Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C020607.341ON88884571e-60
Kwal_YGOB_Anc_7.3417.341ON86882557e-30
KLTH0H01452g7.341ON86882489e-29
SAKL0F10956g7.341ON86842366e-27
ZYRO0F11528g7.341ON121852371e-26
TPHA0F029107.341ON108992142e-23
NCAS0A140807.341ON78842071e-22
Kpol_530.377.341ON88842028e-22
Ecym_45207.341ON91842002e-21
ACL158W7.341ON95841985e-21
TBLA0E004707.341ON1161021934e-20
CAGL0I03432g7.341ON149901921e-19
NDAI0A019507.341ON122881553e-14
Suva_4.847.341ON81841454e-13
YDL160C-A (MHF2)7.341ON80721446e-13
KNAG0C038107.341ON82851376e-12
Smik_4.767.341ON80631367e-12
KLLA0C16709g7.341ON79801332e-11
KAFR0B009007.341ON78851245e-10
Skud_4.957.341ON79841202e-09
SAKL0G00396g2.2ON106863622.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C02060
         (88 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...   180   1e-60
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...   102   7e-30
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...   100   9e-29
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...    96   6e-27
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    96   1e-26
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    87   2e-23
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               84   1e-22
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    82   8e-22
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...    82   2e-21
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...    81   5e-21
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    79   4e-20
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    79   1e-19
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    64   3e-14
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...    60   4e-13
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...    60   6e-13
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    57   6e-12
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...    57   7e-12
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    56   2e-11
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    52   5e-10
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...    51   2e-09
SAKL0G00396g Chr7 complement(31891..35097) [3207 bp, 1068 aa] {O...    28   2.2  

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 88

 Score =  180 bits (457), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%)

Query: 1  MVDKIPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEH 60
          MVDKIPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEH
Sbjct: 1  MVDKIPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEH 60

Query: 61 SGAQRNSNEIVLTHEDLENITGLLLLDM 88
          SGAQRNSNEIVLTHEDLENITGLLLLDM
Sbjct: 61 SGAQRNSNEIVLTHEDLENITGLLLLDM 88

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 86

 Score =  102 bits (255), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 69/88 (78%), Gaps = 2/88 (2%)

Query: 1  MVDKIPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEH 60
          M D +PK+TIAR FQ  +F+N+ST IT+ T+ ++ +Y+E+FVREA+LRS  NK+Q+K EH
Sbjct: 1  MPDSVPKDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQVKDEH 60

Query: 61 SGAQRNSNEIVLTHEDLENITGLLLLDM 88
              +  +++VLTH+DLE ++GLLLLDM
Sbjct: 61 QD--QLGSQVVLTHKDLERVSGLLLLDM 86

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
          weakly similar to uniprot|Q3E829 Saccharomyces
          cerevisiae YDL160c-a
          Length = 86

 Score =  100 bits (248), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 67/88 (76%), Gaps = 2/88 (2%)

Query: 1  MVDKIPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEH 60
          M + IP +TIAR FQ  +F+++ST IT+ T+ ++  Y+EVFVREA+LRS  NKEQ+K EH
Sbjct: 1  MPNSIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEH 60

Query: 61 SGAQRNSNEIVLTHEDLENITGLLLLDM 88
              +  +++VLTH+DLE ++GLLLLDM
Sbjct: 61 QD--QLGDQVVLTHKDLERVSGLLLLDM 86

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
          similar to uniprot|Q3E829 Saccharomyces cerevisiae
          YDL160C-A Putative protein of unknown function
          Length = 86

 Score = 95.5 bits (236), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (73%), Gaps = 3/84 (3%)

Query: 5  IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64
          +PK+TIAR FQ  +F  +ST IT++TV +  KY+E+FVREAVLRS  NKE++K E    +
Sbjct: 6  LPKDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKEKVKPE---TE 62

Query: 65 RNSNEIVLTHEDLENITGLLLLDM 88
             N  VL+HEDLE I+GLLLLDM
Sbjct: 63 SLDNGTVLSHEDLEEISGLLLLDM 86

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 95.9 bits (237), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 6/85 (7%)

Query: 5   IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64
           +PKETI R  ++ AFE+EST IT+ETV M+QKY+EVFVREAV RS ANK+       G+ 
Sbjct: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDS-----QGSH 96

Query: 65  RNSN-EIVLTHEDLENITGLLLLDM 88
            + + EI L HEDLE ITG+LLLDM
Sbjct: 97  GDGDGEIQLNHEDLEKITGMLLLDM 121

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 87.0 bits (214), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/99 (52%), Positives = 65/99 (65%), Gaps = 16/99 (16%)

