Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C020507.342ON5012438311e-105
ZYRO0F11550g7.342ON5382466822e-82
Skud_4.947.342ON4472436272e-75
Smik_4.757.342ON4602436282e-75
YDL161W (ENT1)7.342ON4542436202e-74
Suva_4.837.342ON4622436091e-72
TPHA0D045607.342ON4872446093e-72
NCAS0H006707.342ON4832536058e-72
Skud_12.2707.342ON6262706095e-71
YLR206W (ENT2)7.342ON6132076052e-70
Smik_12.2647.342ON6122076033e-70
Suva_10.3007.342ON6182636017e-70
SAKL0F10934g7.342ON4982495842e-68
KAFR0L014607.342ON5502565784e-67
KLLA0C16731g7.342ON4782495612e-65
Kpol_2001.707.342ON5332455609e-65
CAGL0A03872g7.342ON5102545511e-63
KNAG0C038007.342ON4472525313e-61
KLTH0H01430g7.342ON5021935282e-60
Kwal_56.246107.342ON5081935204e-59
NDAI0D006107.342ON4862635185e-59
TBLA0E004807.342ON5991965177e-58
Ecym_47317.342ON5141985056e-57
KAFR0B008907.342ON4141264637e-52
ACL157C7.342ON5151834662e-51
KNAG0B026507.342ON6461314302e-45
TBLA0E020407.342ON7012494128e-43
Kwal_47.168574.346ON3821292022e-16
KLTH0D16896g4.346ON4011291971e-15
NDAI0D032004.346ON4351291972e-15
Suva_12.2164.346ON4101291962e-15
SAKL0G17952g4.346ON4151291952e-15
NCAS0A062104.346ON4231091952e-15
TBLA0E047604.346ON4261301943e-15
Skud_10.3494.346ON4101291944e-15
KLLA0B04587g4.346ON4001291925e-15
YJR125C (ENT3)4.346ON4081291925e-15
TDEL0D007104.346ON3751291915e-15
KNAG0M003804.346ON4031291926e-15
KAFR0B067404.346ON3991291916e-15
Smik_10.4184.346ON4091291917e-15
CAGL0H04323g4.346ON4121091901e-14
Kpol_1001.24.346ON4181301873e-14
ZYRO0B14784g4.346ON4241301845e-14
AER155C4.346ON3641081828e-14
TPHA0B004004.346ON3991291783e-13
Ecym_11334.346ON3921091765e-13
Kwal_55.206114.17ON2541101531e-10
SAKL0H25762g4.17ON2621121486e-10
TBLA0B062204.346ON3391081338e-08
TDEL0G017404.17ON257981273e-07
KLLA0D03949g4.17ON2251021254e-07
KLTH0E05874g4.17ON2551001264e-07
Ecym_84074.17ON2541121231e-06
Kpol_388.54.17ON2681071231e-06
ZYRO0G07876g4.17ON259991168e-06
TPHA0F002304.17ON2801071123e-05
CAGL0E03806g4.17ON2601091113e-05
TBLA0G006504.17ON4231071124e-05
YHR161C (YAP1801)5.84ON637791063e-04
ACL061C4.17ON2341001033e-04
SAKL0H02530g5.84ON669721036e-04
NDAI0H002804.17ON310107990.001
TBLA0H012108.335ON49198990.002
NCAS0C058404.17ON267102970.002
Skud_8.2255.84ON62179990.002
NCAS0B036608.335ON416113980.002
Smik_8.2455.84ON62772960.004
CAGL0E01199g8.335ON41298950.005
Suva_10.354.17ON24794930.005
KAFR0B058008.335ON38297940.006
KLTH0G11902g8.335ON399131940.006
YLL038C (ENT4)4.17ON24794930.006
KLLA0D16654g8.335ON399129940.007
Skud_12.304.17ON24793920.008
Smik_12.194.17ON24794910.010
ZYRO0F13684g8.335ON40798920.012
NDAI0J009308.335ON418113910.015
Kwal_YGOB_27.112618.335ON404129900.018
KNAG0A051008.335ON42198890.023
Kpol_344.88.335ON384115890.026
SAKL0H15290g8.335ON393115870.049
TBLA0A040408.335ON415112860.055
AGR046C8.335ON38798850.085
Kwal_27.11263singletonOFF275128840.091
KAFR0I014604.17ON275113830.096
Kpol_1036.768.335ON368120830.13
Suva_2.3158.335ON40398790.39
NDAI0A028305.84ON47377790.47
TPHA0C007408.335ON38597780.54
TDEL0F045908.335ON36197770.60
Smik_4.3988.335ON41698770.76
YDR153C (ENT5)8.335ON41198770.78
Skud_4.4128.335ON40698770.79
NCAS0D014605.84ON67836751.5
KNAG0E006105.84ON60472741.8
NCAS0E038205.84ON42877722.8
TDEL0B003208.863ON63738705.2
Ecym_42648.335ON40870696.3
Ecym_35215.84ON48130697.4
TDEL0G010805.84ON51542688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C02050
         (501 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   324   e-105
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   267   2e-82
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   246   2e-75
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   246   2e-75
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   243   2e-74
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   239   1e-72
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   239   3e-72
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    237   8e-72
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   239   5e-71
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   237   2e-70
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   236   3e-70
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   236   7e-70
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   229   2e-68
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   227   4e-67
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   220   2e-65
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   220   9e-65
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   216   1e-63
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   209   3e-61
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   207   2e-60
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   204   4e-59
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   204   5e-59
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   203   7e-58
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   199   6e-57
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   182   7e-52
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   184   2e-51
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   170   2e-45
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   163   8e-43
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    82   2e-16
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    80   1e-15
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    80   2e-15
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    80   2e-15
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    80   2e-15
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    80   2e-15
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    79   3e-15
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    79   4e-15
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    79   5e-15
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    79   5e-15
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    78   5e-15
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    79   6e-15
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    78   6e-15
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    78   7e-15
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    78   1e-14
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    77   3e-14
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    75   5e-14
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    75   8e-14
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    73   3e-13
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    72   5e-13
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    64   1e-10
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    62   6e-10
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    56   8e-08
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    54   3e-07
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    53   4e-07
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    53   4e-07
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    52   1e-06
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    52   1e-06
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    49   8e-06
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    48   3e-05
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    47   3e-05
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    48   4e-05
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    45   3e-04
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    44   3e-04
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    44   6e-04
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    43   0.001
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    43   0.002
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    42   0.002
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    43   0.002
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    42   0.002
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    42   0.004
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    41   0.005
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    40   0.005
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    41   0.006
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    41   0.006
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    40   0.006
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    41   0.007
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    40   0.008
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    40   0.010
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    40   0.012
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    40   0.015
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    39   0.018
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    39   0.023
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    39   0.026
SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} simi...    38   0.049
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    38   0.055
AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON} S...    37   0.085
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    37   0.091
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    37   0.096
Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa] ...    37   0.13 
Suva_2.315 Chr2 complement(560767..560940,560968..561033,561037....    35   0.39 
NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.8...    35   0.47 
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    35   0.54 
TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {O...    34   0.60 
Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON...    34   0.76 
YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}  ...    34   0.78 
Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON...    34   0.79 
NCAS0D01460 Chr4 (276159..278195) [2037 bp, 678 aa] {ON} Anc_5.8...    33   1.5  
KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa] {O...    33   1.8  
NCAS0E03820 Chr5 (750631..751917) [1287 bp, 428 aa] {ON} Anc_5.8...    32   2.8  
TDEL0B00320 Chr2 complement(59154..61067) [1914 bp, 637 aa] {ON}...    32   5.2  
Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}...    31   6.3  
Ecym_3521 Chr3 (984567..986012) [1446 bp, 481 aa] {ON} similar t...    31   7.4  
TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.8...    31   8.8  

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  324 bits (831), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 172/243 (70%), Positives = 172/243 (70%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRN          
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESRL 180
           IIRVKAKELTN             M                 EQDGFDDDLQRALDESRL
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGFDDDLQRALDESRL 180

Query: 181 TAEEDERRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSQYYDIFGNP 240
           TAEEDERRRKMLGSEDDD                               PSQYYDIFGNP
Sbjct: 181 TAEEDERRRKMLGSEDDDLQAALQLSKEEEELKRLQEMQKLQQQQTQQQPSQYYDIFGNP 240

Query: 241 ISP 243
           ISP
Sbjct: 241 ISP 243

 Score =  258 bits (660), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 131/177 (74%)

Query: 325 PMATGSNNPFALNNLQLQQARPAQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXXXXXXXX 384
           PMATGSNNPFALNNLQLQQARPAQSSPVPNFTST                          
Sbjct: 325 PMATGSNNPFALNNLQLQQARPAQSSPVPNFTSTQAQSPPKPQPQAQPQKQAPLPQQPQQ 384

Query: 385 XXXXVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQ 444
               VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQ
Sbjct: 385 ALKPVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQ 444

Query: 445 VTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGNXXXXXXXXXXXXXXXXGVSLIDL 501
           VTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGN                GVSLIDL
Sbjct: 445 VTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGNQPSQQNQAQQHQTADQGVSLIDL 501

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  267 bits (682), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 155/246 (63%), Gaps = 4/246 (1%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           M  QFVRSAKN +KGY+SAQVLVR+ATANE EGPSVD LDELA ++YDSVEFFEIMDMID
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWCRENLY+IKTL EFR+          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESRL 180
           IIRVKAKELTN                                ++ +D ++QRALD SRL
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERG-EDKGAPPRMMSPSPPTPRRNSYDSEMQRALDASRL 179

