Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C035801.195ON53053026250.0
ZYRO0G18150g1.195ON53053020610.0
KLLA0D16412g1.195ON52952920410.0
SAKL0F00396g1.195ON52753119660.0
Smik_10.811.195ON53352419140.0
Suva_6.2311.195ON54353619060.0
Skud_10.631.195ON53352619030.0
YJL153C (INO1)1.195ON53352419020.0
CAGL0I06050g1.195ON53853818330.0
TPHA0A028801.195ON54053418180.0
TBLA0C020701.195ON53653617650.0
Kpol_2001.171.195ON47145717280.0
KAFR0F018601.195ON54250816970.0
KNAG0C025201.195ON59252916890.0
NCAS0I027501.195ON58352316810.0
NDAI0B001201.195ON56754016200.0
TBLA0D040608.282ON41947704.8
SAKL0H22550g4.128ON119648706.3
SAKL0G18766g4.378ON34441688.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C03580
         (530 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.1...  1015   0.0  
ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} high...   798   0.0  
KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]...   790   0.0  
SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly s...   761   0.0  
Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {O...   741   0.0  
Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C ...   738   0.0  
Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {O...   737   0.0  
YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON} ...   737   0.0  
CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly...   710   0.0  
TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {O...   704   0.0  
TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.1...   684   0.0  
Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON} (48908....   670   0.0  
KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {O...   658   0.0  
KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {O...   655   0.0  
NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.1...   652   0.0  
NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195 Y...   628   0.0  
TBLA0D04060 Chr4 complement(1009971..1011230) [1260 bp, 419 aa] ...    32   4.8  
SAKL0H22550g Chr8 complement(1958491..1961990,1962073..1962163) ...    32   6.3  
SAKL0G18766g Chr7 (1621177..1622211) [1035 bp, 344 aa] {ON} simi...    31   8.0  

>TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.195
           YJL153C
          Length = 530

 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/530 (93%), Positives = 497/530 (93%)

Query: 1   MTVQRYFSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDL 60
           MTVQRYFSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDL
Sbjct: 1   MTVQRYFSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDL 60

Query: 61  KIPKIXXXXXXXXXXXXXXXXASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDE 120
           KIPKI                ASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDE
Sbjct: 61  KIPKIGVMLVGLGGNNGTTLVASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDE 120

Query: 121 QGNDVYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVP 180
           QGNDVYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVP
Sbjct: 121 QGNDVYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVP 180

Query: 181 LPSIYYPDFIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVI 240
           LPSIYYPDFIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVI
Sbjct: 181 LPSIYYPDFIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVI 240

Query: 241 VLWTANTERYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGSPQNT 300
           VLWTANTERY                 IKNDHEEIAPSTIFAVASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYADVLSNVNDNADNLLAAIKNDHEEIAPSTIFAVASILEGVPYINGSPQNT 300

Query: 301 FVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360
           FVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL
Sbjct: 301 FVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360

Query: 361 TSERQFKSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYS 420
           TSERQFKSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYS
Sbjct: 361 TSERQFKSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQSYESFYSILSF 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQSYESFYSILSF
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQSYESFYSILSF 480

Query: 481 LSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKLK 530
           LSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKLK
Sbjct: 481 LSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKLK 530

>ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 530

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/530 (71%), Positives = 434/530 (81%)

Query: 1   MTVQRYFSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDL 60
           MT   YF+P++ VA DK HYSET+LTT+Y YVNS+V ++    T++V P  Q+Y+F+VDL
Sbjct: 1   MTAANYFTPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDL 60

Query: 61  KIPKIXXXXXXXXXXXXXXXXASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDE 120
           K+P++                AS+LANR K++FH K+G KEANYYGSVTQ ST+KLG+  
Sbjct: 61  KLPRVGVMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRP 120

Query: 121 QGNDVYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVP 180
            GND YVPFNS+LPFVSPNDF V GWDI+  NLGDAM R+QVLEYDLQ+QL+ EM++  P
Sbjct: 121 DGNDFYVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKP 180

Query: 181 LPSIYYPDFIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVI 240
           LPSIYYPDFIAANQD RADNCINR   +G  STK KW H+E+IR DI+ FK   DLDKVI
Sbjct: 181 LPSIYYPDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVI 240

Query: 241 VLWTANTERYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGSPQNT 300
           VLWTANTERY                 IK D EEIAPSTIFAVASILEG  YINGSPQNT
Sbjct: 241 VLWTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNT 300

Query: 301 FVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360
           FVPGVI+LAE+ ++ IAGDDFKSGQTKIKSVLAQFLV+AGIKP SIASYNHLGNNDG+NL
Sbjct: 301 FVPGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNL 360

Query: 361 TSERQFKSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYS 420
           +SERQFKSKEISK+SVVDDV+ASN +LYN+K GNKIDHCIVIKYMNAVGDSKVAMDEYYS
Sbjct: 361 SSERQFKSKEISKKSVVDDVVASNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQSYESFYSILSF 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDL+VMAEFC+RVSYK++G     Y  FY+ILSF
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGKFYNILSF 480

Query: 481 LSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKLK 530
           LSYWLKAPLTRKG++ INGLNKQR G+ENF+RLLIGLPA DELRFEE+LK
Sbjct: 481 LSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERLK 530

>KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]
           {ON} highly similar to uniprot|P11986 Saccharomyces
           cerevisiae YJL153C INO1 Inositol 1-phosphate synthase
           involved in synthesis of inositol phosphates and
           inositol- containing phospholipids transcription is
           coregulated with other phospholipid biosynthetic genes
           by Ino2p and Ino4p which bind the UASINO DNA element
          Length = 529

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/529 (71%), Positives = 425/529 (80%), Gaps = 1/529 (0%)

Query: 1   MTVQRYFSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDL 60
           MT    F PT+ VA D   +SET+LTT+Y Y N++V KS  DG   V P  QDYEF+VDL
Sbjct: 1   MTAPTVFKPTVKVATDVAEFSETELTTKYTYRNAIVEKS-ADGVFNVEPVTQDYEFKVDL 59

