G +I+
Sbjct: 472 GVYGSVYSATINVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFAGHKIY 531

Query: 541 FRCRI-----FHRLDEVDIDTDRR 559
           +R        F  L ++D+ TD R
Sbjct: 532 YRISTGKWWGFKALRDIDLLTDMR 555

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  260 bits (664), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 175/521 (33%), Positives = 269/521 (51%), Gaps = 20/521 (3%)

Query: 67  VKEGQVH--EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMAT 124
           +K+G +H    ++K+ LK+RH                     L   GPVG LIAYLF+  
Sbjct: 32  LKQGVLHNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGI 91

Query: 125 LVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFAL----ELSV 180
           +V     ++ E+A+F+P T A    + +F+  + G      + F W  T++     ELS 
Sbjct: 92  VVGCNQIAIAEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSA 145

Query: 181 VGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLC 240
              I+ +WT   P A +ITIF VL  V+N++ +++YGE E+   ++K+I +   II  L 
Sbjct: 146 TAVIMRYWTDISP-AVFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGLV 204

Query: 241 MVCGAGITGP--VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGI 298
           +  G G+ G   +GF YWR+PG +   I+    + G+F+G+ S+L +  ++Y G + + I
Sbjct: 205 IDLG-GVKGQERLGFHYWRDPGPFAEYIVGG--SIGKFVGFWSALSSVVYSYSGIQNIAI 261

Query: 299 TAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIA 358
            AGE  N R ++    K V  RI+V Y      + L+VPYND  + S      SSPF+IA
Sbjct: 262 LAGETKNSRHAIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALIASGTGTAKSSPFVIA 321

Query: 359 IENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYF 418
           +  +G KVLPHI NA+VLT+  SAGN  +  GSR ++ LA    AP  F +T+  G+PY 
Sbjct: 322 MNRAGIKVLPHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYV 381

Query: 419 AVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISR 478
            V F S F  LAYM  S   ++ F W   +        W+LISA HI   +ALK +G SR
Sbjct: 382 GVIFISCFLPLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSR 441

Query: 479 DDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAP-TFSGVDFAAAYVSVFLFIAIWLGA 537
            DLP+     P+ A+++     + +L  GF  F    F    F   Y  + L I ++   
Sbjct: 442 SDLPYSTPIAPYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFW 501

Query: 538 QIWFRCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKF 578
           +++ + R + R +EVD+ +   DI       E  K +W + 
Sbjct: 502 KLFKKTR-YLRPEEVDLASIFDDIRENPEHIEKSKPIWARL 541

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  260 bits (664), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 160/510 (31%), Positives = 256/510 (50%), Gaps = 17/510 (3%)

Query: 77  VKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEM 136
           +KR++K RH                     L   GP G +I Y  ++ + Y ++Q+ GEM
Sbjct: 83  LKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEM 142

Query: 137 ATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMA 195
           A   P +   F  +SS+ +S  FG A+ ++Y   W     LEL      I++W  ++   
Sbjct: 143 AVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINAD 202

Query: 196 AWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVGFR 254
            +I IF+V +   + F  + YGE EF     KV+ ++GF+I  + + CG AG    +G +
Sbjct: 203 VFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAK 262

Query: 255 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 314
           YW +PGA+  G         +F G    L+   F+Y GTEL  +T  E +NPR+++    
Sbjct: 263 YWYDPGAFAVG-----SGATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSIT 317

Query: 315 KKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFIIAIENSGTKVLPHIFN 372
           K+ ++RIL+ Y    + IG LVP+   +L  +S  S   +SP+++A+   G K++PHI N
Sbjct: 318 KQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIIN 377

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           AV+L  +IS GNS +Y G RI+  LA+   AP F    + AG P  A+   S FG LA++
Sbjct: 378 AVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFV 437

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
             S      F WL  I G++  FTW  I   H+RF QA++Y      +L +KA      +
Sbjct: 438 AASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGS 497

Query: 493 YYALFFMVVIILIQGFTAFAP-----TFSGVDFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
              L F +++ + Q + + AP         + F  +Y++  L++ ++ G  I FR   I 
Sbjct: 498 VLGLSFNILVFIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEII 557

Query: 547 HRLDEVDIDTDRR--DIEAVVWDDEPPKTL 574
             L ++D+D  R   D + +  +D   K L
Sbjct: 558 KPLKDIDLDHYRSIYDQDRLYQEDLEHKIL 587

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  258 bits (659), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 162/514 (31%), Positives = 259/514 (50%), Gaps = 26/514 (5%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G  H   +KR LK RH                     L+  GP+  +I +    + +  
Sbjct: 62  DGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVG 121

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            +  LGE+    PV  AF  +S+R L P+       +Y   W     +EL      ++FW
Sbjct: 122 TIHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFW 181

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           TT V    W+ IF+V++   NLF VK +GE EF  + +KVI ++GFII  + ++CG G  
Sbjct: 182 TTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPD 241

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
              +G  YW +PGA   G          F G  S  + A+++  G+E+V + + E  +P 
Sbjct: 242 HRFIGTEYWHHPGALANG----------FKGVASVFVTASYSLGGSEMVCLCSAET-DP- 289

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K +P AIK+V +RI+ F+      +G LVPY +  L    S V++SPF+IAI+ SG +VL
Sbjct: 290 KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSS-VNNSPFVIAIKLSGIRVL 348

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P I NAV+L +I+S GNS ++  SR +  +A   L P  FG  + AG P   +   S FG
Sbjct: 349 PSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFG 408

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++  S      F+WL+ I G+A    W+ I+  HIRF  A+K +  S D+L FK+  
Sbjct: 409 LLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSV 468

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPT-------FSGVDFAAAYVSVFLFIAIWLGAQIW 540
             + + Y+    ++I++ Q + +  P             F   Y+   + + +++  +I+
Sbjct: 469 GVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIY 528

Query: 541 FRCRI-----FHRLDEVDIDTDRRDIEAVVWDDE 569
           F+C       F  L E+D++TDR++I+  +   E
Sbjct: 529 FKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQE 562

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  258 bits (659), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 154/514 (29%), Positives = 255/514 (49%), Gaps = 26/514 (5%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G    + +KR LK RH                     ++  GP+G ++ +    + +  
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 129

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            +  LGE+    PV  AF  + +RFL P+       +Y   W     LE+      +++W
Sbjct: 130 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
            +++    W+ IF+V++   NLF V+ +GE EF  + IK I + GFII C+ ++ G G  
Sbjct: 190 NSSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPD 249

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
              VG +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P 
Sbjct: 250 HEYVGAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLASGET-DP- 297

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K +P AIK+V +RIL F+      +G LVPY +  L    S V +SPF+IAI+    KVL
Sbjct: 298 KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVL 356

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P I N V+L +++S GNS ++  SR +  +A   L P +FG  + AG P   +   S FG
Sbjct: 357 PSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 416

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++  S      FNWL+ I G+A    W+ I+  HIRF  A+K +G   D+L F +  
Sbjct: 417 LLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAV 476

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAP-------TFSGVDFAAAYVSVFLFIAIWLGAQIW 540
             W + Y+     +I+L Q + +  P       +     F   Y+   + + I++  +I+
Sbjct: 477 GIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIY 536

Query: 541 FRCRI-----FHRLDEVDIDTDRRDIEAVVWDDE 569
           ++C+         L ++D++TDR++I+  +   E
Sbjct: 537 YKCQTGQWWGIKALKDIDLETDRKNIDIEIVKQE 570