Query: 181 TAEEDERRRKMLGSEDDDXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXPSQYYDIF 237
           TAEEDERRRK L +ED D                                  P  YYDIF
Sbjct: 180 TAEEDERRRKTLNNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQMQPQGYYDIF 239

Query: 238 GNPISP 243
           GNPISP
Sbjct: 240 GNPISP 245

 Score =  164 bits (416), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 88/184 (47%), Positives = 114/184 (61%), Gaps = 7/184 (3%)

Query: 325 PMATGSNNPFALNNLQLQQ-ARPAQSSPVP---NFTSTXXXXXXXXXXXXXXXXXXXXXX 380
           P++TGSNNPFALN + LQ  ++P  +S +    N+ +                       
Sbjct: 355 PVSTGSNNPFALNGMPLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQPQHNTA 414

Query: 381 XXXXXXXXVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGT 440
                   VRTG+ ++++KY +LN+LLA  TG+DTFGN GDARIPAQHTKTGTFINSQGT
Sbjct: 415 PEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGT 474

Query: 441 GYRQVTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGN---XXXXXXXXXXXXXXXXGVS 497
           G++Q + EPKKNPFL +Q+TGIP+S++VP+HTGYGFGN                   GVS
Sbjct: 475 GFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFGNQQAQNQQISQPPQQQQADQGVS 534

Query: 498 LIDL 501
           LIDL
Sbjct: 535 LIDL 538

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  246 bits (627), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 149/243 (61%), Gaps = 3/243 (1%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQFVRSAKN+VKGYSS QVLVRNAT+N++   S D L ELAEK+YDS +FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYWRHIAK+LTVLDYL+RFGSENCVLWC+ENLY+IKTL EFR+          
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESRL 180
           I+RVKAKELT              M                   D  DDDLQRA+D SR+
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNM-NIKGRSRKGRKRRGTGRNDEDDDDLQRAIDASRM 179

Query: 181 TAEEDERRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSQYYDIFGNP 240
           TAEEDERRRK    ED +                                  YYDIFGNP
Sbjct: 180 TAEEDERRRKQ--DEDYETALQLSKEEEELKRLQDLQRMQQVHAQQQQQQPMYYDIFGNP 237

Query: 241 ISP 243
           I+P
Sbjct: 238 ITP 240

 Score =  160 bits (406), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 82/89 (92%)

Query: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448
            RTG+ +MT+KYG+LN+LLATGTGIDTFGN GD+R+PAQHTKTGTFINSQGTGYRQV+ +
Sbjct: 337 TRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSND 396

Query: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGFG 477
           PK+NPFL SQYTG+PS+NIVP  TGYGFG
Sbjct: 397 PKQNPFLNSQYTGLPSTNIVPTQTGYGFG 425

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  246 bits (628), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 131/243 (53%), Positives = 151/243 (62%), Gaps = 3/243 (1%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQFVRSAKN+VKGYSS QVLVRNAT+N++   S D L ELAEK+YDS +FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYWRHIAK+LTVLDYL+RFGSENCVLWC+ENLY+IKTL EFR+          
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESRL 180
           I+RVK+KELT              M                   +  D+DLQRALD SR+
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGTGRSSNDNDNDLQRALDASRM 180

Query: 181 TAEEDERRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSQYYDIFGNP 240
           TAEEDE+RRKM   ED +                               P  YYDIFGNP
Sbjct: 181 TAEEDEKRRKM--DEDYETALQLSKEEEELKRLQDLQRMQQLQTQQQQQP-MYYDIFGNP 237

Query: 241 ISP 243
           I+P
Sbjct: 238 ITP 240

 Score =  153 bits (387), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 79/89 (88%)

Query: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448
            RTG+ +MT+KY +LN+LLATGTGIDTFGN GDAR+PAQHTKTGTFINSQGTGY+QV+ +
Sbjct: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409

Query: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGFG 477
           PK NPFL  QYTG+PS+N+VP  TGYGFG
Sbjct: 410 PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  243 bits (620), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 148/243 (60%), Gaps = 3/243 (1%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQFVRSAKN+VKGYSS QVLVRNAT+N++   S D L ELAEK+YDS +FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYWRHIAK+LTV+DYL+RFGSENCVLWCRENLY+IKTL EFR+          
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESRL 180
           I+RVKAKELT              M                   D  DDDLQRA+  SRL
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNM-NIKGRNRKGRRRRGTGRSDENDDDLQRAISASRL 179

Query: 181 TAEEDERRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSQYYDIFGNP 240
           TAEEDERRRK    ED +                                  YYDIFGNP
Sbjct: 180 TAEEDERRRKQ--DEDYETALQLSKEEEELKRLQDLQRMQQQQGQQQLQQPMYYDIFGNP 237

Query: 241 ISP 243
           I+P
Sbjct: 238 ITP 240

 Score =  150 bits (378), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 66/87 (75%), Positives = 78/87 (89%)

Query: 390 RTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGEP 449
           RTG+ +MT+KY +LN+LLATGTGIDTFGN G+ARIPAQHTKTGTFINSQGTGYRQV+ +P
Sbjct: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDP 404

Query: 450 KKNPFLQSQYTGIPSSNIVPAHTGYGF 476
             NPFL SQYTG+PS+++VP  TGYGF
Sbjct: 405 NHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  239 bits (609), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 128/243 (52%), Positives = 148/243 (60%), Gaps = 3/243 (1%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQ VRSAKN+VKGYSS QVLVRNAT+N++   S D L ELAEK+YDS +FFEIMDM+D
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYWRHIAK+LTVLDYL+RFGSENCVLWC+ENLY+IKTL EFR+          
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESRL 180
           I+RVKAKELT+             M                   +  DDDLQRA+D SR+
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRRTNRSSED-DDDLQRAIDASRM 179

Query: 181 TAEEDERRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSQYYDIFGNP 240
           TA+EDERRRK    ED +                                  Y DIFGNP
Sbjct: 180 TADEDERRRKQ--DEDYETALQLSKEEEELKRLQDLQRIQAQQQQQQQQQPMYCDIFGNP 237

Query: 241 ISP 243
           I+P
Sbjct: 238 ITP 240

 Score =  158 bits (400), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 86/113 (76%), Gaps = 2/113 (1%)

Query: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448
            RTG+ +MT+KY +LN+LL TGTGIDTFGN GD R+PAQHTKTGTFINSQGTGYRQV+ +
Sbjct: 352 TRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND 411

Query: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGFGNXXXXXXXXXXXXXXXXGVSLIDL 501
           PK NPFL SQYTG+PS+N+VPA TGYGFGN                G +LIDL
Sbjct: 412 PKHNPFLNSQYTGLPSTNVVPAQTGYGFGN--QPQQQSQTNGTNSQGYALIDL 462

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  239 bits (609), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 152/244 (62%), Gaps = 9/244 (3%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MS QFVRS KNVVKGYSS QVLVRNATANE  GP++D L ++AEKTYDS +FFEIMDM+D
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFR--NXXXXXXXX 118
           KRLNDKGKYW+HIAKSLTVLDYLVRFGSENCVLWC+ENLY+IKTL EFR  +        
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 XXIIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDES 178
             IIRVKAKELT                                 ++G D+DLQRAL+ES
Sbjct: 121 GQIIRVKAKELT----ALLMDDERLREERRLNNRRDRNRNRRPPARNGSDEDLQRALEES 176

Query: 179 RLTAEEDERRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSQYYDIFG 238
           R TAEEDER+R++  ++DD                                P  YYD+FG
Sbjct: 177 RRTAEEDERKRRL--NQDDSDLQAALQLSKEEEELKRLQELQSSMHMQQQQPV-YYDVFG 233

Query: 239 NPIS 242
           NPIS
Sbjct: 234 NPIS 237

 Score =  162 bits (410), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 103/175 (58%), Gaps = 1/175 (0%)

Query: 328 TGSNNPFALNNLQLQQARPAQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 387
           TGSNNPFALNN Q        +S +P+FT                               
Sbjct: 313 TGSNNPFALNNQQTNNNNVQAASELPDFTKPQAQSYQPAKLPEQIEIQQPVQQPVQQPLQ 372

Query: 388 XVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTG 447
             RTG+  MT KY ELN+LLA+GTGIDTFGNTG+ RIPAQHT+TGTFINSQGTGYRQ +G
Sbjct: 373 QNRTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSG 432

Query: 448 EPKKNPFLQSQYTGIPSSNIVPAHTGYGFG-NXXXXXXXXXXXXXXXXGVSLIDL 501
           E K NPFL +QYTG+PSSNI+P  TGYGFG                  GVSLIDL
Sbjct: 433 ESKVNPFLSNQYTGLPSSNIIPTQTGYGFGNQPQQQQYQQQQQQNNNQGVSLIDL 487

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  237 bits (605), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 128/253 (50%), Positives = 152/253 (60%), Gaps = 10/253 (3%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQFVRSAKN+VKGYS+ QVLVR+AT+N++  PS + L ELA++++DSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWC+ENLY+IKTL EFR+          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXX------XXXXXXXXXXXXXXEQDGFDDDLQRA 174
           IIRVKAKELT+             +                         D   D+LQRA
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDEDQDELQRA 180