Query: 5   IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQ-------IK 57
           IPK+TIAR  Q+ +F  E T I+ E+VG++QKYME+FVREAVLRS  N+EQ       +K
Sbjct: 10  IPKDTIARILQLESF-GEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68

Query: 58  VEHSGA--------QRNSNEIVLTHEDLENITGLLLLDM 88
              + A        Q + N I LTHEDLE I+GLLLLDM
Sbjct: 69  KAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 84.3 bits (207), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 8/84 (9%)

Query: 5  IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64
          IPKETIA+  Q+ AFEN  T +T+ET+ M+Q+YME+F+REA+ RS  NKE+        +
Sbjct: 3  IPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEK--------E 54

Query: 65 RNSNEIVLTHEDLENITGLLLLDM 88
              +IV+  +DLE + GLLLLDM
Sbjct: 55 LGQTDIVIDEKDLERVVGLLLLDM 78

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
          complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 82.4 bits (202), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 3/84 (3%)

Query: 5  IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64
          IPKETIAR  +  +FE+ ST IT++ V  +QKYME+FVREA++RS   K +++ E+S   
Sbjct: 7  IPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAKLEEENSF-- 64

Query: 65 RNSNEIVLTHEDLENITGLLLLDM 88
               + LTH DLE I GLLLLDM
Sbjct: 65 -TGVRVELTHTDLEEIAGLLLLDM 87

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
          Ashbya gossypii ACL158W
          Length = 91

 Score = 81.6 bits (200), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 59/84 (70%), Gaps = 1/84 (1%)

Query: 5  IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64
          +P +TIAR FQ+ +F  +ST IT++T+ + +KY+++FVREAVLRS  NK+++K E  G  
Sbjct: 9  VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKE-DGKG 67

Query: 65 RNSNEIVLTHEDLENITGLLLLDM 88
                VL H DLE I+G+LLLD 
Sbjct: 68 SLIEGPVLHHTDLEEISGILLLDF 91

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
          of Saccharomyces cerevisiae YDL161CX; YDL161CX was
          overlooked in Saccharomyces cerevisiae
          Length = 95

 Score = 80.9 bits (198), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 59/84 (70%), Gaps = 1/84 (1%)

Query: 5  IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64
          IP +TIAR F   +F  +ST IT++ V ++++YM++F+REAVLRS  NKE++K E + A 
Sbjct: 13 IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQE-TRAD 71

Query: 65 RNSNEIVLTHEDLENITGLLLLDM 88
            +   VL H DLE I+G+L+LD 
Sbjct: 72 SFAEGPVLQHTDLEEISGVLILDF 95

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 79.0 bits (193), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 59/102 (57%), Gaps = 17/102 (16%)

Query: 4   KIPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANK-EQIKVEHSG 62
           K+P+ TIAR  Q  +F +E+T IT  TV  +QKYME+F+REA LRS  NK EQI  E S 
Sbjct: 15  KLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSA 74

Query: 63  AQRNSN----------------EIVLTHEDLENITGLLLLDM 88
            +                    +I L+HE LE ITGLLLLDM
Sbjct: 75  VKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 78.6 bits (192), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 55/90 (61%), Gaps = 16/90 (17%)

Query: 5   IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGA- 63
           +P++TIAR  QV AF+++ T I  + V  +Q+Y++VF REAVLRS        +EH  A 
Sbjct: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRS--------IEHHDAS 121

Query: 64  -----QRNSNEIVLTHEDLENITGLLLLDM 88
                Q    EI  TH DLENI GLLLLDM
Sbjct: 122 QEGLEQEQDKEI--THTDLENIAGLLLLDM 149

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 64.3 bits (155), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (62%), Gaps = 4/88 (4%)

Query: 5   IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKV----EH 60
           I  ETI +  +  +F+N+ T IT ET+ M+Q+YM++F++EAV+RS  NK   +V    + 
Sbjct: 35  ILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVEDFDDE 94

Query: 61  SGAQRNSNEIVLTHEDLENITGLLLLDM 88
             A      I LTH DLE I GLLL+++
Sbjct: 95  EDADEEDKTIELTHLDLERIVGLLLMEL 122

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
          YDL160C-A (REAL)
          Length = 81

 Score = 60.5 bits (145), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 5/84 (5%)

Query: 5  IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64
          +PKE I +        +++  I D+ + M+QKY+E+F+ EA LRS  + +    + SGA 
Sbjct: 3  LPKEAIIKILSQNN-SDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHK----DSSGAH 57

Query: 65 RNSNEIVLTHEDLENITGLLLLDM 88
               + L+H DLE I GLLL+DM
Sbjct: 58 DGDGPLELSHLDLERIVGLLLMDM 81

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
          MHF2Protein of unknown function; ortholog of human
          MHF2, and component of the heterotetrameric MHF
          histone-fold complex that in humans interacts with both
          DNA and Mph1p ortholog FANCM to stabilize and remodel
          blocked replication forks and repair damaged DNA; mhf2
          srs2 double mutants are MMS hypersensitive
          Length = 80