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  257 bits (657), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 153/514 (29%), Positives = 258/514 (50%), Gaps = 26/514 (5%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G    + +KR LK RH                     ++  GP+G ++ +    + +  
Sbjct: 71  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 130

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            +  LGE+    PV  AF  + +RFL P+       +Y   W     LE+      +++W
Sbjct: 131 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 190

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
            +++    W+ IF+ ++   NLF  + +GE EF  + +K I + GFII  + ++CG G  
Sbjct: 191 NSSIDPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPD 250

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
              +G +YW +PG    G          F G ++ L+ A+++  G E+  + +GE  +P 
Sbjct: 251 HEFIGAKYWHDPGCLANG----------FPGVLAVLVVASYSLGGIEMTCLASGET-DP- 298

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K +P AIK+V +RIL F+      +G LVPY +  L    S V +SPF+IA++    KVL
Sbjct: 299 KGLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAMKLHHIKVL 357

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P I NAV+L +++S GNS ++  SR +  +A   L P +FG  + AG P   +   S FG
Sbjct: 358 PTIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 417

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++  S   A  FNWL+ I G+A    W+ I+  HIRF  A+K +G S D+L F +  
Sbjct: 418 LLAFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAV 477

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPT---FSGVD----FAAAYVSVFLFIAIWLGAQIW 540
             W + Y+     +I++ Q + +  P     SG +    F   Y+   + + I++  +I+
Sbjct: 478 GIWGSAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIY 537

Query: 541 FRCRI-----FHRLDEVDIDTDRRDIEAVVWDDE 569
           ++C+         L ++D++TDR+DI+  +   E
Sbjct: 538 YKCQTGKWWGVKSLKDIDLETDRKDIDIEIIKQE 571

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  254 bits (650), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 160/495 (32%), Positives = 254/495 (51%), Gaps = 27/495 (5%)

Query: 26  SSSGQAGAINHRK-KSVVSKTTAVXXXXXXXXXXXXXXXXXFVKEGQVH--EAEVKRALK 82
           S SG+A  ++  K KS + +T                      K+G ++     +K+ LK
Sbjct: 2   SESGEASGLSQEKVKSKICETNVDEQELECGSET--------AKQGVLYNDRTRLKQGLK 53

Query: 83  QRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEMATFIPV 142
           +RH                     L   GPVG LIAYLF+  +V     ++ E+A+F+P 
Sbjct: 54  ERHIKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPA 113

Query: 143 TSAFTVFSSRFLSPAFGAASGYMYWFSWAITFAL----ELSVVGQIIEFWTTAVPMAAWI 198
           T A    + +F+  + G      + F W  T++     ELS    I+++WT   P A +I
Sbjct: 114 TGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSATAVIMKYWTDVSP-AVFI 166

Query: 199 TIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP--VGFRYW 256
           T+F VL   +N++ +++YGE E+   ++K++ +   II  L +  G G+ G   +GF YW
Sbjct: 167 TVFGVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLG-GVKGQERLGFHYW 225

Query: 257 RNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKK 316
           R+PG +   +++   + G+F+G+ +++ +  ++Y G + + I AGE  N R ++    K 
Sbjct: 226 RDPGPFANYLVAG--HIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKN 283

Query: 317 VVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFNAVVL 376
           V  RI+V Y      + L+VPYND  + +      SSPF+IA+  +G KVLPHI NA++L
Sbjct: 284 VFLRIIVLYLVTVFVLTLIVPYNDKLIATGTGTAKSSPFVIAMNRAGIKVLPHIVNALIL 343

Query: 377 TTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYMELST 436
           T+  SAGN  +  GSR ++ LA    AP  F +T+  G+PY  V F S+F  LAYM  S 
Sbjct: 344 TSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFLPLAYMSCSE 403

Query: 437 GGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAYYAL 496
             A+ F W   +        W+LISA HI   +ALK +G SR DLP   +  P+ A+++ 
Sbjct: 404 SSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRIAPFAAWFSG 463

Query: 497 FFMVVIILIQGFTAF 511
              V+ +   GF  F
Sbjct: 464 IMSVIFLFTGGFYNF 478

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  257 bits (656), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 156/514 (30%), Positives = 256/514 (49%), Gaps = 26/514 (5%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G    + +KR LK RH                     L+  GP+  +I +    + +  
Sbjct: 55  DGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVG 114

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            +  LGE+    PV  AF  +S+RFL P+       +Y   W     LE+      I++W
Sbjct: 115 TIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYW 174

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
            +++    W+ IF+ ++   NLF  + +GE EF  + IK I + GFII C+ ++CG G  
Sbjct: 175 NSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPD 234

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
              +G +YW +PGA   G          F G +S L+ A+++  GTE+  + +GE  +P 
Sbjct: 235 HEFIGAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEMTCLASGET-DP- 282

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K +P AIK+V +RIL F+      +G LVPY +  L    S V +SPF+IAI+    K L
Sbjct: 283 KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKLHHIKAL 341

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           P I NAV+L +I+S GNS ++  SR +  +A   L P FFG  + AG P   +   S FG
Sbjct: 342 PSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFG 401

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++  S+  +  F+WL+ I G+A    W+ I+  HIRF  A+K +  + D+L F +  
Sbjct: 402 LLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAV 461

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVD-------FAAAYVSVFLFIAIWLGAQIW 540
             W + Y+    V+I++ Q + +  P     D       F  +Y+   + + I+   +++
Sbjct: 462 GIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVY 521

Query: 541 FRCRI-----FHRLDEVDIDTDRRDIEAVVWDDE 569
           +R           L ++D++T R++++  V   E
Sbjct: 522 YRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAE 555

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  256 bits (655), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 160/505 (31%), Positives = 264/505 (52%), Gaps = 25/505 (4%)

Query: 75  AEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLG 134
           A++K+ +K RH                   + L+ AGP G ++ Y+  + ++Y +V++ G
Sbjct: 63  AKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAG 122

Query: 135 EMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           E+   +  +T  +T +SS  + PA G +  ++Y   W   F L+L     II++WT   P
Sbjct: 123 ELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTDINP 182

Query: 194 MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITGPVG 252
              ++ I + ++   NLF  K Y E EF+    KV+ ++GF+I  + + CG AG +G +G
Sbjct: 183 -DIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIG 241

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
            +YW  P  +  G          F G       AAF Y G E++ ++A E  NPRKS+  
Sbjct: 242 DKYWHEPRPFMNG----------FKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISS 291

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFN 372
           A KKV++RI++ Y    V +  LVP + P L S  S   +SP +IA+   G K++PHI N
Sbjct: 292 ACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS--RASPLVIAVSFHGVKIVPHIIN 349

Query: 373 AVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYM 432
           AV+L  ++S GNS++Y   R++  LA+   AP  F   +  G P  A F    FG LA++
Sbjct: 350 AVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFL 409

Query: 433 ELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLA 492
             S      F WLL I+G++  F W+ I   HIRF  A+K +G S  ++ +KA+   W +
Sbjct: 410 AASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGS 469

Query: 493 YYALFFMVVIILIQGFTAFAPTFS-GVD---FAAAYVSVFLFIAIWLGAQIWFRC-RIFH 547
           + A+    +I++ Q + A +P  + GVD   F  +Y++  + +  + G +I+ +  RI  
Sbjct: 470 WIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDWRICI 529