Query: 175 LDESRLTAEEDERRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSQ-- 232
           L+ESRLTAEEDERRR+ +   DD                                     
Sbjct: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTALQLSKEEEELKKLQEMQRLQQQQGQMNQP 240

Query: 233 --YYDIFGNPISP 243
             Y+DIFGNPISP
Sbjct: 241 QGYFDIFGNPISP 253

 Score =  160 bits (406), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 106/179 (59%), Gaps = 16/179 (8%)

Query: 325 PMATGSNNPFALNNLQLQQARPAQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXXXXXXXX 384
           P+ TGSNNPFA+NN      +PA  S    +T++                          
Sbjct: 319 PLQTGSNNPFAMNNFN---NKPAVES-TQAYTASAPQLNQQPAQQQPQQQPLKQ------ 368

Query: 385 XXXXVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQ 444
                RTG+ ++T+KY +LN LLATGTGIDTFGNTG+ RIPAQHT+TGTFINSQGTGYRQ
Sbjct: 369 ----TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQ 424

Query: 445 VTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGNXXXXXXXXXXXXXXX--XGVSLIDL 501
           VT +PK NPFL SQYTG+PS+NIV   TGYGFGN                  G SLIDL
Sbjct: 425 VTNDPKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSQQQQQQQQQQQRPDQGFSLIDL 483

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  239 bits (609), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 131/270 (48%), Positives = 156/270 (57%), Gaps = 28/270 (10%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           M KQFVRSAKN+VKGYSS QVLVR+ATAN+S  PS+D LD+LA+++YDSV+FFEIMDM+D
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWCREN YVIKTL EFR+          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDG---------FDDDL 171
           IIRVKAKEL +             M                 ++ G         + D+L
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 172 QRALDESRLTAEEDERRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP- 230
           ++ L+ESR+TA+EDE+RR+ L   DD+                               P 
Sbjct: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQPL 240

Query: 231 SQ------------------YYDIFGNPIS 242
           SQ                  YYDIFGNPIS
Sbjct: 241 SQMPVPVQQQQQQQQQQLPAYYDIFGNPIS 270

 Score =  155 bits (393), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 69/90 (76%), Positives = 81/90 (90%)

Query: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448
            RTG+ ++++KY +LN LLATGTG+DTFGNTG+ARIPAQHTKTGTFINSQGTGY+QVT E
Sbjct: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513

Query: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
           PK NPFL +QYTG+PS+NIVP  TGYGFGN
Sbjct: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 543

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  237 bits (605), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 144/207 (69%), Gaps = 9/207 (4%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQFVRSAKN++KGYSS QVLVR+ATAN+S  PS+D LD+LA+++YDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWCREN YVIKTL EFR+          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQD---------GFDDDL 171
           IIRVKAKEL +             M                 ++           + DDL
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQDDL 180

Query: 172 QRALDESRLTAEEDERRRKMLGSEDDD 198
           ++AL+ESR+TA+EDE+RR+ L   DD+
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDE 207

 Score =  157 bits (396), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 70/90 (77%), Positives = 81/90 (90%)

Query: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448
            RTG+ ++++KY +LN LLATGTGIDTFGNTG+ARIPAQHTKTGTFINSQGTGY+QVT E
Sbjct: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487

Query: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
           PK NPFL +QYTG+PS+NIVP  TGYGFGN
Sbjct: 488 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 517

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 17/19 (89%)

Query: 325 PMATGSNNPFALNNLQLQQ 343
           P+ TGSNNPF+++NL+ Q+
Sbjct: 340 PLPTGSNNPFSMDNLERQK 358

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  236 bits (603), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 142/207 (68%), Gaps = 9/207 (4%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQFVRSAKN++KGYSS QVLVR+ATAN+S  PS+D LD+LA+++YDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWCREN YVIKTL EFR+          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXX---------XXXXXXXXXXXEQDGFDDDL 171
           IIRVKAKEL +             M                              + +DL
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQNDL 180

Query: 172 QRALDESRLTAEEDERRRKMLGSEDDD 198
           ++AL+ESR+TA+EDE+RR+ L   DD+
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDE 207

 Score =  153 bits (386), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 68/90 (75%), Positives = 79/90 (87%)

Query: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448
            RTG+ ++++KY +LN LLATGTG DTFGNTG+ARIPAQHTKTGTFINSQGTGY+QV  E
Sbjct: 429 TRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVINE 488

Query: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
           PK NPFL +QYTG+PS+NIVP  TGYGFGN
Sbjct: 489 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 518

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  236 bits (601), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 151/263 (57%), Gaps = 21/263 (7%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQFVRSAKN+VKGYSS QVLVR+ATAN+   PS+D LD+LA+++YDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWCREN YVIKTL EFR+          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDG-------------F 167
           IIRVKAKEL +             M                                  +
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 168 DDDLQRALDESRLTAEEDERRRKMLGSEDDD----XXXXXXXXXXXXXXXXXXXXXXXXX 223
            +DL++AL+ESR+TA+EDE RR  +   DDD                             
Sbjct: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAALQLSKEEEELKQLQELQKQQQL 240

Query: 224 XXXXXXPSQ----YYDIFGNPIS 242
                 P Q    YYDIFGNPIS
Sbjct: 241 QSQLQMPPQQQAAYYDIFGNPIS 263

 Score =  150 bits (378), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 79/90 (87%)

Query: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448
            RTG+ ++++KY +LN LLATGTG DTFGNTG++RIPAQHTKTGTFINSQGTGY+QV  E
Sbjct: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496

Query: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
           PK NPFL SQYTG+PS++IVP  TGYGFGN
Sbjct: 497 PKNNPFLNSQYTGLPSTSIVPTQTGYGFGN 526

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  229 bits (584), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 154/249 (61%), Gaps = 8/249 (3%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSK  +R+AKNVV GYSS QVLVRNAT+NE  GP+VD+LDELAEKTYD+VEFFEIMDM+D
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGK WRH+AKSLTVLDYLVR+GSENCVLW +ENLY+IKTL EF +          
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESRL 180
           IIRVKAKELT+             M                 E+  +DDDLQRAL+ESRL
Sbjct: 121 IIRVKAKELTSLLRDEERLTEERNMRKKRRGKTRRPERSRGGEE--YDDDLQRALEESRL 178

Query: 181 TAEEDERRRKM-LGSEDDDXXXXXXXXXXXXXX-----XXXXXXXXXXXXXXXXXPSQYY 234
           TAEE+ERRR+   GS DDD                                       YY
Sbjct: 179 TAEEEERRRRTDSGSNDDDDFQTALQLSKEEEELRRLRNLQMQQQQTAMFQQQQQQPMYY 238

Query: 235 DIFGNPISP 243
           D+FGNPI+P
Sbjct: 239 DVFGNPITP 247

 Score =  141 bits (356), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 95/152 (62%), Gaps = 15/152 (9%)

Query: 328 TGSNNPFALNNLQLQQARPAQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 387
           TGSNNPFAL      +  P +    P  + +                             
Sbjct: 327 TGSNNPFALG-----RQEPDEEQITPKVSESVATTAGTTTATTTTQQQALNP-------- 373

Query: 388 XVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTG 447
             RTG+ ++++KY +LN LLA+GTG+DTFGNTG  RIPAQHT+TG FINSQGTGY+QVT 
Sbjct: 374 -TRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTN 432

Query: 448 -EPKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
            +PK NPFL +QYTG+PS+++VP++TGYGFGN
Sbjct: 433 DQPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  227 bits (578), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 126/256 (49%), Positives = 149/256 (58%), Gaps = 14/256 (5%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQFVRSAKNV+KGYSS QVLVR+AT+N++   ++D LD++A ++YDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYW+HI KSLTVLDYLVRFGSENCVLWC+ENLYVIKTL EFR           
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IIRVKAKELTN---XXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGF---DDDLQRA 174
           IIRVKAKELT+                                   Q      DDDLQR 
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDDDDLQRV 180

Query: 175 LDESRLTAEEDERRRKMLGSEDDD--------XXXXXXXXXXXXXXXXXXXXXXXXXXXX 226
           ++ES+ TAEEDERRRK L   D++                                    
Sbjct: 181 IEESKKTAEEDERRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQLQMLQQQ 240

Query: 227 XXXPSQYYDIFGNPIS 242
               + YYD+FGNPIS
Sbjct: 241 QTSANVYYDVFGNPIS 256

 Score =  152 bits (385), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 82/155 (52%), Positives = 94/155 (60%), Gaps = 5/155 (3%)

Query: 325 PMATGSNNPFALNNLQLQQARPAQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXXXXXXXX 384
           PM TGSNNPF+++NL     +   + P                                 
Sbjct: 328 PMVTGSNNPFSMDNL----GKVNNAPPPQPVPQPQLAVQSPPQQIPQVAMPPLPQQQEQQ 383

Query: 385 XXXXVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQ 444
                RTG+  +TEKY ELN LLA GTG+DTFGNTG  RIPAQHTKTGTFINSQGTGY+Q
Sbjct: 384 PLKQNRTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQ 443

Query: 445 VTGE-PKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
           VT E  K NPFL +QYTG+PSSNIVP+ TGYGFGN
Sbjct: 444 VTNERSKNNPFLNTQYTGLPSSNIVPSSTGYGFGN 478