Query: 61  KIPKIXXXXXXXXXXXXXXXXASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDE 120
           K+PK+                AS+LAN+ K++F TK+G KEANYYGSVTQSST+KLG+D 
Sbjct: 60  KLPKVGVMLVGLGGNNGTTFLASILANKHKVKFQTKEGLKEANYYGSVTQSSTLKLGVDA 119

Query: 121 QGNDVYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVP 180
           +GNDVY PFNS++P VSPNDF V GWDINGA+LG AMAR++VL  DLQ +LR EM+   P
Sbjct: 120 EGNDVYAPFNSLVPMVSPNDFYVSGWDINGADLGTAMARAEVLGVDLQNKLRQEMSAHKP 179

Query: 181 LPSIYYPDFIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVI 240
           LPSIYYPDFIAANQDERADNC NRDGK+G VS K KWSHVE IR DI+ FK  N LDKV+
Sbjct: 180 LPSIYYPDFIAANQDERADNCFNRDGKAGPVSVKDKWSHVEHIRNDIRQFKENNGLDKVL 239

Query: 241 VLWTANTERYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGSPQNT 300
           VLWTANTERY                 I++DH EIAPST+FAVASILE VPYINGSPQNT
Sbjct: 240 VLWTANTERYADIVTGVNDTAENLINAIRSDHAEIAPSTVFAVASILENVPYINGSPQNT 299

Query: 301 FVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360
           FVPGVIDLAEK  A IAGDDFKSGQTK+KSVLAQFLVDAGI+PVSIASYNHLGNNDG+NL
Sbjct: 300 FVPGVIDLAEKEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNL 359

Query: 361 TSERQFKSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYS 420
           +S +QFKSKEISK SVVDD+I SN+ILYN+K GNKIDHCIVIKYM AVGDSKVAMDEYYS
Sbjct: 360 SSPQQFKSKEISKASVVDDIIESNQILYNDKLGNKIDHCIVIKYMPAVGDSKVAMDEYYS 419

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQSYESFYSILSF 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDL+VMAEFCSR+ YKK+      Y SFY +L+ 
Sbjct: 420 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCSRIKYKKINDLSGGYHSFYPVLTM 479

Query: 481 LSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529
           LSYWLKAPLTR GFK INGLNKQR  +ENFLRLLIGLPALDELRFEE+L
Sbjct: 480 LSYWLKAPLTRPGFKAINGLNKQRAALENFLRLLIGLPALDELRFEERL 528

>SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 527

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/531 (69%), Positives = 429/531 (80%), Gaps = 7/531 (1%)

Query: 1   MTVQRYFSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDL 60
           MT Q  ++P + VA +   Y  + L T Y Y N++V+K   DG+   +P  ++Y+F+VDL
Sbjct: 1   MTAQ--YTPKVKVATENCQYRGSDLITNYTYKNTIVSKCS-DGSYSAQPVVENYQFKVDL 57

Query: 61  KIPKIXXXXXXXXXXXXXXXXASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDE 120
           K+PK+                AS+LAN+ KI+F++K+G   ANYYGSVTQ+STIKLGID 
Sbjct: 58  KVPKLGVMLVGLGGNNGSTFIASILANKHKIQFNSKEGTIGANYYGSVTQASTIKLGIDA 117

Query: 121 QGNDVYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVP 180
            GNDVYVPFNSVLPFV+PNDFVVGGWDING+N+ +AM R++VLEYDLQ++L+ EM K  P
Sbjct: 118 DGNDVYVPFNSVLPFVNPNDFVVGGWDINGSNMYEAMVRAKVLEYDLQEKLKAEMEKIHP 177

Query: 181 LPSIYYPDFIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVI 240
           LPS+YYPD+IAANQDERA+NCINR    G VSTK KW HVE+IRKDI++FK  N LDKVI
Sbjct: 178 LPSVYYPDYIAANQDERANNCINR--VKGTVSTKNKWDHVEKIRKDIRDFKETNGLDKVI 235

Query: 241 VLWTANTERYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGSPQNT 300
           VLWTANTERY                 IK+DH EI+PS IFAVASILE VPYINGSPQNT
Sbjct: 236 VLWTANTERYSDLIDGVNDNAENLLKAIKSDHTEISPSAIFAVASILENVPYINGSPQNT 295

Query: 301 FVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360
           FVPG+++LAEK+ + I GDDFKSGQTK+KSVLAQFLVDAGI+PVSIASYNHLGNNDG+NL
Sbjct: 296 FVPGIVELAEKNKSFIGGDDFKSGQTKLKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNL 355

Query: 361 TSERQFKSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYS 420
           +S +QFKSKEISK SVVDD+IASN ILYNEK G KIDHCIVIKYM AV DSKVAMDEYYS
Sbjct: 356 SSPKQFKSKEISKSSVVDDIIASNSILYNEKLGKKIDHCIVIKYMPAVADSKVAMDEYYS 415

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQ--SYESFYSIL 478
           ELMLGGHNRISIHNVCEDSLLATPLIIDL+VM+EF SRV+YKKL SD    SYE  YSIL
Sbjct: 416 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMSEFLSRVTYKKLESDASAGSYEKLYSIL 475

Query: 479 SFLSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529
           SFLSYWLKAPLTRKGF+TINGLNKQR  +ENFLRLLIGLPA+DELRFEE+L
Sbjct: 476 SFLSYWLKAPLTRKGFETINGLNKQRMALENFLRLLIGLPAIDELRFEERL 526

>Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/524 (68%), Positives = 415/524 (79%), Gaps = 6/524 (1%)

Query: 10  TINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDLKIPK-IXXX 68
           ++ V  DK  Y+E +L T+Y Y N+VV K+   G  +V PT QDY F++DL  PK +   
Sbjct: 11  SVKVVTDKCTYTENELLTKYSYENAVVTKT-AGGQFDVTPTVQDYVFKLDLNKPKKLGIM 69

Query: 69  XXXXXXXXXXXXXASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDEQGNDVYVP 128
                        AS+LANR  + F TK+G K+ NY+GS+TQ ST+KLGID +GNDVY P
Sbjct: 70  LIGLGGNNGSTLVASILANRHDMEFQTKEGLKKPNYFGSMTQCSTLKLGIDAEGNDVYAP 129