Query: 548 RLDEVDIDTDRRDIEAVVWDDEPPK 572
              EVD+ + R+     V+D++  K
Sbjct: 530 PASEVDLISHRQ-----VFDEDELK 549

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  256 bits (654), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 154/524 (29%), Positives = 271/524 (51%), Gaps = 30/524 (5%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
           ++ R LK RH                     LS  GP   LIAY+ ++  V+S++  + E
Sbjct: 54  KIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTE 113

Query: 136 MATFIPVTSAFTVFS--SRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           M   IP+    +++S    +L+       G+  +++ A+    E++    ++++WT A  
Sbjct: 114 MVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWTDA-N 172

Query: 194 MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP--V 251
            A +I+IF V+  +  + PVK +GE EFW++ IK++ +VG II  + +  G G      +
Sbjct: 173 SAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVL 232

Query: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGT-ELVGITAGEAANPRKSV 310
           GF YW+NPGA+ P +   + N GRFL   +++I + F++    E V   + E   PR+++
Sbjct: 233 GFHYWKNPGAFNPHL--AEGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNM 290

Query: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL----NSSDSYVSSSPFIIAIENSGTKV 366
           P+A ++ ++R+ +FY    + +G++V +N+ +L     S  S  ++SPF+I I+ +G K+
Sbjct: 291 PKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKI 350

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           LPHI NA +LT+  S G   +Y  SR +Y +A    AP  F + N  G PY++    S F
Sbjct: 351 LPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLF 410

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
             LAY+  S   +  FNWL NI  ++GF +W+ +S  +IRF + +    ++ D +PF+  
Sbjct: 411 SFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRRP 469

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAP-TFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRI 545
           F   LAY    F  ++ L  G+  F    ++  DF A+YV++   I ++L    +++   
Sbjct: 470 FQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYKQWT 529

Query: 546 FHRLDEVDI----------DTDRRDIEAVVWDDEPPKTLWDKFW 579
           F    E+++          + +R D+  V      P+   +K W
Sbjct: 530 FRDFKEIEVEILPKIDIADEEERNDVIPV------PRNFMEKVW 567

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  258 bits (659), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 159/492 (32%), Positives = 261/492 (53%), Gaps = 14/492 (2%)

Query: 76  EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLGE 135
           E+K+ +K RH                   + L  AGP G L+ +  M T +Y ++Q++GE
Sbjct: 148 ELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGE 207

Query: 136 MAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPM 194
           MA  +  +   F  + S  + PAFG +  ++Y   W     LEL      I++WTT V  
Sbjct: 208 MAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTKVDP 267

Query: 195 AAWITIFWVLLTVSNLFP-VKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT-GPVG 252
             ++ IF+VL+   N+      Y E EF     K++ ++GF I  + ++CG     G +G
Sbjct: 268 DVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIG 327

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312
            +YW  PGA+       +    RF G +++L+NAAF +  +E +G+TA E +NPRK++P 
Sbjct: 328 GKYWHEPGAF-----RGEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPS 382

Query: 313 AIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTKVLPHIF 371
           A KK+++RI+  +      +G LVPY+ D  L SS   V +SP+++A+   G KV+PH  
Sbjct: 383 AAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVVPHFI 442

Query: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431
           NAV+L +++S  NS  Y  SR++  LA+   AP  F   +  G P   +   S FG +A+
Sbjct: 443 NAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAF 502

Query: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491
              S      F WLL I+G++  FTW+ I   H+RF +A+  +G S  +L F+++   W 
Sbjct: 503 CATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWG 562

Query: 492 AYYALFFMVVIILIQGFTAFAPTFSG----VDFAAAYVSVFLFIAIWLGAQIWFRC-RIF 546
           + YA   MV I++ Q + A AP   G     +F   Y+++ + +A++ G +I+ +   IF
Sbjct: 563 SSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIF 622

Query: 547 HRLDEVDIDTDR 558
            R  ++D+ + R
Sbjct: 623 IRAKDIDLVSHR 634

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  256 bits (653), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 159/527 (30%), Positives = 256/527 (48%), Gaps = 29/527 (5%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +G    + +KRALK RH                     L+  GP+  +I +    T +  
Sbjct: 70  DGSFDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIG 129

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            +  LGE+   +PV  AF  +S+RFL P+       +Y   W     LE+      + FW
Sbjct: 130 TIHGLGELTVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFW 189

Query: 189 TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT 248
           T +V    W+ +F+ ++   NL  V+ +GE EF  + +KVI + GFII C+ ++ G G T
Sbjct: 190 TQSVDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPT 249

Query: 249 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 307
              VG RYW +PG    G          F G  + ++ A+++  G+E+  + +GE  +P 
Sbjct: 250 HQYVGSRYWHDPGPLANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP- 297

Query: 308 KSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVL 367
           K +P AIK++ +RIL F+      +G LVPY +  L    S   +SPF++A+     KV+
Sbjct: 298 KELPHAIKQIFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-AENSPFVLALYLHHVKVV 356

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           PHI N V+L +I+S GNS ++  SR +  +A   L P  FG  +  G P   +   S FG
Sbjct: 357 PHIVNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFG 416

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            LA++   +  ++ F+WL+ I G+A    W+ I+  H+RF  A+K +  S D+L F +  
Sbjct: 417 LLAFLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSV 476

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSGVD-------FAAAYVSVFLFIAIWLGAQIW 540
             W + YA     + ++ Q + A  P     D       F   Y+   + IA++   + +
Sbjct: 477 GVWGSVYAGVLNFLTLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCY 536

Query: 541 FRCRI-----FHRLDEVDIDTDRRDIEAVVWDD---EPPKTLWDKFW 579
           FR          +L EVD+DT R +I+  +  +   E  K L +K W
Sbjct: 537 FRITTGKWWGIKKLSEVDLDTGRVNIDIEIIKEEVAERKKFLRNKAW 583

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  255 bits (652), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 169/509 (33%), Positives = 263/509 (51%), Gaps = 13/509 (2%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           E       +K+ ++ RH                     L N GP   +I Y  +++++Y 
Sbjct: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132

Query: 129 VVQSLGEMAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           V+QS  E+A  +  +   F  + S  +  AFG +  ++Y   W     LEL      I++
Sbjct: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AG 246
           W   +   A++TIF+V+L   N      Y E EF+    KV+ ++GF I  + + CG AG
Sbjct: 193 WNQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAG 252

Query: 247 ITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
             G +G RYW +PGA+         +  RF G V+ L+NAAF Y G E   +TA E  NP
Sbjct: 253 NDGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTK 365
           +KS+  A KK+V+RIL  Y   A+ +G LVP+N D  L S  S   +SPF+IA+ + G +
Sbjct: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367

Query: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425
           V+PH  NAV+L +++S  NS +Y  SRI+  L++   AP F    +  G P   +  +  
Sbjct: 368 VVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCV 427

Query: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485
           FG L+++  S    + F WLL I+G++  FTW  IS  H+R  +A+  +G S D+L + A
Sbjct: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487

Query: 486 KFMPWLAYYALFFMVVIILIQGFTAFAPTFSGV----DFAAAYVSVFLFIAIWLGAQIWF 541
               W AYYA+  +V I++ Q + A +P  S      +F   Y+++ + I ++LG +IW 
Sbjct: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547

Query: 542 RC-RIFHRLDEVDIDTDRRDIEAVVWDDE 569
           R  R+     EVD+   R+  +A V   E
Sbjct: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHE 576

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  254 bits (650), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 157/535 (29%), Positives = 275/535 (51%), Gaps = 28/535 (5%)

Query: 66  FVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATL 125
            + E   H+  ++R LK RH                     LS  GP   LI+Y+ M+  
Sbjct: 50  LIDEKPSHQ--MQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFF 107