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  220 bits (561), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 149/249 (59%), Gaps = 10/249 (4%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSK F+RSAKN+V GYS AQVLVR+AT+N+ +GPSVD+L+ELAE+T+D+VEFFEIMDM+D
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXX- 119
           KRLNDKG+ WRH+AKSLT LD+LVR GSENCV WC+ENLY+IKTL EF +          
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 XIIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESR 179
            I+RVKAKELT              M                 E    DDDLQRAL+ESR
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKNRRDDNED---DDDLQRALEESR 177

Query: 180 LTAEEDERRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPS------QY 233
           +TAEE+ERRRK L  + DD                                        Y
Sbjct: 178 ITAEEEERRRKQLMMQGDDSSLQAALELSKEEEELRRLQQLQAQQQAALWQQQQQQQPMY 237

Query: 234 YDIFGNPIS 242
           YDIFGNPIS
Sbjct: 238 YDIFGNPIS 246

 Score =  150 bits (378), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/152 (52%), Positives = 94/152 (61%), Gaps = 12/152 (7%)

Query: 328 TGSNNPFALNNLQLQQARPAQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 387
           TGSNNPFALN       RP    P P                                  
Sbjct: 309 TGSNNPFALN-------RP----PSPQEIEEIEEPDFTPVQLPPSPSPAAVPQQEFKPVP 357

Query: 388 XVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTG 447
             RTG+ ++++K+ ELN LLA+GTGIDTFGNTG+ R+PAQHTKTGTFINSQGTGY+Q+T 
Sbjct: 358 KQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITN 417

Query: 448 E-PKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
           + PK NPFL SQYTGIPSS I P++TGYGFGN
Sbjct: 418 DAPKHNPFLTSQYTGIPSSAIAPSYTGYGFGN 449

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  220 bits (560), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 150/245 (61%), Gaps = 7/245 (2%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           M KQFVRSAKNVVKGYSS QV+VRNAT+N+S GP +D LD LAEKTYDSVEFFEIMDM+D
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYW+HIAKSLTVLDYLVRFGSENCVLWC+ENLY+I+TL EF            
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESRL 180
           IIRVKAKELT+             M                 +    DD+LQRA++ES+ 
Sbjct: 121 IIRVKAKELTSLLNDEERLRDERGMNRRGGRRERARPRRRPSD----DDELQRAIEESKR 176

Query: 181 TAEEDERRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPS---QYYDIF 237
           TAE+D+RRR+M   E+ D                                     YYDIF
Sbjct: 177 TAEDDDRRRRMRDDEEADLQTALQLSKEEEELKRLQELQRLQQQQQQQQQQQQPMYYDIF 236

Query: 238 GNPIS 242
           GNPIS
Sbjct: 237 GNPIS 241

 Score =  174 bits (441), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 89/154 (57%), Positives = 104/154 (67%), Gaps = 3/154 (1%)

Query: 328 TGSNNPFALNN--LQLQQARPAQSSPVPNFTSTXXXXXX-XXXXXXXXXXXXXXXXXXXX 384
           TGSNNPFA+NN  LQL        S +P+F +                            
Sbjct: 319 TGSNNPFAMNNQALQLNNQNDKAHSELPDFNAKPVSAYQPAELPPQQQISLPPQPQQPQQ 378

Query: 385 XXXXVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQ 444
                RTG+  +T+K+GELN+LLA+GTGIDTFGNTG+ARIPAQHTKTGTFINSQGTGYRQ
Sbjct: 379 PLKQTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQ 438

Query: 445 VTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
           VT +PK NPFL SQYTG+PS+NIVP+HTGYGFGN
Sbjct: 439 VTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  216 bits (551), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 152/254 (59%), Gaps = 11/254 (4%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           M  Q VRSAKN+VKGYSS QV+VR+ATAN+S  PSV  L++LA+KTYD+VEFFEIMDM+D
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXX-XXXX 119
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWC+ENLY+IKTL EFR+          
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 XIIRVKAKELTNXXXXXXXXXXXXXMXXX------XXXXXXXXXXXXXXEQDGFDDDLQR 173
            IIRVKAKELT+             +                        ++ +DDDLQ+
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQK 180

Query: 174 ALDESRLTAEEDERRRKML----GSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 229
           AL+ESR+TAEE+E RR+        + D                                
Sbjct: 181 ALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKEEEELKKLQDMQRMQELQAQQQQ 240

Query: 230 PSQYYDIFGNPISP 243
            + YYDIFGNPISP
Sbjct: 241 QNVYYDIFGNPISP 254

 Score =  160 bits (406), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 82/152 (53%), Positives = 101/152 (66%), Gaps = 11/152 (7%)

Query: 326 MATGSNNPFALNNLQLQQARPAQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXXXXXXXXX 385
           +ATGSNNPF+ +N+       A ++ +P+                               
Sbjct: 309 LATGSNNPFSRDNISNNNNTSANNALLPDLQPKPAPSPQPQQQQPQQQPLQK-------- 360

Query: 386 XXXVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQV 445
               RTG+ ++++KY ELN LLA+GTGIDTFGNTG+ARIPAQHTKTGTFINSQGTGY+QV
Sbjct: 361 ---TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQV 417

Query: 446 TGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFG 477
           T EPK NPFL SQYTG+PS+NIVP+HTGYGFG
Sbjct: 418 TNEPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  209 bits (531), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 113/252 (44%), Positives = 142/252 (56%), Gaps = 24/252 (9%)

Query: 5   FVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLN 64
            +RSAKN+VKGYS  +VLVR+ATAN S  PS + LD+LA+K+Y+SVEFFEI+DM+DKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXXIIRV 124
           DKGKYWRH+AK+LTVLDYLVRFGSENCV+WC+ENLY+IKTL EF +          IIRV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESRLTA-- 182
           KAKELT+             M                   +  D+DLQRA++ES+ TA  
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRSDEDLQRAIEESKRTAEE 180

Query: 183 -----------EEDERRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPS 231
                      E D +    L  E++D                                 
Sbjct: 181 EERRRRNGASSEADRQAALQLSREEEDLRRLQEQARLAQQQQQQQQQQ-----------P 229

Query: 232 QYYDIFGNPISP 243
            YYD+FGNPI+P
Sbjct: 230 MYYDVFGNPITP 241

 Score =  151 bits (381), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 78/153 (50%), Positives = 94/153 (61%), Gaps = 20/153 (13%)

Query: 326 MATGSNNPFALNNLQLQQARPAQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXXXXXXXXX 385
           + TGSNNPFALNN     A  + ++  P    T                           
Sbjct: 295 LPTGSNNPFALNNATQPSAPASTTAARPAAIETPATQTKPLTQ----------------- 337

Query: 386 XXXVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQV 445
               R+G+ A+++KY  LN LLA+GTGIDTFGNTG+ RIPAQHT+TGTFINSQGTGYRQV
Sbjct: 338 ---TRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQV 394

Query: 446 TGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
             + K NPFL  QYTG+PS+NIVP  TG+GFGN
Sbjct: 395 NNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGN 427

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  207 bits (528), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 104/193 (53%), Positives = 132/193 (68%), Gaps = 8/193 (4%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSK  +R AKNVV GYS+ QVL+R AT+N+ +GPS+D +DE+AE+++DSV FFEIMDM+D
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGK WRH+AKSLTVLDYLVR GSE+CV W +ENLY+IKTL EF +          
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESRL 180
           I+RVKA+ELT              +                   D +DDD+QRAL+ESR+
Sbjct: 121 IVRVKARELT------ALLQDEERLREERELKGRNRRPRRRKNSDSYDDDMQRALEESRM 174

Query: 181 TAEED--ERRRKM 191
           TAE++  ERRRK+
Sbjct: 175 TAEQEEAERRRKL 187

 Score =  149 bits (376), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 104/180 (57%), Gaps = 5/180 (2%)

Query: 325 PMATGSNNPFALNNLQLQQARPAQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXXXXXXXX 384
           P+ TGSNNPFA N  Q     P++ +   +   T                          
Sbjct: 325 PLETGSNNPFAKNAQQPSAEDPSKYAAASSPQRTQQLSPQLQPQPEQFQQQQQQIPQQPL 384

Query: 385 XXXXVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQ 444
                RTG+ ++T+K+ +LN LLA+GTG+DTFGNTG  RIPAQHTKTGTFINSQGTGY+Q
Sbjct: 385 KQ--TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQ 442

Query: 445 VTGEP--KKNPFLQSQYTGIPSSNIVPAHTGYGFGNXXXXXXXXXXXXX-XXXGVSLIDL 501
           V+  P  K NPFL  QYTG+PS+++VP++TGYGFGN                 GVSLIDL
Sbjct: 443 VSNMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  204 bits (520), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 106/193 (54%), Positives = 129/193 (66%), Gaps = 8/193 (4%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSK  +R AKNVV GYS+ QVL+R AT+N+ EGPS+D +DE+AE+++DSV FFEIMDM+D
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGK WRH+AKSLTVLDYLVR GSE+CV W +ENLYVIKTL EF +          
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESRL 180
           I+RVKA+ELT              +                      D+DLQRA++ESRL
Sbjct: 121 IVRVKARELTALLLDDERLREERSLRTKNRKPRRRPTAGSE------DEDLQRAMEESRL 174

Query: 181 TA--EEDERRRKM 191
           TA  EE ERRRK+
Sbjct: 175 TAEQEEAERRRKL 187

 Score =  153 bits (386), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 86/184 (46%), Positives = 105/184 (57%), Gaps = 7/184 (3%)