Query: 129 FNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPSIYYPD 188
           FNS+LP V+PNDF+V GWDIN ANL +AM R QVLEYDLQQ+L+ +M+   PLPSIYYPD
Sbjct: 130 FNSLLPMVNPNDFIVSGWDINKANLYEAMQRGQVLEYDLQQRLKAKMSTVKPLPSIYYPD 189

Query: 189 FIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVIVLWTANTE 248
           FIAANQDERA+NCIN D K G V+T+GKWSH++QIR+DI++FK  N LDKVIVLWTANTE
Sbjct: 190 FIAANQDERANNCINLDEK-GKVTTRGKWSHLQQIRRDIQHFKEENSLDKVIVLWTANTE 248

Query: 249 RYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGSPQNTFVPGVIDL 308
           RY                 IK+DHEEIAPST+FA ASILEGVPYINGSPQNTFVPG++ L
Sbjct: 249 RYVEVTAGVNDTMQNLLQSIKDDHEEIAPSTVFAAASILEGVPYINGSPQNTFVPGLVQL 308

Query: 309 AEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLTSERQFKS 368
           AE     IAGDDFKSGQTK+KSVLAQFLVDAGIKPVSIASYNHLGNNDG+NL++ +QF+S
Sbjct: 309 AEHEGTFIAGDDFKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFRS 368

Query: 369 KEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHN 428
           KEISK SV+DD+IASN ILYN+K G K+DHCIVIKYM  VGDSKVAMDEYYSELMLGGHN
Sbjct: 369 KEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHN 428

Query: 429 RISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGS---DQQSYESFYSILSFLSYWL 485
           RISIHNVCEDSLLATPLIIDL+VM EFCSRVSYKK  S   D   YESFY +L+FLSYWL
Sbjct: 429 RISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKGSSVQEDHDKYESFYPVLTFLSYWL 488

Query: 486 KAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529
           KAPLTR GF  +NGLNKQR  +ENFLRLLIGLP+L+ELRFEE+L
Sbjct: 489 KAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSLNELRFEERL 532

>Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C
           (REAL)
          Length = 543

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/536 (66%), Positives = 424/536 (79%), Gaps = 16/536 (2%)

Query: 8   SPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDLKIP-KIX 66
           + ++ VA++K  Y++ +L T+Y Y N+VV+K+  DG  +V PT QDY F++DL  P K+ 
Sbjct: 9   TASVRVASNKCTYTDNELLTKYSYENAVVSKTP-DGRYDVTPTVQDYVFKLDLNKPAKLG 67

Query: 67  XXXXXXXXXXXXXXXASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDEQGNDVY 126
                          A++LAN+  I F TK+G K+ NY+GS+TQSST+KLGID QGNDVY
Sbjct: 68  VMLVGLGGNNGSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGIDAQGNDVY 127

Query: 127 VPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPSIYY 186
            PFNS+LP  +PNDFVV GWDIN AN  +AM R+QVLEYDLQQ+L+ +M+   PLPSIYY
Sbjct: 128 APFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPLPSIYY 187

Query: 187 PDFIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVIVLWTAN 246
           PDFIAANQD+RA+NCIN D K G+V+TKGKW+H++QIR DI++FK  N LDKVIVLWTAN
Sbjct: 188 PDFIAANQDQRANNCINLDEK-GHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVIVLWTAN 246

Query: 247 TERYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGSPQNTFVPGVI 306
           TERY                 IK+DHEEIAPSTIFA ASILEGVPYINGSPQNTFVPG++
Sbjct: 247 TERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLV 306

Query: 307 DLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLTSERQF 366
            LAE   A IAGDDFKSGQTK+KSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL++ +QF
Sbjct: 307 QLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLSAPKQF 366

Query: 367 KSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGG 426
           +SKEISK SV+DD+IASN ILYN+K GNK+DHCIVIKYM  VGDSKVAMDEYYSELMLGG
Sbjct: 367 RSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGG 426

Query: 427 HNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQS-------------YES 473
           HNRISIHNVCEDSLLATPLIIDL+VM EFCSRVSYKK  S Q++             +ES
Sbjct: 427 HNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQENGNGNENENENDGKFES 486

Query: 474 FYSILSFLSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529
           FY +L+FLSYWLKAPLTR GF  +NGLNKQR  +ENF+RLLIGLP+L+ELRFEE+L
Sbjct: 487 FYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEERL 542

>Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/526 (67%), Positives = 417/526 (79%), Gaps = 6/526 (1%)

Query: 8   SPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDLKIP-KIX 66
           + ++ VA +K  Y+E +L T+Y Y N+VV+K+  DG  +V PT QDY F+V L  P K+ 
Sbjct: 9   TASVRVATEKCTYTEDELLTKYSYENAVVSKTP-DGRFDVTPTVQDYVFKVGLDKPDKLG 67

Query: 67  XXXXXXXXXXXXXXXASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDEQGNDVY 126
                          ASVLAN+  I FHTK+G K+ NY+GS+TQSST+KLG+D  GNDVY
Sbjct: 68  IMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVDAAGNDVY 127

Query: 127 VPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPSIYY 186
            PFNS+LP V+PNDFV+ GWDIN ANL +AM R+QVLEYDLQQ+L   M+   PLPS+YY
Sbjct: 128 APFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSVYY 187

Query: 187 PDFIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVIVLWTAN 246
           PDFIAANQDERA+NCIN D K G+V+T GKW+H++QIR DI++FK  N LDKVIVLWTAN
Sbjct: 188 PDFIAANQDERANNCINVDAK-GSVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVLWTAN 246

Query: 247 TERYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGSPQNTFVPGVI 306
           TERY                 IKNDHEEIAPSTIFA ASILEGVPYINGSPQNTFVPG++
Sbjct: 247 TERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLV 306

Query: 307 DLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLTSERQF 366
            LAE     IAGDD KSGQTK+KSVLAQFLVDAGIKP+SIASYNHLGNNDG+NL++ +QF
Sbjct: 307 QLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSAPKQF 366

Query: 367 KSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGG 426
           +SKEISK SV+DD+IASN ILYN+K G K+DHCIVIKYM  VGDSKVAMDEYYSELMLGG
Sbjct: 367 RSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGG 426