Query: 126 VYSVVQSLGEMATFIPVTSAFTVFS--SRFLSPAFGAASGYMYWFSWAITFALELSVVGQ 183
           V++++  L EM    P+    ++++    +L+       G+  +++ A+    E++    
Sbjct: 108 VWTIMHQLTEMVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTL 167

Query: 184 IIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC 243
           +I++WT A   A +++IF V+       PVK +GE EFW++ IK+I + G II  + +  
Sbjct: 168 LIQYWTDA-NSAIFVSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFF 226

Query: 244 GAGITGP--VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY-QGTELVGITA 300
           G G      +GF YW++PGA+ P I     N G+FL   +++I + F +    E +   +
Sbjct: 227 GGGPNQHHVLGFHYWKHPGAFKPHI--STGNTGKFLAVWTAIIKSGFAFILSPETLTSCS 284

Query: 301 GEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL----NSSDSYVSSSPFI 356
            EA  PR+++PRA  + V+R+++FY   A+ +G+ V Y++  L     S  S  ++SPF+
Sbjct: 285 AEADRPRRNMPRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFV 344

Query: 357 IAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVP 416
           I I+  G KVLPHI NA +LT   SAG + +Y  SR+++ +A    AP  F R N  GVP
Sbjct: 345 IGIKEVGIKVLPHIINAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVP 404

Query: 417 YFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGI 476
           Y+++   S F  LAY+  S   +  F WL NI+ ++GF +WV +S  ++RF + + Y  +
Sbjct: 405 YYSIIVPSCFCFLAYLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDL 464

Query: 477 SRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAP-TFSGVDFAAAYVSVFLFIAIWL 535
           + D + F+  F    AY++  F V++ L  G+  F    +S  DF A Y+++   + +++
Sbjct: 465 N-DRIKFRKPFQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFI 523

Query: 536 GAQIWFRCRIFHRLDE--------VDIDTDRRDIEAVVWDDEPPKTLWDKFWNIV 582
               +++   F  ++E        +D+  +    E V+     P T + K  N++
Sbjct: 524 MGTAYYKEWRFRDMEEIRSELIPKIDMADEEESNEIVI----EPTTWYGKLGNVL 574

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  253 bits (645), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 154/462 (33%), Positives = 234/462 (50%), Gaps = 15/462 (3%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           + G      +KR+LK RH                     L+  GP+  +I +L   T + 
Sbjct: 68  ENGSFDPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMV 127

Query: 128 SVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
             +  LGE+    PV  AF  + +RFL P+       +Y   W     LE+      I+F
Sbjct: 128 GTIHGLGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQF 187

Query: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGI 247
           W T++    W+ IF+V +   NLF V+ +GE EF  + IKVI + GFII C+ ++ G G 
Sbjct: 188 WNTSIDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGP 247

Query: 248 TGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306
           T   VG RYW +PGA   G          F G  S  + A+++  G+E+  + +GE  +P
Sbjct: 248 THEYVGARYWHDPGALAHG----------FKGVASVFVTASYSLGGSEMACLASGET-DP 296

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKV 366
            K +P AIK+V +RI+ F+      +G LVPY +  L    S V++SPF+IA      KV
Sbjct: 297 -KELPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VNNSPFVIACNLYHIKV 354

Query: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426
           LP I NAV+L +I+S GNS ++  SR +  +A   L P  FG  + AG P   +   S F
Sbjct: 355 LPSIINAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLF 414

Query: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486
           G LA++  S+  +  FNWL+ I G+A    W+ I+  HIRF  A+K +  + D+L F + 
Sbjct: 415 GLLAFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSA 474

Query: 487 FMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVF 528
              W + Y+    V+I++ Q + +  P     D +A+ V +F
Sbjct: 475 VGIWGSVYSAVVNVLILIAQFYISLWPVGGWTD-SASRVKLF 515

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  253 bits (645), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 151/503 (30%), Positives = 262/503 (52%), Gaps = 20/503 (3%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
              ++K+++K  H                     +S+AG  G L+ Y  + +++   +QS
Sbjct: 66  ENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCMQS 125

Query: 133 LGEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTA 191
           +GE+    P +   F  +  RF+ P+FG    +++   W I   LEL      I++W  +
Sbjct: 126 VGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWNNS 185

Query: 192 VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA-GITGP 250
           +  + ++ IF+ L+   + F  + Y + EF     KV+ + GFII  + +  GA G +G 
Sbjct: 186 LNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGTSGY 245

Query: 251 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA--NPRK 308
           +G +Y + PGA+             F    S+L+NA F+  G E + ++A E A  N  K
Sbjct: 246 IGIKYLKTPGAF--------NTRNTFKSICSTLVNACFSCGGVEFLALSAAEQARGNISK 297

Query: 309 SVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVL 367
           S+ RA  +V+ R+ VFY      IGLLVPYN P+L  SS   + SSP++IA+ + G KV+
Sbjct: 298 SIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVV 357

Query: 368 PHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFG 427
           PH+ NAV+L  ++S  NS +Y  SR ++ LA+   APS+F + ++ G P+  +  +  FG
Sbjct: 358 PHLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFG 417

Query: 428 ALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKF 487
            L+++       S F WLL+I+G++  FTW +I   H+RF  A+K +  S ++L  +A  
Sbjct: 418 LLSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRAWS 477

Query: 488 MPWLAYYALFFMVVIILIQGFTAFAPTFSG-----VDFAAAYVSVFLFIAIWLGAQIWFR 542
             + +YY +    + +++Q + +  P         V+F   Y++V   + +++G +I+ R
Sbjct: 478 GIYGSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHKIYTR 537

Query: 543 C-RIFHRLDEVDIDTDRRDIEAV 564
             +     D++D+DT  RDI  V
Sbjct: 538 SWQFIIPADKIDVDTS-RDIYGV 559

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  253 bits (647), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 165/522 (31%), Positives = 264/522 (50%), Gaps = 24/522 (4%)

Query: 69  EGQVHEA-----EVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMA 123
           EG  H++      +K+A+K RH                  +  L   GP   +I Y+ ++
Sbjct: 102 EGSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLVS 161

Query: 124 TLVYSVVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVG 182
            + Y ++Q+ GEMA T+  +   F  +SS F+S AFG A+ +++   W     LEL    
Sbjct: 162 FVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELITAS 221

Query: 183 QIIEFWTTAVPMAAWITIFWVLLTVSNLFP-VKYYGEFEFWIAFIKVIALVGFIIYCLCM 241
             I++W   +    +I IF+V L   +LF  V  YGE EF     K++ ++GFII  + +
Sbjct: 222 LTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMSIVI 281

Query: 242 -VCGAGITGPVGFRYWRNPGAWGPGIISKDKNEG-RFLGWVSSLINAAFTYQGTELVGIT 299
              GAG    +G ++W +PGA+        K  G RF G    L++  F+Y GTEL  ++
Sbjct: 282 NAGGAGNREYIGGKFWHDPGAFA------GKTAGSRFKGICYVLVSGYFSYGGTELFALS 335

Query: 300 AGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIA 358
             E +NPR+S P+A K  ++RIL+ Y    + IG  VPY+ D  + S  S   +SP+++A
Sbjct: 336 VNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHASPYVLA 395

Query: 359 IENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYF 418
              +G K+ PH  NAV+L ++IS  NS++Y   R+M  LA+   AP F    +  G P  
Sbjct: 396 ASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLL 455