Query: 325 PMATGSNNPFALNNLQ------LQQARPAQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXX 378
           P+ TGSNNPFA ++ Q       + A  A S P  N   +                    
Sbjct: 325 PLETGSNNPFARHSNQNANEDASKYANVAPSPPQDNQLLSQQQQLQQEQQQQQQQQQQPQ 384

Query: 379 XXXXXXXXXXVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQ 438
                      RTG+ ++TEK+ ELN LLA+GTG+DTFGNTG  RIPAQHTKTG FINSQ
Sbjct: 385 PQPQPQPLKQTRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQ 444

Query: 439 GTGYRQVTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGNXXXXXXXXXXXXX-XXXGVS 497
           GTGY+QV+  PK NPFL  QYTG+PS+N+VP++TGYGFGN                 G+S
Sbjct: 445 GTGYKQVSSTPKHNPFLGQQYTGLPSTNVVPSYTGYGFGNQPNQNQQNQNQSNGADQGMS 504

Query: 498 LIDL 501
           LIDL
Sbjct: 505 LIDL 508

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  204 bits (518), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 151/263 (57%), Gaps = 21/263 (7%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQFVRSAKN++KGYS+ QVLVR+AT+N+S  PS + L E++++++DSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           KRLNDKGKYW+HIAKSLTVLDYLVRFGSENCVLWC++NLY+IKTL EF+           
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFK-LEDDNVDESS 119

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXX-----XXXEQDGFDDDLQRAL 175
           IIRVKAKELT              +                           D+DLQ+AL
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKSDEDLQKAL 179

Query: 176 DESRLTAEEDERRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSQ--- 232
           +ESR+TAEEDERRR+ L   D+                                  Q   
Sbjct: 180 EESRITAEEDERRRRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQLQQQQQQQM 239

Query: 233 ------------YYDIFGNPISP 243
                       YYDIFGNPISP
Sbjct: 240 QFQQQPQQQEQVYYDIFGNPISP 262

 Score =  153 bits (387), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/151 (55%), Positives = 100/151 (66%), Gaps = 19/151 (12%)

Query: 328 TGSNNPFALN-NLQLQQARPAQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 386
           TGSNNPFALN  +     RPA+  P P FT+                             
Sbjct: 323 TGSNNPFALNATINTSPIRPAEQQPQPQFTAPQQQQQPLQQPLKQ--------------- 367

Query: 387 XXVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVT 446
              RTG+ ++++KY ELN LLA+GTGIDTFGNTGD RIPAQHT+TGTFINSQGTGY+Q+ 
Sbjct: 368 --TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIV 425

Query: 447 GEP-KKNPFLQSQYTGIPSSNIVPAHTGYGF 476
            +P KKNPFL +QYTG+PSSNIVP+HTGYGF
Sbjct: 426 NDPVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  203 bits (517), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 126/196 (64%), Gaps = 17/196 (8%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQF+RS KN+VKGYSS Q+LVR+ATAN+   PS+D LD++AEKTYDSV+FFEIMDM+D
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXX-- 118
           KRLNDKGKYW+H+AKSLTVLDYL+RFGSENCV WC+ENLY+IKTL EFR           
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 119 --XXIIRVKAKELTNXXXXXXXXXXXXXMXXX-------------XXXXXXXXXXXXXXE 163
               I+RV+A ELT+             +                               
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 164 QDGFDDDLQRALDESR 179
            D +DDDLQ+A++ES+
Sbjct: 181 DDHYDDDLQKAIEESK 196

 Score =  162 bits (410), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 104/159 (65%), Gaps = 5/159 (3%)

Query: 325 PMATGSNNPFALNNLQ-LQQARP----AQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXXX 379
           PM TG+NNPF+L+N+   QQ +P    + S+ +P+ +S                      
Sbjct: 401 PMVTGTNNPFSLSNINNPQQQQPPLMSSSSTTLPDLSSFKQSTSVPPATQSSYTTKTNAS 460

Query: 380 XXXXXXXXXVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQG 439
                    +RTG+  +++KY  LN LLATGTGIDTFGNTGD RIPAQHT TGTFINSQG
Sbjct: 461 SLPPQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQG 520

Query: 440 TGYRQVTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
           TGY+Q   +PK NPF+ +QYTG+PS+N+VP++TGYGFGN
Sbjct: 521 TGYKQYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGN 559

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  199 bits (505), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 130/198 (65%), Gaps = 3/198 (1%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQ +RSAKNV+ GYS AQVLVRNAT+N+  GPS+D+++ELAE+TY +VEFFEIM M+D
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXX-XXXX 119
           +RLNDK K WRH+AKSLTV DYLVR G+E CV W REN+++I+ L EF +          
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 XIIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESR 179
            +IRVKAKEL               +                   DG D DL+RAL+ESR
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNP--DGVDPDLKRALEESR 178

Query: 180 LTAEEDERRRKMLGSEDD 197
           +TAEE+ERRRK+    +D
Sbjct: 179 ITAEEEERRRKLAEKTED 196

 Score =  150 bits (378), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 87/114 (76%), Gaps = 3/114 (2%)

Query: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448
            RTG+ ++++KYGELN LLATGTGIDTFGNTG ARI +QHTKT TFINS GTG++QV+ E
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 449 -PKKNPFLQSQYTGIPSSNIVPAHTGYGFGNXXXXXXXXXXXXXXXXGVSLIDL 501
            PK NPFL +QYTG+PS+NIVP+HTGYGFGN                G+SLIDL
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGN--ASSFQQTASKPNDQGMSLIDL 514

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  182 bits (463), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 101/126 (80%)

Query: 5   FVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLN 64
            +RSAKN+VKGYSS Q LVR+AT+N  + P +D+L ELAE TY+++EFFEIMDM+DKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXXIIRV 124
            KGKYW+H+ KSL VLDYLVRFGSENCV+WC+ENLY+IKTL EF            ++RV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KAKELT 130
           +AKELT
Sbjct: 121 RAKELT 126

 Score =  159 bits (403), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 98/154 (63%), Gaps = 25/154 (16%)

Query: 325 PMATGSNNPFALNNLQLQQARPAQSSPVPNFTSTXXXXXXXXXXXXXXXXXXXXXXXXXX 384
           P+ATGSNNPFALNN +LQQ      +P P+   T                          
Sbjct: 275 PLATGSNNPFALNNKKLQQ-----HTPEPSVIDTTLNTQAPLKQ---------------- 313

Query: 385 XXXXVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQ 444
                RTG  ++++KY  LN LLATGTGIDTFGNTG+ RIPAQHTKTGTFINSQGTGY+Q
Sbjct: 314 ----TRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQ 369

Query: 445 VTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
           V+     N FL SQYTG+PSSNIVP+ TGYGFGN
Sbjct: 370 VSTNGFNNVFLNSQYTGLPSSNIVPSQTGYGFGN 403

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  184 bits (466), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 95/183 (51%), Positives = 118/183 (64%), Gaps = 3/183 (1%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MSKQ +RSAKNVV GYS AQ+LVRNAT+NE  GPS+D+++ELAE++Y +VEFFEI+ M+D
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNX-XXXXXXXX 119
           KRL+DK K+WRH+AKSLTV D+LVR G+E CV W RENLY+ + L EF +          
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 XIIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGFDDDLQRALDESR 179
            IIRVKA+EL               M                 E    D DLQRAL+ESR
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRLGRNPRNRQASVPPPAED--LDPDLQRALEESR 178

Query: 180 LTA 182
           +TA
Sbjct: 179 ITA 181

 Score =  148 bits (374), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 67/91 (73%), Positives = 80/91 (87%), Gaps = 1/91 (1%)

Query: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448
            RTG+ ++T+KY ELN LLA+GTG+DTFGNTG  RIPAQHTKTGTFINSQGTGY+QV  E
Sbjct: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460

Query: 449 -PKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
            PK NPF+ +QYTG+PS+N+VP+HTGYGFGN
Sbjct: 461 PPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  170 bits (430), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 102/131 (77%), Gaps = 1/131 (0%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MS+QFVRSAKNV+KGYSS QVLVR+ATAN+   P +D L+++A  ++DSV+FFEIMD+++
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXX-XXX 119
           KRLND GKYWRHI KSLTVLDYLVRFGSE+C  W R++L+++K L  FR           
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 XIIRVKAKELT 130
            I+RVKA++L 
Sbjct: 121 QIVRVKARDLV 131

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 64/93 (68%), Positives = 74/93 (79%), Gaps = 3/93 (3%)

Query: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448
           + TG+  +T KY ELN LLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG++QV  E
Sbjct: 494 MNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSE 553

Query: 449 ---PKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478
              P  NPFL SQYTG+PS+ IVPA+TGYGFGN
Sbjct: 554 GKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGN 586

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 24/31 (77%)

Query: 168 DDDLQRALDESRLTAEEDERRRKMLGSEDDD 198
           DDDLQRA++ES+ T +EDE RR+ L   D++
Sbjct: 205 DDDLQRAIEESKRTVQEDEERRRQLSMYDEE 235

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%)

Query: 325 PMATGSNNPFALNNLQLQQARPAQS 349
           PM TGSNNPFA+N   +QQ    QS
Sbjct: 392 PMTTGSNNPFAVNAAPIQQPNYTQS 416

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  163 bits (412), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 99/249 (39%), Positives = 126/249 (50%), Gaps = 15/249 (6%)