Query: 427 HNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQ---SYESFYSILSFLSY 483
           HNRISIHNVCEDSLLATPLIIDL+VM EFCSRVSYK++   Q+    +ESFY +L+FLSY
Sbjct: 427 HNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPVLTFLSY 486

Query: 484 WLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529
           WLKAPLTR GF  +NGLNKQR  +ENF+RLLIGLP+L+ELRFEE+L
Sbjct: 487 WLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERL 532

>YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON}
           INO1Inositol-3-phosphate synthase, involved in synthesis
           of inositol phosphates and inositol-containing
           phospholipids; transcription is coregulated with other
           phospholipid biosynthetic genes by Ino2p and Ino4p,
           which bind the UASINO DNA element
          Length = 533

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/524 (67%), Positives = 415/524 (79%), Gaps = 6/524 (1%)

Query: 10  TINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDLKIP-KIXXX 68
           ++ V  DK  Y + +L T+Y Y N+VV K+   G  +V PT QDY F++DLK P K+   
Sbjct: 11  SVKVVTDKCTYKDNELLTKYSYENAVVTKT-ASGRFDVTPTVQDYVFKLDLKKPEKLGIM 69

Query: 69  XXXXXXXXXXXXXASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDEQGNDVYVP 128
                        ASVLAN+  + F TK+G K+ NY+GS+TQ ST+KLGID +GNDVY P
Sbjct: 70  LIGLGGNNGSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGIDAEGNDVYAP 129

Query: 129 FNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPSIYYPD 188
           FNS+LP VSPNDFVV GWDIN A+L +AM RSQVLEYDLQQ+L+ +M+   PLPSIYYPD
Sbjct: 130 FNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSIYYPD 189

Query: 189 FIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVIVLWTANTE 248
           FIAANQDERA+NCIN D K GNV+T+GKW+H+++IR+DI+NFK  N LDKVIVLWTANTE
Sbjct: 190 FIAANQDERANNCINLDEK-GNVTTRGKWTHLQRIRRDIQNFKEENALDKVIVLWTANTE 248

Query: 249 RYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGSPQNTFVPGVIDL 308
           RY                 IKNDHEEIAPSTIFA ASILEGVPYINGSPQNTFVPG++ L
Sbjct: 249 RYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQL 308

Query: 309 AEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLTSERQFKS 368
           AE     IAGDD KSGQTK+KSVLAQFLVDAGIKPVSIASYNHLGNNDG+NL++ +QF+S
Sbjct: 309 AEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFRS 368

Query: 369 KEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHN 428
           KEISK SV+DD+IASN ILYN+K G K+DHCIVIKYM  VGDSKVAMDEYYSELMLGGHN
Sbjct: 369 KEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHN 428

Query: 429 RISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLG---SDQQSYESFYSILSFLSYWL 485
           RISIHNVCEDSLLATPLIIDL+VM EFC+RVSYKK+     D   +E+FY +L+FLSYWL
Sbjct: 429 RISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPVLTFLSYWL 488

Query: 486 KAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529
           KAPLTR GF  +NGLNKQR  +ENFLRLLIGLP+ +ELRFEE+L
Sbjct: 489 KAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERL 532

>CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly
           similar to uniprot|P11986 Saccharomyces cerevisiae
           YJL153c INO1 myo-inositol-1-phosphate synthase
          Length = 538

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/538 (65%), Positives = 411/538 (76%), Gaps = 8/538 (1%)

Query: 1   MTVQRYFSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDL 60
           MTV +  S  +N   DK  Y E +L T Y Y  +VV  +      EV P  ++Y+F+VDL
Sbjct: 1   MTVNKGISIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDL 60

Query: 61  KIP-KIXXXXXXXXXXXXXXXXASVLANRDKIRFHTKD--GAKEANYYGSVTQSSTIKLG 117
             P ++                A+VLAN+  + F T+D  G  E NYYGS+TQSSTIKLG
Sbjct: 61  NKPERLGVMLVGLGGNNGSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLG 120

Query: 118 IDEQGNDVYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAK 177
           +D +G DVYVPFNS++P V+PNDFVV GWDINGA +  AM R+ VLE DL+ +L   M  
Sbjct: 121 VDSKGKDVYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKD 180

Query: 178 TVPLPSIYYPDFIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLD 237
             PL S+YYPDFIAANQDERADNC+N D ++G V+T GKW H+  IR DI+ FK  NDLD
Sbjct: 181 HKPLKSVYYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLD 240

Query: 238 KVIVLWTANTERYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGSP 297
           KVI+LWTANTERY                 IKNDH EIAPSTIFA ASILE  PYINGSP
Sbjct: 241 KVIILWTANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSP 300

Query: 298 QNTFVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDG 357
           QNTFVPG+I+LAEK+++LIAGDDFKSGQTK+KSVLAQFLVDAGI+PVSIASYNHLGNNDG
Sbjct: 301 QNTFVPGLIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDG 360

Query: 358 FNLTSERQFKSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDE 417
           +NL+S +QF+SKEISK SVVDD+I SN ILYN+K GNKIDHCIVIKYM+AVGDSKVAMDE
Sbjct: 361 YNLSSPQQFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDE 420

Query: 418 YYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKL-GSD----QQSYE 472
           YYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVM EFCSRV+Y+ + G D    +  +E
Sbjct: 421 YYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFE 480

Query: 473 SFYSILSFLSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKLK 530
           +FY +LSFLSYWLKAPLT+ G++ INGLNKQR  +ENFLRLLIGLPA+DELRFEE+LK
Sbjct: 481 NFYPVLSFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERLK 538

>TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {ON}
           Anc_1.195 YJL153C
          Length = 540

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/534 (65%), Positives = 406/534 (76%), Gaps = 11/534 (2%)

Query: 7   FSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDLKIPKIX 66
           F P I V NDK       L ++Y Y +++V K++   +  V    +DYEF VDL +PK+ 
Sbjct: 6   FEPKIIVNNDKCTIEGNTLKSKYTYTSNLVTKNDSTNSYIVDTVKKDYEFNVDLNLPKLG 65