Query: 419 AVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISR 478
           A+      G + ++  S      F WL  I G++  FTW  I   H+RF  A+K +  S 
Sbjct: 456 ALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSL 515

Query: 479 DDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAP-TFSGVDFAAAYVSVFLFIAIWL-- 535
           ++L +KA    + + Y + F +++   Q +TA  P    G   A ++ + +L + IWL  
Sbjct: 516 EELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVF 575

Query: 536 --GAQIWFRC-RIFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572
             G  +W R  ++   LD++D+D  RR  D E +  +DE  K
Sbjct: 576 YFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESK 617

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  253 bits (647), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 149/501 (29%), Positives = 261/501 (52%), Gaps = 13/501 (2%)

Query: 73  HEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQS 132
            +A ++++++ RH                   + L  AGP G +I Y  M T +Y ++Q+
Sbjct: 123 EDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182

Query: 133 LGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTA 191
            GEMA ++  +   F  + +  +   FG A  ++Y   W     LEL      I++WTT 
Sbjct: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242

Query: 192 VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCM-VCGAGITGP 250
           V    ++ IF+VL+ + N+F  K Y E +F+    KV+ + GF I  + +   GAG +G 
Sbjct: 243 VNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGY 302

Query: 251 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 310
           +G +YW +PGA+       D++  RF   +++   AAF +  +E + I A E +NPR+++
Sbjct: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAI 357

Query: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY-VSSSPFIIAIENSGTKVLPH 369
           P A K +++RIL  +      +G LVPY+  +L  S S    +SP+++AI + G +V+PH
Sbjct: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417

Query: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429
             NAV+L  ++S  NS  Y   RI++ L++   AP +F   +  G P  A+  +  FG +
Sbjct: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477

Query: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489
           A+   S+     F WLL I+G++  FTW+ I   HIRF +A+  +G S  +L F+++   
Sbjct: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537

Query: 490 WLAYYALFFMVVIILIQGFTAFAPT----FSGVDFAAAYVSVFLFIAIWLGAQIWFRC-R 544
           W + YA   + + ++ + + + AP          F   Y+++ + I  + G +I+ R  +
Sbjct: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597

Query: 545 IFHRLDEVDIDTDRRDIEAVV 565
           +F R   +D+ T R   +A +
Sbjct: 598 LFIRAKNIDLITHRNIFDAEI 618

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  250 bits (638), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 169/501 (33%), Positives = 260/501 (51%), Gaps = 32/501 (6%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +  V E  + R+L  RH                     L   GP   LI Y  +  +VY+
Sbjct: 40  DNNVRE-HLNRSLSPRHVNMIAIAGVIGTGLYLGTGRALHLGGPASLLINYSIIGLIVYA 98

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            + SLGEM+T++P++ +F  F+ +F S +F  A    YWF+ A++ A +L+ +  ++++W
Sbjct: 99  TLLSLGEMSTYMPISGSFCSFAKKFGSESFAFALMCNYWFNDAVSVASDLTALQLVLDYW 158

Query: 189 TTAVP-MAAWIT--IFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245
            T+      WI   IFWV L   N+  VK YGE E+W+A +KVIA++ F I  +    G 
Sbjct: 159 KTSESGFPYWIASLIFWVFLLFLNVIHVKIYGEAEYWLAMLKVIAIIIFFILSIVANVGH 218

Query: 246 GITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 304
                 +GFR W    A  P +         F G+ +  ++A+F Y GTE + +T+GE  
Sbjct: 219 NEQHEYIGFRNWTRGDA--PFV-------NGFRGFATLFVSASFAYGGTESITLTSGETK 269

Query: 305 NPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGT 364
           NP ++ P+ IK V +RIL+FY     FIG+ VPY+ P L  S+  V +SPF I  +  G+
Sbjct: 270 NPVRNTPKVIKTVFWRILIFYIFTVFFIGMNVPYDYPNL--SEKSVMTSPFTIVFQMVGS 327

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLA-KIKLAPSFFGRTNAAGVPYFAVFFT 423
           K      NAV+LT+++SA N  ++ GSRI++ L  +    P    RTN   VPY AV  T
Sbjct: 328 KAAGSFMNAVILTSVVSACNHALFAGSRILFNLGLEGYFFPKLVTRTNWYQVPYVAVLVT 387

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
            A G L +     G  + + WL N+ GV+    W+ I    IRF      RG+SR     
Sbjct: 388 WAVGGLCFGSSFIGAGTLWIWLQNLVGVSNQIAWLSIGVISIRFR-----RGLSRQGKTH 442

Query: 484 KAKFMPWLAYYALFFMVV----IILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQI 539
           + KF+ W   Y  +F+++    IIL+QG+++ +P      F + YV +F+F+A WL   +
Sbjct: 443 ELKFVNWTYPYGPYFVIISVSFIILVQGWSSSSP-MDVTSFFSYYVELFIFLACWL---V 498

Query: 540 W--FRCRIFHRLDEVDIDTDR 558
           W  F+   F R  ++D  TD+
Sbjct: 499 WWAFKRDGFVREKDMDFVTDK 519

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  251 bits (640), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 152/509 (29%), Positives = 258/509 (50%), Gaps = 22/509 (4%)

Query: 74  EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSL 133
           E ++ +A++ RH                   + LS +GP+G +I Y+  + +V+ ++Q+ 
Sbjct: 81  ENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQAA 140

Query: 134 GEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192
           GE+   +  V   FT + +  + PAFG A  ++Y   W I   L+L      I+FW   V
Sbjct: 141 GELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFWNVGV 200

Query: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252
            +  ++   +V++ + NL   + Y E EF+    K++ L GF+I  + +  G    GP G
Sbjct: 201 NLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPNGPDG 260

Query: 253 F---RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
           +   +YWRNPG +  G          F G  S    AAF+Y G E + ++A E  NP KS
Sbjct: 261 YIGGKYWRNPGLFANG----------FKGVCSVFCYAAFSYGGVETLVLSAAEQKNPLKS 310

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL-NSSDSYVSSSPFIIAIENSGTKVLP 368
           +P A KKV++RIL  Y    + +  LVPY  P L  SS S   SSPF+IAI + G  V+P
Sbjct: 311 IPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVIAIASHGVSVVP 370

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
           H+ NAV+L +++S  NS +YV  R++  LA+   AP F    +  G P         FG 
Sbjct: 371 HLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLVVVLFGM 430

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           + ++  S      F WLL+I+G+   F W+ I   HIRF  A++ +G    ++ +KA+  
Sbjct: 431 IGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIAYKAQTG 490

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPT-----FSGVDFAAAYVSVFLFIAIWLGAQIWFRC 543
            W +Y A+   + +++ Q + A AP          +F   Y++  + +  +LG +++++ 
Sbjct: 491 YWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGFKVYYKQ 550

Query: 544 -RIFHRLDEVDIDTDRRD-IEAVVWDDEP 570
            ++    D++++D +R   +     +D+P
Sbjct: 551 WQLLIPADKIELDNNRNVYVPEEALEDKP 579

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  250 bits (638), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 160/495 (32%), Positives = 269/495 (54%), Gaps = 20/495 (4%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           E  + E +++RALK RH                  +  L   GP    + Y  M  +VY 
Sbjct: 47  EANIRE-DLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYL 105

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            +  LGEM+T++P++ +F  ++ +F S +F  A  + YWF+ A++ A +++ +  ++++W
Sbjct: 106 TLLCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYW 165

Query: 189 TTAV---PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245
            T     P  A   +FW L+ + N+  V++YGE E+W+A +KVIA++ F I  + +  G 
Sbjct: 166 DTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGH 225