 Score = 60.1 bits (144), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (66%), Gaps = 7/72 (9%)

Query: 20 ENESTN---ITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQRNSNEIVLTHED 76
          +NE  N   I DE V M+QKY+++F+ EAVLRS  + + I    +G + + + + L+H+D
Sbjct: 13 QNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDI----NGERGDKSPLELSHQD 68

Query: 77 LENITGLLLLDM 88
          LE I GLLL+DM
Sbjct: 69 LERIVGLLLMDM 80

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 82

 Score = 57.4 bits (137), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (58%), Gaps = 11/85 (12%)

Query: 4  KIPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGA 63
          +I +ET++R     +F+N+ST I D+ +  +QKY+E +V+E +LRS  NK+         
Sbjct: 8  QISRETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD--------- 57

Query: 64 QRNSNEIVLTHEDLENITGLLLLDM 88
              N   LT  D+E I GLLLLDM
Sbjct: 58 -LGVNPAELTERDIERILGLLLLDM 81

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
          YDL160C-A (REAL)
          Length = 80

 Score = 57.0 bits (136), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (66%), Gaps = 4/63 (6%)

Query: 26 ITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQRNSNEIVLTHEDLENITGLLL 85
          I+DE + M+QKY+++F+ EA LRS  + + I  EH       + + L+H+DLE + G+LL
Sbjct: 22 ISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHD----KKDPLELSHQDLERVVGVLL 77

Query: 86 LDM 88
          +DM
Sbjct: 78 MDM 80

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON}
          conserved hypothetical protein
          Length = 79

 Score = 55.8 bits (133), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 10/80 (12%)

Query: 9  TIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQRNSN 68
          TIAR  Q   F++ +T IT+E + +++ Y+E+FVRE VLRS  NK  +  + +       
Sbjct: 9  TIARILQTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLENKADMLADKT------- 61

Query: 69 EIVLTHEDLENITGLLLLDM 88
             +   DLE + GLLL+D 
Sbjct: 62 ---VDFVDLEAVAGLLLMDF 78

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 78

 Score = 52.4 bits (124), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/85 (45%), Positives = 47/85 (55%), Gaps = 10/85 (11%)

Query: 5  IPKETIARTFQVGAFEN-ESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGA 63
          IPKETI+R       EN E+ +I  ETV  + KY +V + E VLRS  NKE I      A
Sbjct: 3  IPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLENKENI------A 56

Query: 64 QRNSNEIVLTHEDLENITGLLLLDM 88
          +       L  +DLE I GLLLLDM
Sbjct: 57 EATP---TLDVDDLEKIIGLLLLDM 78

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
          YDL160C-A (REAL)
          Length = 79

 Score = 50.8 bits (120), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 6/84 (7%)

Query: 5  IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64
          + K+ + +      F  +   I D+ + M+Q Y+++F+ EA LRS  +++    + SG  
Sbjct: 2  LSKDALIKILSQNNFRKD-IKIDDKVLPMIQNYLDIFIEEAALRSLQSQK----DASGGH 56

Query: 65 RNSNEIVLTHEDLENITGLLLLDM 88
          R+   + L+H DLE I GLLL+DM
Sbjct: 57 RDG-PLELSHLDLERIVGLLLMDM 79

>SAKL0G00396g Chr7 complement(31891..35097) [3207 bp, 1068 aa] {ON}
           similar to uniprot|P35688 Saccharomyces cerevisiae
           YDL240W LRG1 Putative GTPase-activating protein (GAP)
           involved in the Pkc1p-mediated signaling pathway that
           controls cell wall integrity appears to specifically
           regulate 1 3-beta-glucan synthesis
          Length = 1068

 Score = 28.5 bits (62), Expect = 2.2,   Method: Composition-based stats.
 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 3/63 (4%)

Query: 22  ESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQRNSNEIVLTHE-DLENI 80
           E +N   ET+ M Q Y+       + R  + ++ ++V H   +   + I+ T E D+ N 
Sbjct: 567 ERSNSVKETISMQQTYIRTL--NDIKRLKSRRQSVRVTHDKQEARRSRILETTETDINNT 624

Query: 81  TGL 83
           T +
Sbjct: 625 TAV 627

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.335 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,336,182
Number of extensions: 269818
Number of successful extensions: 823
Number of sequences better than 10.0: 26
Number of HSP's gapped: 803
Number of HSP's successfully gapped: 26
Length of query: 88
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 28
Effective length of database: 46,601,439
Effective search space: 1304840292
Effective search space used: 1304840292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)