Query: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60
           MS QFVRS KN+ KGYS  QVLVR+ATAN   G S+D LD+L E +YD+ EF +I  ++D
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           +R++DK KYWRH+AKSLTV+DYLVRFGSE CV W R+N   ++ L +F            
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IIRVKAKELTNXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXEQDGF------DDDLQRA 174
           +IRVKA EL +             M                  +         ++D+ RA
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180

Query: 175 LDESRLTAEEDE-RRRKMLGSEDDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSQY 233
           L+ES+ TAEEDE RRRK    E  D                                 QY
Sbjct: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQDEANNK--------PQY 232

Query: 234 YDIFGNPIS 242
           +D  GNPIS
Sbjct: 233 FDENGNPIS 241

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 59/80 (73%)

Query: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448
           + TG+  ++ KY  LN+LLA GTGIDTFGN G  RIPAQHTKTGTFINSQGTGY+QVT  
Sbjct: 594 MHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSS 653

Query: 449 PKKNPFLQSQYTGIPSSNIV 468
               P L +QYTG+P+   V
Sbjct: 654 SSPIPLLPTQYTGLPAQTAV 673

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   ++++A+ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K    WR I K+L +LDYL+R G+E  +   R NL +IK L  F            
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +A EL
Sbjct: 135 NVRNRAHEL 143

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 71/129 (55%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+N+V  Y+  +  VR AT NE  G S   ++++++ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K    WR I K+L +LDYL+R G+E  +   R NL +IK L  F            
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +A EL
Sbjct: 135 NVRNRAHEL 143

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 73/129 (56%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   ++++A+ TY+  E +EI+ MI +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K G  WR I K+L +LDYL++ GSE  +   R +L +I+ L  F            
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +AK L
Sbjct: 135 NVRNRAKLL 143

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 71/129 (55%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   +D++++ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K G  WR I K+L +LDYL++ GSE  +   R ++ +IK L  F            
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R + K L
Sbjct: 135 NVRTRVKAL 143

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 71/129 (55%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   +++++  TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K    WR I K+L +L+YL++ GSE  +   R NL +IK L  F            
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +A+EL
Sbjct: 135 NVRNRAQEL 143

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 66/109 (60%), Gaps = 1/109 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   ++++A+ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFR 109
           R  +K G  WR I K+L +LDYL++ GSE  +   R ++ V+K L  F 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFH 123

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 72/130 (55%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   ++++A+ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K G  WR I K+L +L+YL+  G+E  +   R +L +I+ L  F            
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 121 IIRVKAKELT 130
            +R +A+ +T
Sbjct: 135 NVRSRAQAMT 144

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 71/129 (55%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   +D++++ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K G  WR I K+L +LDYL++ GSE  +   R ++ +IK L  F            
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R + K L
Sbjct: 135 NVRTRVKTL 143

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 70/129 (54%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   ++ +A+ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K    WR I K+L +L+YLV+ GSE  +   R NL ++K L  F            
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +A +L
Sbjct: 135 NVRNRASQL 143

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 71/129 (55%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   +D++++ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K G  WR I K+L +LDYL++ GSE  +   R ++ +I+ L  F            
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R + K L
Sbjct: 135 NVRTRVKAL 143

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 71/129 (55%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   ++++++ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           RL +K    WR I K+L +LDYL+R  SE  +   R ++ +IK L  F            
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +AK L
Sbjct: 135 NVRNRAKAL 143

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 72/129 (55%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  ++  +  VR AT NE  G S   ++++A+ TY+  E  E+M M+ +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K G  WR I K+L +LDYL+R GSE  +   R  L +++ L  F            
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 121 IIRVKAKEL 129
            +R +AK++
Sbjct: 135 NVRNRAKQI 143

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 78.2 bits (191), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 72/129 (55%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   ++++A+ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K G  WR I KSL +LDYL+R GSE  +   R ++ +I+ L  F            
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R +AK L
Sbjct: 135 NVRNRAKAL 143

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 71/129 (55%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   +D++++ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K G  WR I K+L +LDYL++ GSE  +   R ++ +I+ L  F            
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R + K L
Sbjct: 135 NVRTRVKAL 143

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 66/109 (60%), Gaps = 1/109 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   ++++A+ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFR 109
           R  +K G  WR I K+L +L+YL++ GSE  +   R ++ ++K L  F 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFH 123

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 72/130 (55%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NV+  Y+  +  VR AT NE  G S   ++++++ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K    WR I K+L +L+YL++ GSE  +   R +L +IK L  F            
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELT 130
            +R KA+ LT
Sbjct: 135 NVRNKAQSLT 144

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 71/130 (54%), Gaps = 1/130 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NE  G S   ++ +A+ TY+  E  EI+ MI +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K    WR I K+L +L+YL++ GSE  +   R ++ ++K L  F            
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 IIRVKAKELT 130
            +R +AK LT
Sbjct: 170 NVRTRAKALT 179

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 64/108 (59%), Gaps = 1/108 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NV+  Y+  +  VR AT NE  G S   + ++A+ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
           R  +K    WR I KS+ +L+YLV+ GSE  +   R NL +I+ L  F
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETF 122

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 69/129 (53%), Gaps = 1/129 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NV+  Y+  +  VR AT NE  G S   + ++A+ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNXXXXXXXXXX 120
           R  +K    WR I KSL + DYL++ GSE  +   R ++ +IK L  F            
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKEL 129
            +R KA+ L
Sbjct: 135 NVRNKAQSL 143

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 1/109 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K++ R A+NVV  Y+  +  VR AT NES G     + ++A+ TY+  E  EI+ MI +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFR 109
           R  +K    WR I KS+ +L+YL+  GSE  +   R  L +IK L  F 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFH 123

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 61/110 (55%), Gaps = 8/110 (7%)

Query: 5   FVRSAKNVVKGYSSAQVLVRNATAN-ESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRL 63
            +++ +N+  G SS +V  RNAT + E  G +   ++EL+  TY      EI  +I KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  N-----DKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
           +        K   H+ K+LT++ YL+  GS+  V+W R  LY+I TL EF
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEF 110

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 64/112 (57%), Gaps = 12/112 (10%)

Query: 5   FVRSAKNVVKGYSSAQVLVRNATAN-ESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRL 63
           F+RS +N+  G S+ +V V+ AT + E  G +   ++E++  TY +    EI  +I +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWR-------HIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
           +  G Y +       HI K+LT++ YL+  GS + V W R+  Y++ TL EF
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREF 110

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 60/108 (55%), Gaps = 1/108 (0%)

Query: 2   SKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDK 61
           +K+F R A+N +   +  +  VR AT N+  G SV  + ++   T++  +  +I++M+  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
           R  +K G  WR I KS+ +L YL+  GS   V   + NL +IK LM F
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLF 122

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 54/98 (55%), Gaps = 6/98 (6%)

Query: 17  SSAQVLVRNAT-ANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDKG-----KYW 70
           S+ ++ V+ AT  NES G +   ++E++  TY      EI+ ++ KRL   G     K  
Sbjct: 13  STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGHGRRNSHKIC 72

Query: 71  RHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
            H+ K+LT++ YL+  GS + + W R N+ ++  L EF
Sbjct: 73  IHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEF 110

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (55%), Gaps = 8/102 (7%)

Query: 15  GYSSAQVLVRNAT-ANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDKGKYWR-- 71
           G S+ Q+ V+ AT +NES G +   ++EL+  TY      EI ++I KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
                 + K+LT+++YL+  GSE  VLW R +L  I+ L ++
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDY 112

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 6/100 (6%)

Query: 15  GYSSAQVLVRNATAN-ESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRL---NDKGKYW 70
           G S  ++  +NAT + E  G +   ++E++  TY S    EI  ++ KRL   N K  + 
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 71  R--HIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
              HI K+LT+  YL+  GS   V W R  +Y+I +L EF
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEF 110

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 60/112 (53%), Gaps = 12/112 (10%)

Query: 5   FVRSAKNVVKGYSSAQVLVRNATAN-ESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRL 63
           F+ S +++  G SS  V V+ AT + E  G     ++E+A  TY      EI  ++ KRL
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  NDKGKYWR-------HIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
              G Y +       ++ K+LT++ +LV  GSE C+ W R +L +I++  +F
Sbjct: 61  --VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDF 110

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 8/107 (7%)

Query: 8   SAKNVVKGYSSAQVLVRNATA-NESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDK 66
           S +N V+  + A+V  + AT  NE+ G +   ++E++  TY      EI+ ++ KRL   
Sbjct: 6   SVRNFVQSATEAKV--KEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKY-----WRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
            K        HI K++T++ YL+  GS + + W R N+ + + L +F
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDF 110

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (52%), Gaps = 6/99 (6%)

Query: 13  VKGYSSAQVLVRNAT-ANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDKGKYWR 71
           V G SS ++ VR AT  +E  G +   ++E++  TY      EI  ++ +RL+  G+   
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 72  H-----IAKSLTVLDYLVRFGSENCVLWCRENLYVIKTL 105
           H     I K+LT++ YL+  GSE  V W R NL   + L
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECL 107

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 8/107 (7%)

Query: 8   SAKNVVKGYSSAQVLVRNATAN-ESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLN-- 64
           S +N V+  + ++V  R AT + E+ G +   ++E++  TY      EI+ ++ KRL   
Sbjct: 6   SVRNFVQSPTESKV--RQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 65  ---DKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
              +  K   HI K+LT++ YL+  GS + + W R N+ + + L  F
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNF 110