Query: 246 GITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 304
                 +GF+ W +  A  P +         F G+ S  ++A+F Y GTE + +T GEAA
Sbjct: 226 NPQHEYIGFKNWNHGEA--PFV-------DGFKGFASLFVSASFAYGGTESITLTNGEAA 276

Query: 305 NPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGT 364
           NP ++ P+ +K V +RILVFY     FI + +PY+ P L++    V +SPF +  + +GT
Sbjct: 277 NPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGLDTKS--VVTSPFTLVFQMAGT 334

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAP-SFFGRTNAAGVPYFAVFFT 423
           K      NAV++T++ISA N  ++ GSR+MY +      P     RTN   VPY +V  T
Sbjct: 335 KAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLIT 394

Query: 424 SAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPF 483
           S+ G L +     G  + + WL NI GV+    W+ I    IRF + L+ +G +  +L +
Sbjct: 395 SSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELRY 453

Query: 484 KAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRC 543
           K    P+  Y+ + F+  IIL+QG++AF P +   +F + Y+ +F+F   ++   ++ R 
Sbjct: 454 KNWTYPYGPYFLVIFVTFIILVQGWSAFDP-WDVTNFFSYYLDLFVFPFCFIIWWLYKRD 512

Query: 544 RIFHRLDEVDIDTDR 558
           R F +L+++D  TDR
Sbjct: 513 R-FVKLEDMDFVTDR 526

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  251 bits (641), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 162/515 (31%), Positives = 277/515 (53%), Gaps = 15/515 (2%)

Query: 68  KEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVY 127
           K       ++++ +K RH                  S+ LS AGP   +I Y  M + +Y
Sbjct: 113 KVNNTESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLY 172

Query: 128 SVVQSLGEMAT-FIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
            ++Q+ GEMA  +  +   F  + S  L PA G +  ++Y   W     LEL      I+
Sbjct: 173 CIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIK 232

Query: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-A 245
           +WTT V    ++ IF+VL+   N+F  + Y E EF+    KV+ ++GF I  + +  G A
Sbjct: 233 YWTTKVDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGA 292

Query: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
           G  G +G +YW  PGA+       +    RF G + + + AAF +  TE + +TA E +N
Sbjct: 293 GNDGYLGAKYWHEPGAF-----RGEHAVDRFKGVMDTFVAAAFAFGATEFIALTAAEQSN 347

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGT 364
           PRK++P A KKV++RI++ +    + +G LVPY+ D  L SS S V +SP+++A+   G 
Sbjct: 348 PRKAIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKASPYVLAVSLHGV 407

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
           +V+PH  NAV+L +++S GNS  Y  SR++  L++   AP +F   +  G P  A+  ++
Sbjct: 408 RVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSA 467

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
            FG +A+   S      FNWLL I+G++  FTW  I   H+RF  A+K +G S  ++ F 
Sbjct: 468 LFGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFH 527

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAPTFSG----VDFAAAYVSVFLFIAIWLGAQIW 540
           ++   + + YA   M++ ++ Q + A AP   G     +F  +Y+++ + IA++ G +++
Sbjct: 528 SQTGVYGSLYAATMMILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLY 587

Query: 541 FRC-RIFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572
           +R  +++ + D++D+ + R+  D   +  +DE  K
Sbjct: 588 YRDWKLYIKADKIDLISHRQIFDENILKQEDEEYK 622

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  249 bits (637), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 158/518 (30%), Positives = 263/518 (50%), Gaps = 19/518 (3%)

Query: 71  QVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVV 130
           Q  +  ++++++ RH                     ++ AG  G LI Y  +  ++   +
Sbjct: 35  QGKKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGIIGVMLVCCM 94

Query: 131 QSLGEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWT 189
           QS+GE+    P ++  F  +  RF+ P+ G +  +++   W I   LEL      I++W 
Sbjct: 95  QSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVTGSMTIKYWN 154

Query: 190 TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA-GIT 248
            ++  + ++++F+ L+ V N F    Y E EF    +KV+ ++GFII  + +  G  G +
Sbjct: 155 ASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIILGVLIDTGCVGTS 214

Query: 249 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA--NP 306
           G +GFRY  +PG +       +KN         +L+NAAF+  G E + ++A E    N 
Sbjct: 215 GTIGFRYLIDPGMF-------NKNYNIIKATAGTLVNAAFSCGGVEFLALSAAEQNRDNM 267

Query: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDS-YVSSSPFIIAIENSGTK 365
            KS+ RA  +V  RI VFY      +GLLVP+N P L  S S  + SSP++ A+  +G  
Sbjct: 268 PKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSSPYVAAVAMNGIT 327

Query: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425
           V+PHI NAV+L  +IS  NS +Y  SR ++ LA+   AP +F + N  G P   +F ++ 
Sbjct: 328 VVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMRCLFISAL 387

Query: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485
           FG ++++       + F WLL+I+G++  FTW  I   HIRF  A+K RG S + L +K+
Sbjct: 388 FGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSLETLGYKS 447

Query: 486 KFMPWLAYYALFFMVVIILIQGFTAFAPTFSG-----VDFAAAYVSVFLFIAIWLGAQIW 540
                 +Y A    +VI+++Q + +  P  S      V F   Y++V + +  ++G +++
Sbjct: 448 ITGVAGSYIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLFYIGHKVY 507

Query: 541 FRC-RIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDK 577
            +   +  R   VDI TD RDI     +D   K L   
Sbjct: 508 TKNWSLLIRASNVDITTD-RDIYCPTIEDPKIKVLMQN 544

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  249 bits (636), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 163/496 (32%), Positives = 266/496 (53%), Gaps = 20/496 (4%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           +  V    + R+L  RH                  +  L+  GP   LI Y+ M  ++Y 
Sbjct: 54  QDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINYVIMGGVIYL 113

Query: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188
            + SLGEM+TF+P++ ++  +S +F+S ++  A     W+S A++ A +L+ +  ++++W
Sbjct: 114 TMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDLTALQLVLDYW 173

Query: 189 TTAV---PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245
            T     P  A   +FW L+   N+  VK YGE E+W+A +KV+A++ F I  +   CG 
Sbjct: 174 KTNTHHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIFFIMAIIANCGH 233

Query: 246 GITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 304
                 +GF+ W +  A  P +      +G F G+V+  + ++F+Y GTE V +T GEA 
Sbjct: 234 NQQHEYIGFKNWSHGDA--PFV------QG-FKGFVTIFVTSSFSYGGTETVTLTGGEAK 284

Query: 305 NPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGT 364
           NP ++ P+ IK V +RILVFY     F+G+ +PY+ P L +    V +SPF I  + +GT
Sbjct: 285 NPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNLKTKS--VLTSPFTIVFQMAGT 342

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAP--SFFGRTNAAGVPYFAVFF 422
           K      NAV++T+ ISA N  ++ GSRI+Y +      P   FF +TN    PY AV  
Sbjct: 343 KAAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNRNKAPYVAVIT 402

Query: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482
           T A G L +     G    F+WL NI GV+   +W+ I+   IRF + L+ +G    +L 
Sbjct: 403 TWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKGLEAQG-KVHELK 461

Query: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFR 542
           F+    P+  ++ + F+ +IIL+QG++AF P +S   F + Y+ + +F A W+   +  R
Sbjct: 462 FRNWTYPYGPWFCIIFISLIILVQGWSAFDP-WSTSSFFSFYLELIVFPACWIFWWVIKR 520