Query: 67  XXXXXXXXXXXXXXXASVLANRDKIRFHTKD--GAKEANYYGSVTQSSTIKLGIDEQGND 124
                          ASVLAN++ + F++K+  G K+ANYYGSVTQSSTIKLGID + ND
Sbjct: 66  IMLVGLGGNNGTTLLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGIDPKTND 125

Query: 125 -VYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPS 183
            +YVPF  +LP  +PNDFV+ GWDI+  N  +AM R+ VLE+DLQ QL+ EM K  PL S
Sbjct: 126 EIYVPFTDILPLSNPNDFVITGWDISDLNCFEAMQRACVLEHDLQMQLKDEMEKIKPLKS 185

Query: 184 IYYPDFIAANQDERADNCINRDGKS-GNVS-------TKGKWSHVEQIRKDIKNFKSGND 235
           IYYPDFIA NQ+ERA++C NR  ++ GN         TK KWSHVEQIR DI+NFK  N+
Sbjct: 186 IYYPDFIALNQNERANHCFNRKSEAEGNKDPLSLDGLTKNKWSHVEQIRDDIRNFKKENN 245

Query: 236 LDKVIVLWTANTERYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYING 295
           LDKVIVLWTANTERY                 IKNDH E++PSTIFAVASILEGVPYING
Sbjct: 246 LDKVIVLWTANTERYSTIEAGVNDNADNLLNAIKNDHSEVSPSTIFAVASILEGVPYING 305

Query: 296 SPQNTFVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNN 355
           SPQNTFVPGVIDLAE+ ++ IAGDDFKSGQTK+KSVLAQFLVDAGIKP+SIASYNHLGNN
Sbjct: 306 SPQNTFVPGVIDLAEREHSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNN 365

Query: 356 DGFNLTSERQFKSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAM 415
           DGFNL+S  QFKSKEISKR V DD+I SN+IL+N+K G  IDHCIVIKY+NAVGDSKVAM
Sbjct: 366 DGFNLSSPMQFKSKEISKRGVCDDMIESNQILFNDKVGKTIDHCIVIKYLNAVGDSKVAM 425

Query: 416 DEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQSYESFY 475
           DEYYSELMLGGHNRISIHNVCEDSLLATPLIIDL+VM EFC+RV+YKKLG     YE FY
Sbjct: 426 DEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVTYKKLGEGATDYEQFY 485

Query: 476 SILSFLSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529
            +L+ LSYWLKAPLTR GFK INGL KQR  +ENFLRLLIGLP LD+LRFEE+L
Sbjct: 486 PVLTLLSYWLKAPLTRPGFKPINGLMKQRAALENFLRLLIGLPPLDDLRFEERL 539

>TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.195
           YJL153C
          Length = 536

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/536 (63%), Positives = 407/536 (75%), Gaps = 8/536 (1%)

Query: 1   MTVQRYFSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDL 60
           MT Q  F P + V  DK  Y+E +L T+Y Y N +V  ++   + +V+   +DYEF+ DL
Sbjct: 1   MTAQT-FVPAVKVQTDKCRYTEDELITKYTYKNVLVDSNQAKTSFDVKIQNEDYEFKTDL 59

Query: 61  KIPKIXXXXXXXXXXXXXXXXASVLANRDKIRFHTKD--GAKEANYYGSVTQSSTIKLGI 118
           KIPK+                ASVLAN+ K++F TK+  G K+ANYYGSVTQ+ST+KLG+
Sbjct: 60  KIPKVGVMLVGMGGNNGTTFVASVLANKKKLKFRTKNFKGLKDANYYGSVTQASTVKLGV 119

Query: 119 D-EQGNDVYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAK 177
           D E  NDVY+PFNS+LP V+PNDFVV GWDI   N  DAM  SQVLEYDL QQL+ EM++
Sbjct: 120 DSETLNDVYIPFNSLLPMVNPNDFVVSGWDIQDYNCYDAMVESQVLEYDLIQQLKPEMSQ 179

Query: 178 TVPLPSIYYPDFIAANQDERADNCINR-DGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDL 236
             PL SIYYPDF+A NQ ERA+NCINR D  S  +  K K S ++ IR DIK FK  N L
Sbjct: 180 IKPLKSIYYPDFLAMNQIERANNCINRKDNSSEVIDIKNKQSDLDHIRNDIKTFKQENHL 239

Query: 237 DKVIVLWTANTERYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGS 296
           DKVIVLWTA+TERY                 IK  HEEIAPSTIFAVASILEG  YINGS
Sbjct: 240 DKVIVLWTASTERYADIIEGVNDTADNLLNSIKTSHEEIAPSTIFAVASILEGAIYINGS 299

Query: 297 PQNTFVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNND 356
           PQNT VPGV+DL+++ N +IAGDDFK+GQTK+KSVLAQFL+DAGIKP+S+ASYNHLGNND
Sbjct: 300 PQNTLVPGVVDLSKRENTIIAGDDFKTGQTKLKSVLAQFLIDAGIKPLSVASYNHLGNND 359

Query: 357 GFNLTSERQFKSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMD 416
           G+NL++ +QF+SKEISK SV+DD+I SN+ILYN K G ++DHCIVIKYM AVGD+KVAMD
Sbjct: 360 GYNLSAPKQFRSKEISKSSVIDDMIESNEILYNAKTGAEVDHCIVIKYMPAVGDNKVAMD 419

Query: 417 EYYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGS---DQQSYES 473
           EYYSELMLGGHNRIS+HNVCEDSLLATP++IDL+VM EF SR+SYK++ S   ++  Y +
Sbjct: 420 EYYSELMLGGHNRISVHNVCEDSLLATPIMIDLMVMVEFISRISYKRVNSRDDEELEYST 479

Query: 474 FYSILSFLSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529
           F S LSFLSYWLKAP+ +KGF+ INGLNKQR  +ENFLRLLIGLP  DELRFEE+L
Sbjct: 480 FNSTLSFLSYWLKAPMVKKGFQPINGLNKQRLALENFLRLLIGLPPNDELRFEERL 535

>Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON}
           (48908..50323) [1416 nt, 472 aa]
          Length = 471