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 8/109 (7%)

Query: 8   SAKNVVKGY--SSAQVLVRNATA-NESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLN 64
           S  +  KG+  S  ++ VR AT  NE  G +   ++E++  TY      +++ +I KRL+
Sbjct: 2   SLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS 61

Query: 65  -----DKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
                +  +   H+ K+LT++ YL+  GS + + W + + YVI+ L  F
Sbjct: 62  GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF 110

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 8/107 (7%)

Query: 8   SAKNVVKGYSSAQVLVRNATA-NESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDK 66
           S +N V+  S  ++ VR AT  NE+ G +   ++E++  TY +    EI+ ++ KRL   
Sbjct: 6   SVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRLTGY 63

Query: 67  GKYWRH-----IAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
           GK   H     I K+LT++ YL+  GS   + W  EN  + + +  F
Sbjct: 64  GKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNF 110

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
          YAP1801Protein involved in clathrin cage assembly;
          binds Pan1p and clathrin; homologous to Yap1802p,
          member of the AP180 protein family
          Length = 637

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 3/79 (3%)

Query: 22 LVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDKGKYWRHIAKSLTVLD 81
          LV+ AT  +S  P    LD +   T +  +F+EI+  +D R+ND    W  + KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRFGSENCVL-WCRENL 99
           ++R GS++  L +   NL
Sbjct: 65 LMIREGSKDVALRYYSRNL 83

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 6/100 (6%)

Query: 15  GYSSAQVLVRNATA-NESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDKG-----K 68
           G S     VR AT  NE  G S   + E+   TY      ++  ++ KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
              HI K+LT+ +YL+  GSE+ V W +    +++ L +F
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDF 110

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
          similar to uniprot|P53309 Saccharomyces cerevisiae
          YGR241C YAP1802 Yeast Assembly Polypeptide, member of
          AP180 protein family, binds Pan1p and clathrin; member
          of clathrin assembly polypeptide AP180 family and
          weakly similar to uniprot|P38856 Saccharomyces
          cerevisiae YHR161C YAP1801 Yeast Assembly Polypeptide
          member of AP180 protein family binds Pan1p and clathrin
          clathrin assembly protein
          Length = 669

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 22 LVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDKGKYWRHIAKSLTVLD 81
          LV+ AT  +   P    +D +   T DS EF EIM  ++ R+ND    W  + KSL V+ 
Sbjct: 7  LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82 YLVRFGSENCVL 93
           ++R G  +  +
Sbjct: 65 LMMRDGDRDVTI 76

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%), Gaps = 11/107 (10%)

Query: 8   SAKNVVKGYSSAQVLVRNATA-NESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND- 65
           + KN V+  + ++V  + AT  NE+ G +   ++E++  TY      +I+ +I KRL+  
Sbjct: 6   TVKNFVQTPTESKV--KQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSA 63

Query: 66  --KGKYWRH-----IAKSLTVLDYLVRFGSENCVLWCRENLYVIKTL 105
               K   H     I K+LT++ YL+  GS   + W R N Y+++ +
Sbjct: 64  TSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENI 110

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 45/98 (45%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+N++  Y   Q+ +R AT  +S GP+   LD++     + V   +I+D I KRL D
Sbjct: 20  ARYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKRLMD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYLV 84
                               G  WR + KSL VL +L+
Sbjct: 79  HINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLL 116

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 52/102 (50%), Gaps = 8/102 (7%)

Query: 13  VKGY--SSAQVLVRNAT-ANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDKGKY 69
           VK +  S  +  V+ AT  +E+ G +   ++E++  TY      EI+ ++ KRL+   + 
Sbjct: 7   VKSFVQSPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRK 66

Query: 70  WRH-----IAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLM 106
             H     I K+LT++ YL+  GS   V W R N  +I  L+
Sbjct: 67  TSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLI 108

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
          YHR161C (REAL)
          Length = 621

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 22 LVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDKGKYWRHIAKSLTVLD 81
          LV+ AT  +S  P    LD +   T    +F+EI+  +D R+ND    W  + K+L V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82 YLVRFGSENCVL-WCRENL 99
           ++R G ++  L +   NL
Sbjct: 65 LMMREGKKDVALRYYSRNL 83

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 49/113 (43%), Gaps = 24/113 (21%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+NV+  Y   QV +R AT  ++ GP+   L ++    Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYLVRFGSE----NCVLWC 95
                               G  WR + K L V+D+L+   SE    N VL C
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSC 131

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
          YHR161C (REAL)
          Length = 627

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 22 LVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDKGKYWRHIAKSLTVLD 81
          LV+ AT  +S  P    LD +   T    +F+EI+  ++ R+ND    W  + KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRFGSENCVL 93
           ++R G+++  L
Sbjct: 65 LMIREGAKDVAL 76

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 43/98 (43%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+NV+  Y   QV VR AT  +S GP+   L ++    Y  V  + I + I KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYLV 84
                               G  WR + K L V++YL+
Sbjct: 79  HIAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 51/94 (54%), Gaps = 7/94 (7%)

Query: 23  VRNATA-NESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRL------NDKGKYWRHIAK 75
           V+ AT+ +E+ G +   ++E++  TY      EI+ ++ KRL       +  +    + K
Sbjct: 19  VKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRSCIQVMK 78

Query: 76  SLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFR 109
           +LT++ YL+  GS   + W + N+ +I+ L +F+
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQ 112

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDK 66
           R A+NV+  Y   Q+ VR AT  ++ GP+   L+++    +  V  + + + I KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKYWRHIAKSLTVLDYLV 84
                              G  WR + K LTV++YL+
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 56/131 (42%), Gaps = 30/131 (22%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+NV+  Y   QV +R AT  +S GP+   L ++    Y  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYL---VRFGSE-----NCVLWCREN 98
                               G  WR + K L VL+YL   V  GSE     +C+L  +  
Sbjct: 79  HIASRPKNFYEKARKQYVNYGSEWRVVLKCLVVLEYLLLNVDNGSELDQVTSCLLTHKHI 138

Query: 99  LYVIKTLMEFR 109
           L   + +M+FR
Sbjct: 139 L--TRDVMQFR 147

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 50/94 (53%), Gaps = 7/94 (7%)

Query: 23  VRNAT-ANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRL------NDKGKYWRHIAK 75
           V+ AT  +E+ G +   ++E++  TY      EI+ +I KRL       +  +    + K
Sbjct: 19  VKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRNCIQVMK 78

Query: 76  SLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFR 109
           +LT++ YL+  GS   + W + N+ +I+ L +F+
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQ 112

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 26/129 (20%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+NV+  Y   Q+ +R AT  +S GP+   L ++    Y+ V  F + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYLV----RFGSENCVLWCRE--NLY 100
                               G  WR + K L +L+YL+    R    + VL C +     
Sbjct: 79  HMAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHI 138

Query: 101 VIKTLMEFR 109
           + K  M++R
Sbjct: 139 LTKETMQYR 147

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 49/93 (52%), Gaps = 7/93 (7%)

Query: 23  VRNATA-NESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRL------NDKGKYWRHIAK 75
           V+ AT+ +E+ G +   ++E++  TY      EI+ +I KRL       +  +    + K
Sbjct: 19  VKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRNCIQVMK 78

Query: 76  SLTVLDYLVRFGSENCVLWCRENLYVIKTLMEF 108
           +LT++ YL+  GS   + W + N+ +I+ L  F
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKGNMILIEILENF 111

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 50/94 (53%), Gaps = 7/94 (7%)

Query: 23  VRNAT-ANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRL------NDKGKYWRHIAK 75
           V+ AT  +E+ G +   ++E++  TY      EI+ ++ KRL       +  +    + K
Sbjct: 19  VKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRNCIQVMK 78

Query: 76  SLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFR 109
           +LT++ YL+  GS   + W + N+ +++ L +F+
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQ 112

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 44/98 (44%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+N++  Y   QV VR AT  +S GP+   L+++    Y  V  + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYLV 84
                               G  WR + K LTV++YL+
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 50/113 (44%), Gaps = 24/113 (21%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+NV+  Y   QV +R AT  ++ GP+   L ++    Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYL---VRFGSE-NCVLWC 95
                               G  WR + K LTV++YL   V  G E N V+ C
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRC 131

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 55/129 (42%), Gaps = 26/129 (20%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+NV+  Y   QV +R AT  +S GP+   L ++    Y  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYL---VRFGSE-NCVLWCRENLYVI 102
                               G  WR + K L VL+YL   V  GSE + V+ C      I
Sbjct: 79  HIASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTTHKRI 138

Query: 103 --KTLMEFR 109
             + +M+FR
Sbjct: 139 LSRDVMQFR 147

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+NV+  Y   QV +R AT  ++ GP+   L ++    Y  V  + + + I KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKRLVD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYLV 84
                               G  WR + K LTV+++L+
Sbjct: 79  HIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 24/115 (20%)

Query: 7   RSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDK 66
           R  +N++  Y   Q+ +R AT  ++ GP+   L ++    Y SV  + + + + KR+ D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 67  -------------------GKYWRHIAKSLTVLDYLVRFGSE----NCVLWCREN 98
                              G  WR I K L V++YL+   SE    N V  C EN
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLEN 134

>SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 393

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 28/115 (24%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+N++  Y   QV +R AT  +S GP+   L ++    +  V  + + + I KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDIRRATNTDSWGPTPKHLSKVMRNRF-QVPLYLMTEYILKRLVD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYL---VRFGSE-----NCVL 93
                               G  WR + K L +L+++   V  G+E     NC+L
Sbjct: 79  HIATRPKNLYEKARKQYVNYGNEWRVVLKCLVLLEHMLLNVDVGNELDQVVNCIL 133

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 48/112 (42%), Gaps = 24/112 (21%)

Query: 7   RSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDK 66
           R A+NV+  Y   Q+ +R AT  ++ GP+   L ++    Y  V  + + + I KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRY-QVPLYLMTEYILKRIVDH 79

Query: 67  -------------------GKYWRHIAKSLTVLDYL---VRFGSE-NCVLWC 95
                              G  WR + K L V+D+L   V  G E N V  C
Sbjct: 80  IAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEELNQVKSC 131

>AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR153C
           (ENT5)
          Length = 387

 Score = 37.4 bits (85), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+NV+  Y   QV VR AT  +S GP+  ++ ++  +  + V  + I +   KRL D
Sbjct: 20  ARFAQNVIIQYEPYQVDVRRATNTDSWGPTPKQMLKVM-RHKNHVPMYLITEYTMKRLVD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYLV 84
                               G  WR + K L VL++L+
Sbjct: 79  HMAKRPKNLYEKARKQYVNYGHEWRVVLKCLVVLEFLI 116

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 55/128 (42%), Gaps = 26/128 (20%)

Query: 7   RSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDK 66
           R A+NV+  Y   QV +R AT  +S GP+   L ++    Y  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKYWRHIAKSLTVLDYL---VRFGSE-NCVLWCRENLYVI- 102
                              G  WR + K L VL+YL   V  GSE + V+ C      I 
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTTHKRIL 139

Query: 103 -KTLMEFR 109
            + +M+FR
Sbjct: 140 SRDVMQFR 147

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 14/113 (12%)

Query: 5   FVRSAKNVVKGYSSAQVLVRNAT-ANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRL 63
           F  S +N+V  YS  ++ VR AT  NE    +   ++E++  TY +    EI+ ++ K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTL 105
                  N  G    K    + K+ T++ YL+  GS + + W + N  V++ L
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQIL 113

>Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa]
           {ON} complement(205197..206303) [1107 nt, 369 aa]
          Length = 368

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 56/120 (46%), Gaps = 25/120 (20%)

Query: 7   RSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDK 66
           R A+N++  Y   Q+ +R AT  +S GP+   L ++    Y  V  + + + I KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRTATNTDSWGPTSKHLQKVIRHKY-HVPVYLMTEYILKRLIDH 79

Query: 67  -------------------GKYWRHIAKSLTVLDYL---VRFGSE-NCVLWC-RENLYVI 102
                              G  WR + K L ++++L   V  G E + VL C +++++++
Sbjct: 80  IASKPKNFYEKARKEYVNYGNEWRVVMKCLILIEFLLMNVSDGDELHQVLTCLKKHIHIL 139

>Suva_2.315 Chr2
           complement(560767..560940,560968..561033,561037..562005)
           [1209 bp, 403 aa] {ON} YDR153C (REAL)
          Length = 403

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 42/98 (42%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+NV+  Y   QV +R AT  ++ GP+   L ++    Y  V  + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYLV 84
                               G  WR + K L V+++L+
Sbjct: 79  HIATRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.84
          YGR241C
          Length = 473

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 17 SSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDKGKYWRHIAKS 76
          +S + LV+ AT  +   P    +D +   T +++EF +I+  +  R+N+    W  I K+
Sbjct: 2  TSYKKLVKGATKIKMAPPKQKYVDPILLGTSNNIEFQQIVSELTSRINN-CNIWSVIYKT 60

Query: 77 LTVLDYLVRFGSENCVL 93
          L V+  ++  G  N  L
Sbjct: 61 LIVVHLMISIGEPNVTL 77

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDK 66
           R  +N++  Y   Q+ VR A+  ++ GP+   L ++    Y SV  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKYWRHIAKSLTVLDYLV 84
                              G  WR + K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {ON}
           Anc_8.335 YDR153C
          Length = 361

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDK 66
           R A+N++  Y   Q+ +R AT  ++ GP+   L+++    Y  V  + + +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRRATNTDAWGPTPKHLEKVLRNRY-QVPLYLLTEYTLKRLVDH 79

Query: 67  -------------------GKYWRHIAKSLTVLDYLV 84
                              G  WR + K L V+++L+
Sbjct: 80  VATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON}
           YDR153C (REAL)
          Length = 416

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 42/98 (42%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+NV+  Y   Q+ +R AT  ++ GP+   L ++    Y  V  + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYLV 84
                               G  WR + K L V+++L+
Sbjct: 79  HIATRPKNFYEKARKDYVNYGSEWRVVLKCLAVIEFLL 116

>YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}
           ENT5Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p, clathrin adaptor complex AP-1, and
           clathrin
          Length = 411

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 42/98 (42%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+NV+  Y   Q+ +R AT  ++ GP+   L ++    Y  V  + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYLV 84
                               G  WR + K L V+++L+
Sbjct: 79  HIATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON}
           YDR153C (REAL)
          Length = 406

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 42/98 (42%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
            R A+NV+  Y   QV +R AT  ++ GP+   L ++    Y  V  + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKSLTVLDYLV 84
                               G  WR + K L V+++L+
Sbjct: 79  HIASRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>NCAS0D01460 Chr4 (276159..278195) [2037 bp, 678 aa] {ON} Anc_5.84
           YGR241C
          Length = 678

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 325 PMATGSNNPFALNNLQLQQARPAQSSP--VPNFTST 358
           P  TGSNNPF+LNN+  +  +  Q +P  V NF ST
Sbjct: 488 PQPTGSNNPFSLNNITKESQQREQINPFSVSNFAST 523

>KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa]
          {ON} Anc_5.84 YGR241C
          Length = 604

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 2/72 (2%)

Query: 22 LVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDKGKYWRHIAKSLTVLD 81
          LV+ AT  +   P    +D +   T    +F EI+  +  R+ D    W  + KSL V  
Sbjct: 7  LVKGATKIKMAPPKAKYVDPILLGTAQRDDFREIVGALRTRVGDSA--WTVVYKSLLVCH 64

Query: 82 YLVRFGSENCVL 93
           + R G E  VL
Sbjct: 65 LMFREGDEQIVL 76

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (87%)

Query: 325 PMATGSNNPFALNNLQ 340
           P+ TGSNNPFALNN Q
Sbjct: 447 PLPTGSNNPFALNNAQ 462

>NCAS0E03820 Chr5 (750631..751917) [1287 bp, 428 aa] {ON} Anc_5.84
          YGR241C
          Length = 428

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 17 SSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLNDKGKYWRHIAKS 76
          +S   LV+ AT  +   P    +D +   T + +EF +I+  +  R+N+    W  + K+
Sbjct: 2  TSYNKLVKGATKVKMAPPKQKYVDPILLGTANPMEFEQIVSQLTARINN-CNIWSVVYKT 60

Query: 77 LTVLDYLVRFGSENCVL 93
          L V+  ++  G +   L
Sbjct: 61 LIVVHLMISIGEQGVTL 77

>TDEL0B00320 Chr2 complement(59154..61067) [1914 bp, 637 aa] {ON}
           Anc_8.863 YML088W
          Length = 637

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%), Gaps = 3/38 (7%)

Query: 163 EQDG--FDDDLQRALDESRLTAEEDERRRKMLGSEDDD 198
           EQ G   DDDL+RA++ESRL A+E+++  +    EDD+
Sbjct: 540 EQSGEEVDDDLERAIEESRL-AQENQQFVESFADEDDE 576

>Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}
          similar to Ashbya gossypii AGR046C
          Length = 408

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 7/70 (10%)

Query: 6  VRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMIDKRLND 65
           R A+N++  Y   QV +R AT  +S GP+  +L ++    Y  V  + I +   KRL D
Sbjct: 20 ARFAQNMIIQYEPYQVDIRRATNTDSWGPTPKQLAKVMRNRY-QVPMYLITEYTMKRLVD 78

Query: 66 KGKYWRHIAK 75
                H+AK
Sbjct: 79 ------HMAK 82

>Ecym_3521 Chr3 (984567..986012) [1446 bp, 481 aa] {ON} similar to
           Ashbya gossypii AEL209W
          Length = 481

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 325 PMATGSNNPFALNNLQLQQARPAQSSPVPN 354
           P  TGSNNPF+L N   QQ    Q +PV N
Sbjct: 404 PTPTGSNNPFSLQNFN-QQTSNIQVTPVTN 432

>TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.84
           YGR241C
          Length = 515

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 442 YRQVTGEPKKNPFLQ-----SQYTGIPSSN-IVPAHTGYGFG 477
           + Q   +P  NPFL       Q TG  S+N I PA TG GFG
Sbjct: 331 FEQQVPQPTGNPFLTMNDLPQQQTGFYSANQITPAFTGAGFG 372

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,920,146
Number of extensions: 1140708
Number of successful extensions: 3312
Number of sequences better than 10.0: 108
Number of HSP's gapped: 3292
Number of HSP's successfully gapped: 160
Length of query: 501
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 387
Effective length of database: 40,409,475
Effective search space: 15638466825
Effective search space used: 15638466825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)