Query: 543 CRIFHRLDEVDIDTDR 558
            R F +  ++D  TD+
Sbjct: 521 DR-FKKAKDMDFITDK 535

>KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {ON}
           similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W Lysine permease; one of three amino acid
           permeases (Alp1p, Can1p, Lyp1p) responsible for uptake
           of cationic amino acids
          Length = 543

 Score =  247 bits (631), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 170/501 (33%), Positives = 268/501 (53%), Gaps = 28/501 (5%)

Query: 67  VKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLV 126
           +  G V E  + R+L  RH                     L+N GP   LI Y  +  +V
Sbjct: 30  LNRGHVRE-NLNRSLTPRHINMISIAGVIGTGLYLGTGKALANGGPASLLINYGIIGLVV 88

Query: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186
           Y ++  LGEM+TF+P++ +F  ++ +F S +        YWF+ A++ A +L+ +  I++
Sbjct: 89  YLIMLCLGEMSTFMPISGSFCSYAKKFGSGSLAFTLMCNYWFNDAVSVASDLTALQLILD 148

Query: 187 FW---TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC 243
           +W    +  P  A   IFW  L + N+  V+ YGE E+W+A +KVIA++ F I  + +  
Sbjct: 149 YWKNPNSHFPYWAASLIFWFALLLLNVVHVRVYGEAEYWLALLKVIAIIMFFIISIIVNA 208

Query: 244 GAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 302
           G       +GF+ W        G+       G F G+ S  ++++F + GTE + +TAGE
Sbjct: 209 GHNSDHAYIGFKNW--------GVGDAPFVNG-FKGFASLFVSSSFAFGGTESITLTAGE 259

Query: 303 AANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENS 362
           A NP ++ P+ IK V +RIL+FY   A FIG+ VPYN P L  S+  V +SPF I  +  
Sbjct: 260 AVNPVRNTPKIIKTVFWRILIFYVFTAFFIGMNVPYNYPNL--SEKSVMTSPFTIVFQMV 317

Query: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLA-KIKLAPSFFGRTNAAGVPYFAVF 421
           G++      NAV+LT++ISAGN  ++ GSR+++ +  +    PSF  +TN   VPY AV 
Sbjct: 318 GSRGAGSFMNAVILTSVISAGNHALFAGSRVLFNIGLEGYFFPSFITKTNRYQVPYVAVL 377

Query: 422 FTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDL 481
            T A G L +     G  + + WL NI GV+    W+ IS   IRF      RG++R   
Sbjct: 378 ITWAAGGLCFGSSFIGAGTLWTWLQNIVGVSNQLAWLCISVISIRFR-----RGLARQGK 432

Query: 482 PFKAKFMPWLAYYALFFMVV----IILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGA 537
             + +F+ W   Y  +F+VV    II +QG+++FAP +S  DF + Y+ + +F+A++   
Sbjct: 433 THELQFVNWTYPYGPYFLVVFVTFIIFVQGWSSFAP-WSVSDFFSYYIELIVFVALYAFW 491

Query: 538 QIWFRCRIFHRLDEVDIDTDR 558
            +W R   F + DE+D  TD+
Sbjct: 492 WLWKRDS-FVKSDEMDFVTDK 511

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  248 bits (633), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 161/537 (29%), Positives = 278/537 (51%), Gaps = 34/537 (6%)

Query: 68  KEGQVHEAEVK------RALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLF 121
           ++G + E EVK      R LK RH                     LS  GP   LI+Y+ 
Sbjct: 36  EQGSISELEVKPQNEMVRGLKSRHIQLIALGDAIGTGLFIGSGGALSTCGPAPILISYIV 95

Query: 122 MATLVYSVVQSLGEMATFIPVTSAFTVFS--SRFLSPAFGAASGYMYWFSWAITFALELS 179
           M+  V+++V  L EM   IP+    +++S    ++        G+  +++ A+    E++
Sbjct: 96  MSFFVWTIVNQLTEMVALIPLPGEASMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEIT 155

Query: 180 VVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCL 239
               +I++WT A   A +I+IF V      + PV+ +GE EF ++ IK++ +VG II  +
Sbjct: 156 ACAMLIQYWTDA-NSAIFISIFIVFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIVGI 214

Query: 240 CMVCGAGITGP--VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGT-ELV 296
            +  G G +    +GF YW+ PGA+   ++    + G+FL   +++I + F++    E V
Sbjct: 215 VIFFGGGPSQDHILGFHYWKKPGAFKEHLVPG--STGKFLAVWTAIIKSGFSFVLVPETV 272

Query: 297 GITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL----NSSDSYVSS 352
              + E+A+PR+++PRA ++ V+R+ +FY    + + ++V  +D  L    +S  S  ++
Sbjct: 273 ASCSAESASPRRNMPRACQRFVYRLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNAAA 332

Query: 353 SPFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNA 412
           SP++I I+ +G KVLPHI NA +LT+  S G + +Y  SRI++ +A    AP  F + N 
Sbjct: 333 SPYVIGIKEAGIKVLPHIINACILTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKVNR 392

Query: 413 AGVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALK 472
            GVPY++      F  LAY+  S   +  FNWL NI  ++GF +WV +S  + RF   + 
Sbjct: 393 FGVPYYSTAVACLFTLLAYLNCSKSSSLVFNWLSNIATISGFISWVFVSVTYTRFRTVID 452

Query: 473 YRGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAP-TFSGVDFAAAYVSVFLFI 531
              ++ D +PF+ +F    AY  + F V++ L  G+  F    ++  DF A+YV++    
Sbjct: 453 KLDLN-DRIPFRRRFQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTSDFFASYVTIGFVA 511

Query: 532 AIWLGAQIWFRCRIFHRLDE--------VDI-DTDRRDIEAVVWDDEPPKTLWDKFW 579
            +++G+ I+++   F  + E        +DI D D R+   VV     PK   +K W
Sbjct: 512 VLFIGSTIYYKELRFRDVSEIGREIIPKIDIADEDERNDVPVV-----PKNWGEKIW 563

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  249 bits (635), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 168/572 (29%), Positives = 281/572 (49%), Gaps = 24/572 (4%)

Query: 17  NFSGMNDEDSS--SGQAGAINHRKKSVVSKTTAVXXXXXXXXXXXXXXXXXFVKEGQVH- 73
           N +  ND+D S  S Q  +++HRK +  S                       +++G    
Sbjct: 27  NLASTNDDDISIASSQNRSLSHRKNT--SYYRNFIDSFKRAEHGNLNEKSADLEDGTASI 84

Query: 74  --EAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQ 131
             ++ +K++LK RH                  +  L+  GP   +I Y+ ++ +VY ++Q
Sbjct: 85  QSKSYMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQ 144

Query: 132 SLGEMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTT 190
           + GEMA   P +   F  + S F+S ++G A+ +++   W     LEL      I++WT 
Sbjct: 145 AAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYWTD 204

Query: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG-AGITG 249
            +    ++ IF+V L + +   VK YGE EF     K++ + GFII+ + + CG AG  G
Sbjct: 205 -LNGDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDG 263

Query: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309
            +G +YW  PG++  G         RF G    L+   F+Y GTEL  ++  E A PRK+
Sbjct: 264 YIGGKYWHTPGSFAEG-----GPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKA 318

Query: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTKVLP 368
            P A KK ++RILV Y    + IG  VP+N D  + +  S   +SP+++A    G KV+P
Sbjct: 319 TPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIHGVKVVP 378