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/457 (72%), Positives = 379/457 (82%), Gaps = 10/457 (2%)

Query: 82  ASVLANRDKIRFHTKD--GAKEANYYGSVTQSSTIKLGIDEQGN-DVYVPFNSVLPFVSP 138
           ASVLAN++ + F++K+  G K+ANYYGSVTQSSTIKLGI+ + N DVY+PFN +LPFV+P
Sbjct: 15  ASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGINPETNEDVYIPFNEILPFVNP 74

Query: 139 NDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPSIYYPDFIAANQDERA 198
           NDFVV GWDIN +N  +AM R+ VLEYDLQ +L+  M    PL SIYYPDFIA NQ+ERA
Sbjct: 75  NDFVVSGWDINNSNCSEAMQRACVLEYDLQSKLKDYMKDVTPLKSIYYPDFIAINQNERA 134

Query: 199 DNCINR---DGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVIVLWTANTERYXXXXX 255
           +N INR   D    N+S KGKWSHVE IR DI+NFK+ N+LDKVIVLWTANTERY     
Sbjct: 135 NNVINRGTNDLSLENLS-KGKWSHVEHIRNDIRNFKNENNLDKVIVLWTANTERYSVIEN 193

Query: 256 XXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGSPQNTFVPGVIDLAEKHNAL 315
                       IKNDH E++PSTIFAVASILEGVPYINGSPQNTFVPGVI+LAE+ ++ 
Sbjct: 194 GINDTADNLINSIKNDHAEVSPSTIFAVASILEGVPYINGSPQNTFVPGVIELAEREHSF 253

Query: 316 IAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLTSERQFKSKEISKRS 375
           IAGDDFKSGQTK+KSVLAQFLVDAGIKP+SIASYNHLGNNDG+NL+S  QFKSKEISKR 
Sbjct: 254 IAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSSPMQFKSKEISKRG 313

Query: 376 VVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHNRISIHNV 435
           V DD+I SN+IL+N+K G  IDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHNRISIHNV
Sbjct: 314 VCDDMIESNQILFNDKVGKTIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHNRISIHNV 373

Query: 436 CEDSLLATPLIIDLIVMAEFCSRVSYKKL-GSD--QQSYESFYSILSFLSYWLKAPLTRK 492
           CEDSLLATPLIIDL+VM EFC+RV+YKKL G+D  ++ +E FY +L+ LSYWLKAPLTR 
Sbjct: 374 CEDSLLATPLIIDLLVMTEFCTRVTYKKLDGADATKKEFEPFYPVLTLLSYWLKAPLTRP 433

Query: 493 GFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529
           GFK INGL KQR  +ENF+RLLIGLP LDELRFEE+L
Sbjct: 434 GFKAINGLMKQRAALENFMRLLIGLPPLDELRFEERL 470

>KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {ON}
           Anc_1.195 YJL153C
          Length = 542

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/508 (62%), Positives = 394/508 (77%), Gaps = 3/508 (0%)

Query: 24  KLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDLKIPKIXXXXXXXXXXXXXXXXAS 83
           +L ++Y+Y NS+V K      LE+ P  QDY+F+++L   K+                AS
Sbjct: 37  ELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLNPNKVGIMLVGLGGNNGSTFLAS 96

Query: 84  VLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDEQGNDVYVPFNSVLPFVSPNDFVV 143
           +LAN++ I F+T++G  E NYYGS+TQSST+KLGID +GNDV+ PFNS+LP V+PNDFVV
Sbjct: 97  LLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSEGNDVFAPFNSILPMVNPNDFVV 156

Query: 144 GGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPSIYYPDFIAANQDERADNCIN 203
            GWDIN  NL  AM R++VLEYDLQ +L+  M    PL SIYYPDFIA NQ ERA+NCIN
Sbjct: 157 SGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSIYYPDFIAMNQFERANNCIN 216

Query: 204 RDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVIVLWTANTERYXXXXXXXXXXXXX 263
           ++   G  +T+ KW+ + +IR+DIK+FKS N+L+ +IVLWTANTER              
Sbjct: 217 QN-DDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWTANTERCVEIIPGVNDTMDN 275

Query: 264 XXXXIKNDHEEIAPSTIFAVASILEGVPYINGSPQNTFVPGVIDLAEKHNALIAGDDFKS 323
               IK++H EI+PS IFA A+I+E VPYINGSPQNTFVPG+I+LAE ++ LIAGDDFK+
Sbjct: 276 LIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPGLIELAEHNDVLIAGDDFKT 335

Query: 324 GQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLTSERQFKSKEISKRSVVDDVIAS 383
           GQTK+KSV+ QFLVDAGIKPVSIASYNHLGNNDG NL+S  QF+SKEISK SV+DD I S
Sbjct: 336 GQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHAQFRSKEISKSSVIDDCINS 395

Query: 384 NKILYNEK-AGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHNRISIHNVCEDSLLA 442
           N+IL+N+K + +K +HCIVIKYM AVGDSKVAMDEYYS+LMLGGHNRISIHNVCEDSLLA
Sbjct: 396 NEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLMLGGHNRISIHNVCEDSLLA 455

Query: 443 TPLIIDLIVMAEFCSRVSYKKLGSDQQSYESFYSILSFLSYWLKAPLTRKGFKTINGLNK 502
           +P+IIDL+VM EF SR++YKK+G DQ+ +  FY ILSFLSYWLKAPLTR GFK IN LN+
Sbjct: 456 SPIIIDLLVMTEFLSRITYKKMGEDQE-FHKFYPILSFLSYWLKAPLTRSGFKPINSLNR 514

Query: 503 QRQGIENFLRLLIGLPALDELRFEEKLK 530
           QR  +ENFLRLL+GLP  DELRFEE+L+
Sbjct: 515 QRLALENFLRLLVGLPPNDELRFEERLR 542

>KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {ON}
           Anc_1.195 YJL153C
          Length = 592

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/529 (61%), Positives = 395/529 (74%), Gaps = 10/529 (1%)

Query: 7   FSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLE-VRPTAQDYEFQVDLKIP-K 64
           F+P +   + +T+    +L + ++Y N+V+      G +  + P   +Y F+VDL +P K
Sbjct: 67  FNPQLCTLSRETN----ELVSSFKYQNTVIDTDPSTGAVRGLSPREINYNFKVDLSVPEK 122

Query: 65  IXXXXXXXXXXXXXXXXASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDEQGND 124
           +                AS+LANR K+ F+ K+G + AN++GS+TQSST+KLG+D +GND
Sbjct: 123 VGVLLVGFGGNNGSTLLASILANRQKMVFNNKEGPQRANFFGSMTQSSTMKLGVDVKGND 182

Query: 125 VYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPSI 184
           V+VPFNSVLP   P +FVV GWDIN ANL +AM R  VLEYDLQ +L+ +M   VP+ S+
Sbjct: 183 VFVPFNSVLPMADPTEFVVDGWDINNANLFEAMQRGHVLEYDLQMKLKSQMENIVPMKSV 242

Query: 185 YYPDFIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVIVLWT 244
           YYPDFIA NQ +RA+NCIN        ST  K   +EQIRKDI++FK+ N LDKVIVLWT
Sbjct: 243 YYPDFIALNQFDRANNCINATQGGEGFSTAQKRKDLEQIRKDIRHFKATNKLDKVIVLWT 302

Query: 245 ANTERYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGSPQNTFVPG 304
           ANTER                  I+++HEEIAPSTIFA ASILEGVPYINGSPQNTFVPG
Sbjct: 303 ANTERCVDIIPSVNDSADSLLKAIEDNHEEIAPSTIFAAASILEGVPYINGSPQNTFVPG 362

Query: 305 VIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLTSER 364
           +IDLAE+H+ LIAGDDFKSGQTK+KSVL QFLVDAGIKPVSIASYNHLGNNDG NL+S+R
Sbjct: 363 LIDLAERHDVLIAGDDFKSGQTKLKSVLMQFLVDAGIKPVSIASYNHLGNNDGKNLSSQR 422

Query: 365 QFKSKEISKRSVVDDVIASNKILYNE-KAGNKIDHCIVIKYMNAVGDSKVAMDEYYSELM 423
           QF+SKEISK SV+DD I SNKILYN+ K  +K++HCIVIKY+ AVGDSKVAMDEYYSELM
Sbjct: 423 QFRSKEISKSSVIDDCIQSNKILYNDHKDKSKVNHCIVIKYLPAVGDSKVAMDEYYSELM 482

Query: 424 LGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKL---GSDQQSYESFYSILSF 480
           LGGHNRISIHNVCEDSLLA PLIIDL+VM EF SR+ Y+K+         +  FY IL+F
Sbjct: 483 LGGHNRISIHNVCEDSLLAAPLIIDLLVMTEFFSRIKYQKIEDGAPPSDKFSDFYPILTF 542

Query: 481 LSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529
           LSYWLKAPLTRKGF+ IN LN+QR  +ENFLRLLIGLP  DELRFEE+L
Sbjct: 543 LSYWLKAPLTRKGFQPINSLNRQRLALENFLRLLIGLPPNDELRFEERL 591

>NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.195
           YJL153C
          Length = 583

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/523 (61%), Positives = 392/523 (74%), Gaps = 11/523 (2%)

Query: 13  VANDKTHYS--ETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDLKIPKIXXXXX 70
           +A  K  YS  +  L T Y+Y  S V  ++ DG+++V    QDY+F++DLK+PK+     
Sbjct: 65  LATGKCQYSAKDNVLLTDYKYKTSTVKNNKADGSIKVSLEEQDYKFKIDLKVPKVGVMLV 124

Query: 71  XXXXXXXXXXXASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDEQ-GNDVYVPF 129
                      AS+LAN+  I FH KDG  + NY GS+TQS+T+ LG DE+ G D + PF
Sbjct: 125 GFGGNNGSTLLASILANKHNISFHNKDGEIKPNYLGSMTQSATVHLGRDEETGRDFFQPF 184

Query: 130 NSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPSIYYPDF 189
           N+VLP V+PND +V GWDI+  NL ++M R+QVL+YDLQ+QL   M +  P+ SIYYP+F
Sbjct: 185 NAVLPMVNPNDLIVTGWDISNLNLAESMQRAQVLDYDLQRQLTPLMKEYTPMKSIYYPEF 244

Query: 190 IAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVIVLWTANTER 249
           IAANQ +RA+NCIN  G     +TKGKW H+ Q+R DIK FK+ N LDKVIVLWTANTE+
Sbjct: 245 IAANQFDRANNCINSKGDE--FTTKGKWDHMMQVRSDIKTFKTENQLDKVIVLWTANTEK 302

Query: 250 YXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGSPQNTFVPGVIDLA 309
           +                 IKNDHEEIAPST+FAVASILEGVPYINGSPQNTFVPG+I LA
Sbjct: 303 FAQIVPGVNDTHENLLQAIKNDHEEIAPSTLFAVASILEGVPYINGSPQNTFVPGLIKLA 362

Query: 310 EKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLTSERQFKSK 369
           E  N LIAGDDFK+GQTK+KSVL QFLVDAGI+PVSIASYNHLGNNDG NL+S+ QFKSK
Sbjct: 363 EHENVLIAGDDFKTGQTKLKSVLTQFLVDAGIRPVSIASYNHLGNNDGKNLSSQMQFKSK 422

Query: 370 EISKRSVVDDVIASNKILYN---EKAGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGG 426
           EISK  V++D++ SN I+Y    EKA  +IDHCIVIKYM AVGDSKVAMDEYY+ELMLGG
Sbjct: 423 EISKSGVINDILESNSIMYGDDPEKA--RIDHCIVIKYMPAVGDSKVAMDEYYNELMLGG 480

Query: 427 HNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQSYESFYSILSFLSYWLK 486
           HNRIS+HNVCEDSLLA P+I+DL++M EFCSRV+YK+  +D   Y+ F+ +L+ LSYWLK
Sbjct: 481 HNRISLHNVCEDSLLAAPIILDLVIMCEFCSRVTYKE-ANDNGDYKKFHPVLTLLSYWLK 539