Query: 369 HIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGA 428
           HI NAV+L +++S  NS++Y   R++  LA+   AP      +  G P  A+   + FG 
Sbjct: 379 HIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGC 438

Query: 429 LAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFM 488
           +A++  S      F WL  I G++  FTW  I   H+RF  A+K +    D++ +KA   
Sbjct: 439 IAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATAG 498

Query: 489 PWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAA-AYVSVFLFIAIWLGAQIWFRC---- 543
            + +++   F V++++ Q + A +P  SG   +A ++   +L + IW+   I +      
Sbjct: 499 IYGSWFGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYNKE 558

Query: 544 -RIFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572
             I   L ++D+D  RR  D + +  +D   K
Sbjct: 559 WTILTDLSKIDLDAHRRIYDPDLIRQEDAENK 590

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  247 bits (630), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 150/501 (29%), Positives = 254/501 (50%), Gaps = 30/501 (5%)

Query: 75  AEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYSVVQSLG 134
           A +++++K RH                     ++ AG  G LI YL +  +V   +QS+G
Sbjct: 23  ASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQSVG 82

Query: 135 EMATFIP-VTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVP 193
           E+    P +   F  +  +F+ P+ G    +++   W +   LEL      I++W + + 
Sbjct: 83  ELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWNSNLS 142

Query: 194 MAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA-GITGPVG 252
            + +++ F++L+ + N F    Y E EF    +KV+ L  FI+  + ++ G  G +GP+G
Sbjct: 143 PSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSGPIG 202

Query: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA--NPRKSV 310
           F+Y + PGA+       + N   F     +L+NAAF+  G E + ++A E    N  KS+
Sbjct: 203 FQYLKTPGAF-------NTNYNVFKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSI 255

Query: 311 PRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVS-SSPFIIAIENSGTKVLPH 369
            RA ++V  R+ VFY      +GLLVPY+ P L  S S  + +SP++ AI   G +++PH
Sbjct: 256 RRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHGVRIVPH 315

Query: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429
           I NAV+L  ++S  NS +Y  SR ++ LA+   AP +F   N  G P   +  ++  G +
Sbjct: 316 IINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVGLI 375

Query: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489
           +++       + F WLL+I+G++  FTW  I   HIRF  ALK +G S D L +++    
Sbjct: 376 SFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNTGV 435

Query: 490 WLAYYALFFMVVIILIQGFTAFAPTFS-----GVDFAAAYVSVFLFIAIWLGAQI----- 539
             +Y A    VV+I++Q + +  P  +      V F   Y++V + + ++LG ++     
Sbjct: 436 IGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTNDW 495

Query: 540 --WFRCRIFHRLDEVDIDTDR 558
             W R         VDI+TDR
Sbjct: 496 TPWIRTHC------VDINTDR 510

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  249 bits (635), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 148/510 (29%), Positives = 268/510 (52%), Gaps = 20/510 (3%)

Query: 69  EGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATLVYS 128
           EG   + ++K+ ++ RH                     L+ AGP G +I Y  M +L+Y 
Sbjct: 109 EGDTGD-KLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYC 167

Query: 129 VVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187
           ++Q+ GEMA  ++ +   F  + +  + P F  A+ ++Y   W     LEL      I++
Sbjct: 168 IIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKY 227

Query: 188 WTTAVPMAAWITIFWV-LLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246
           WTT V    ++ IF+V +L ++ L   + Y E EF     K++ ++GF I  + ++CG  
Sbjct: 228 WTTKVDPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICGGA 287

Query: 247 IT-GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305
            T G +G RYW +PGA+       ++   RF G V++L+ AAF++  +E + +TA E +N
Sbjct: 288 GTDGYIGGRYWHDPGAF-----RGERAVDRFKGVVATLVTAAFSFGQSEFIAVTASEQSN 342

Query: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSY-VSSSPFIIAIENSGT 364
           PR+++P A KK+++R L  Y    + +G LVPYN  +L  + S  + +SP+++A+ N G 
Sbjct: 343 PRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKASPYVLAVANHGV 402

Query: 365 KVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTS 424
           +V+PH  NAV++ +++S  NS  Y   R++  L++   AP  F   + AG P   +   S
Sbjct: 403 RVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGIIVAS 462

Query: 425 AFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFK 484
            F  +A+   S      F WLL ++G++  FTW+ I   H+RF +A+  +G S  +  F 
Sbjct: 463 LFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGECGFL 522

Query: 485 AKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRC- 543
           ++   + + Y+ F + +I++ Q + A  P  S    A ++   +L   IW+   I ++C 
Sbjct: 523 SQVGIYGSAYSFFVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYIGYKCY 582

Query: 544 ----RIFHRLDEVDIDTDRRDIEAVVWDDE 569
               R++ +  ++D+   R+     ++D++
Sbjct: 583 TKDWRLYIKSQDIDLVAHRQ-----IYDED 607

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  246 bits (629), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 164/499 (32%), Positives = 266/499 (53%), Gaps = 23/499 (4%)

Query: 66  FVKEGQVHEAEVKRALKQRHXXXXXXXXXXXXXXXXXXSTPLSNAGPVGGLIAYLFMATL 125
           F  E  + E ++KR L  RH                  S  L   GP    + Y     +
Sbjct: 58  FDPESNIRE-DLKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNYSIFGGV 116

Query: 126 VYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185
           VY  +  LGEM+T++P++ +F  ++ +F S +F  A  + YWF+ A++ A +L+ +  ++
Sbjct: 117 VYLTMMCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLTALQLVL 176

Query: 186 EFWTTA---VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMV 242
           ++W T     P  A   +FWV + + N+  V+ YGE E+W+A +KVIA++ F I  + + 
Sbjct: 177 DYWKTKDHHFPYWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFILSIVVN 236

Query: 243 CGAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAG 301
            G       +GF  W +  A  P +         F G+ S  ++A+F Y GTE + +T G
Sbjct: 237 VGHNPEHKYIGFHNWNHGDA--PFV-------NGFKGFASLFVSASFAYGGTESITLTNG 287

Query: 302 EAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIEN 361
           EA NP ++ P+ IK V +RIL+FY   A FI + VPY+ P L +    V +SPF I  + 
Sbjct: 288 EATNPVRNTPKVIKTVFWRILIFYVFSAFFIAMNVPYDYPGLATKS--VMTSPFTIVFQM 345

Query: 362 SGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVF 421
           +G+K      NAV++T++ISA N  ++ GSR+MY ++     P +  +TN    PY AV 
Sbjct: 346 AGSKGAGSFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYKAPYVAVA 405

Query: 422 FTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDL 481
            T A G L +     G  + + WL NI GV+    W+ I+   IRF + L+ +G +  +L
Sbjct: 406 ITWAVGGLCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQGKTH-EL 464

Query: 482 PFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIW- 540
            FK    PW  Y+ + F+  +ILIQG++AF P +S  +F + Y+ +F+F A +L   IW 
Sbjct: 465 KFKNWTYPWGPYFLVVFVSFVILIQGWSAFDP-WSTSNFFSVYLELFVFPACYL---IWW 520

Query: 541 -FRCRIFHRLDEVDIDTDR 558
            ++   F + +++D  TD+
Sbjct: 521 LYKRDKFIKYEDMDFVTDK 539

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,130,565
Number of extensions: 2178473
Number of successful extensions: 8380
Number of sequences better than 10.0: 406
Number of HSP's gapped: 7105
Number of HSP's successfully gapped: 424
Length of query: 583
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 468
Effective length of database: 40,294,809
Effective search space: 18857970612
Effective search space used: 18857970612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)