Query: 487 APLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529
           APL R+ F  +NGL KQR  +ENF+RLLIGLPA DELRFEE+L
Sbjct: 540 APLAREDFLPVNGLMKQRAALENFMRLLIGLPANDELRFEERL 582

>NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195
           YJL153C
          Length = 567

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/540 (57%), Positives = 392/540 (72%), Gaps = 17/540 (3%)

Query: 7   FSPTINVANDKTHYSETKLTTQYRYVNSVV--AKSEVDGTLEVRPTAQDYEFQVDLKIPK 64
           F+ ++N    K   SE  L T Y Y  ++V   +S  +  + V    +DY F+VDLKIPK
Sbjct: 27  FNWSLNSDKCKYSQSENALLTNYTYNKTIVDIQQSHNNNNINVSTLTKDYNFKVDLKIPK 86

Query: 65  IXXXXXXXXXXXXXXXXASVLANRDKIRFHTKDGA----KEANYYGSVTQSSTIKLGIDE 120
           I                AS+LAN++ + F+ KDG     +   + GS+TQSST+ LG ++
Sbjct: 87  IGVMLVGMGGNNGTTFLASLLANKNNLTFNNKDGPYNIKERGGFLGSMTQSSTLYLGKNQ 146

Query: 121 QGN-DVYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTV 179
           Q N DVYVPFNS+LP  +PND ++ GWDI+G N+  AM R++VLEYDLQ++L+  M    
Sbjct: 147 QTNEDVYVPFNSILPMCNPNDLIISGWDISGENMFKAMQRAKVLEYDLQEKLKPLMESYT 206

Query: 180 PLPSIYYPDFIAANQDERADNCINRDGKSGN---VSTKGKWSHVEQIRKDIKNFKSGNDL 236
           PL SIYYPDFIA NQ +RADNCIN   K  N    S K KW+ +  IR++IK+FK+ N L
Sbjct: 207 PLKSIYYPDFIAMNQLDRADNCINYTTKGTNHDAYSIKNKWNDLLTIRQNIKDFKNDNKL 266

Query: 237 DKVIVLWTANTERYXXXXXXXXXXXXXXXXXIKNDHEEIAPSTIFAVASILEGVPYINGS 296
           DKVI+LWTA TE++                 IK +H+EIAPSTIFA ASILE  PYINGS
Sbjct: 267 DKVIILWTATTEKFAEVIPGINDTFENLLNSIKANHKEIAPSTIFATASILENCPYINGS 326

Query: 297 PQNTFVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNND 356
           PQNTFVPG+IDLAE+ N LIAGDDFK+GQTK+KSVLAQFL+DAGIKP+SIASYNHLGNND
Sbjct: 327 PQNTFVPGLIDLAERENVLIAGDDFKTGQTKLKSVLAQFLIDAGIKPISIASYNHLGNND 386

Query: 357 GFNLTSERQFKSKEISKRSVVDDVIASNKILYNE-----KAGNKIDHCIVIKYMNAVGDS 411
           G NL+S  QFKSKEI+K +V+DD+I SN+ILY +     K    +DHCIVIKYM ++GDS
Sbjct: 387 GLNLSSSLQFKSKEITKSNVIDDMIKSNQILYPQSDKMKKKNKDVDHCIVIKYMESIGDS 446

Query: 412 KVAMDEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQ--Q 469
           KVAMDEYY+ELMLGGHNRISIHNVCEDSLLA+P+I+DLI+M EFCSR++Y + G+ Q   
Sbjct: 447 KVAMDEYYNELMLGGHNRISIHNVCEDSLLASPIILDLIIMCEFCSRITYIESGNQQGDG 506

Query: 470 SYESFYSILSFLSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529
           +Y+ FY +LS LSYWLKAPLTR G++ INGLNKQR  ++NF+RLLIGLP +DELRFEE+L
Sbjct: 507 NYQQFYPVLSLLSYWLKAPLTRPGYEPINGLNKQRMALDNFMRLLIGLPPIDELRFEERL 566

>TBLA0D04060 Chr4 complement(1009971..1011230) [1260 bp, 419 aa]
           {ON} Anc_8.282 YDR124W
          Length = 419

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 339 AGIKPVSIASYNHLGNNDGFNLTSERQFKSKEISKRSVVDDVIASNK 385
           + I P++ +S N +  N  FNL S RQ     +  + +V  ++ASNK
Sbjct: 267 SNILPIASSSTNPIKRNVNFNLQSRRQKIGSPLRHQLIVSPLVASNK 313

>SAKL0H22550g Chr8 complement(1958491..1961990,1962073..1962163)
           [3591 bp, 1196 aa] {ON} similar to uniprot|P34111
           Saccharomyces cerevisiae YAL001C TFC3 Largest of six
           subunits of the RNA polymerase III transcription
           initiation factor complex (TFIIIC); part of the TauB
           domain of TFIIIC that binds DNA at the BoxB promoter
           sites of tRNA and similar genes; cooperates with Tfc6p
           in DNA binding
          Length = 1196

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 22/48 (45%)

Query: 93  FHTKDGAKEANYYGSVTQSSTIKLGIDEQGNDVYVPFNSVLPFVSPND 140
           F T  G KE    GS       K  I E  +  YVP N+ L F+S ND
Sbjct: 422 FRTLSGTKEPLDLGSFKDWKEQKKTICELNDKNYVPLNNTLRFISRND 469

>SAKL0G18766g Chr7 (1621177..1622211) [1035 bp, 344 aa] {ON} similar
           to uniprot|P47173 Saccharomyces cerevisiae YJR142W
           Hypothetical ORF
          Length = 344

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 332 LAQFLVDAGIKPVSIASYNHL-GNNDGFNLTSERQFKSKEI 371
           L Q LV+  IKPV + SY H  G+ +  N  SE  F + E+
Sbjct: 220 LPQSLVEESIKPVGVVSYFHFQGDIENDNFESESSFITGEV 260

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,119,600
Number of extensions: 2280656
Number of successful extensions: 6199
Number of sequences better than 10.0: 24
Number of HSP's gapped: 6279
Number of HSP's successfully gapped: 24
Length of query: 530
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 416
Effective length of database: 40,409,475
Effective search space: 16810341600
Effective search space used: 16810341600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)