Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C020407.343ON70570535920.0
NCAS0A141107.343ON75363426430.0
CAGL0I03410g7.343ON72471926390.0
NDAI0A019407.343ON76572525920.0
ZYRO0F11572g7.343ON73171225720.0
KNAG0C037407.343ON72772525660.0
Suva_4.827.343ON75572625610.0
Skud_4.937.343ON75573925410.0
Smik_4.747.343ON84561425380.0
YDL164C (CDC9)7.343ON75571725290.0
SAKL0F10912g7.343ON69368725230.0
KAFR0B008307.343ON71069825200.0
Kpol_2001.717.343ON72671124900.0
Kwal_56.246167.343ON71570923920.0
KLTH0H01408g7.343ON72372123570.0
KLLA0D12496g7.343ON70071522790.0
TPHA0D045707.343ON73672022490.0
ACL155W7.343ON69769622050.0
TBLA0E020507.343ON72069220970.0
TPHA0M002606.18ON9664222638e-23
ACR008W6.18ON9814072513e-21
TBLA0G010406.18ON9722382477e-21
CAGL0E02695g6.18ON9462922371e-19
ZYRO0C07854g6.18ON9443982352e-19
Smik_15.1746.18ON9454352343e-19
TDEL0G045106.18ON9694072316e-19
KLLA0D01089g6.18ON9073802308e-19
YOR005C (DNL4)6.18ON9443832281e-18
KNAG0F028706.18ON9542382272e-18
KLTH0C11286g6.18ON9514292253e-18
Kwal_56.224146.18ON9632602254e-18
NCAS0D026506.18ON9502432244e-18
Skud_15.1666.18ON9474442244e-18
Suva_15.1806.18ON9484632201e-17
KAFR0A050506.18ON9484092164e-17
NDAI0I022606.18ON9672692075e-16
Kpol_1032.76.18ON9652242032e-15
TBLA0D016805.523ON67050734.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C02040
         (705 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...  1388   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...  1022   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...  1021   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...  1003   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   995   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   993   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   991   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   983   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   982   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   978   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   976   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   975   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   963   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   926   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   912   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   882   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   870   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   853   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   812   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   105   8e-23
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   101   3e-21
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   100   7e-21
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    96   1e-19
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...    95   2e-19
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...    95   3e-19
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...    94   6e-19
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    93   8e-19
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...    92   1e-18
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...    92   2e-18
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    91   3e-18
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    91   4e-18
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    91   4e-18
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    91   4e-18
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    89   1e-17
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    88   4e-17
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    84   5e-16
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    83   2e-15
TBLA0D01680 Chr4 complement(416752..418764) [2013 bp, 670 aa] {O...    33   4.2  

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 1388 bits (3592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/705 (96%), Positives = 679/705 (96%)

Query: 1   MFRVVGRPLVELLINKGMSSGKKQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPV 60
           MFRVVGRPLVELLINKGMSSGKKQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPV
Sbjct: 1   MFRVVGRPLVELLINKGMSSGKKQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPV 60

Query: 61  TKKFKSSSPVKLQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRL 120
           TKKFKSSSPVKLQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRL
Sbjct: 61  TKKFKSSSPVKLQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRL 120

Query: 121 SIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXXXXXXXXXXXMKTISEACGKS 180
           SIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEP           MKTISEACGKS
Sbjct: 121 SIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGLGEGLLMKTISEACGKS 180

Query: 181 LVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIK 240
           LVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIK
Sbjct: 181 LVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIK 240

Query: 241 LIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVEQ 300
           LIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVEQ
Sbjct: 241 LIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVEQ 300

Query: 301 AEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRF 360
           AEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRF
Sbjct: 301 AEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRF 360

Query: 361 QGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHTKTLIL 420
           QGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHTKTLIL
Sbjct: 361 QGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHTKTLIL 420

Query: 421 DCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINKSLRER 480
           DCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINKSLRER
Sbjct: 421 DCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINKSLRER 480

Query: 481 RELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSK 540
           RELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSK
Sbjct: 481 RELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSK 540

Query: 541 RSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEFETCCKIG 600
           RSRNWLKLKKDYLDGVGDSLDLCVL               FLLGCYNQDSGEFETCCKIG
Sbjct: 541 RSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEFETCCKIG 600

Query: 601 TGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKA 660
           TGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKA
Sbjct: 601 TGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKA 660

Query: 661 GASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHVA 705
           GASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHVA
Sbjct: 661 GASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHVA 705

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/634 (76%), Positives = 546/634 (86%), Gaps = 1/634 (0%)

Query: 71  KLQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRLSIIKICSEFF 130
           KL+ S+L P K   +E+  +  S   Y+S +PY +VCN+FQEIE TSSRL+IIK+CS+FF
Sbjct: 120 KLEESNLEPSKEPTIENVTQD-STKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFF 178

Query: 131 SRIMKDNPQNLIPTTYLFINRLGPDYEPXXXXXXXXXXXMKTISEACGKSLVQVKNRYRE 190
            +IMK+NPQNLIP TYLFIN+LGPDYEP           MKTISE+CGKSL QV+N+YRE
Sbjct: 179 IKIMKENPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSLAQVRNKYRE 238

Query: 191 MGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLTACE 250
           +GDLGQIA++ARNVQPTMFKPKPLTVGEVFENLR IA S+GKDSQTRKIKLIKRMLTACE
Sbjct: 239 LGDLGQIAMDARNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACE 298

Query: 251 GVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVEQAEAKIRDAFC 310
           G EAKFLIRSLESKLRIGLAEKTVLISLSKALL +E +  K+  MEL+E AE KIRDAFC
Sbjct: 299 GTEAKFLIRSLESKLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFC 358

Query: 311 QVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYK 370
           QVPNYEIVIN+CL YGIMEL+ HC LRPGIPLKPMLAKPTK+I E+LDRFQG+ FTSEYK
Sbjct: 359 QVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYK 418

Query: 371 YDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHTKTLILDCEAVAWDKV 430
           YDGERAQVHLL DGTMRIYSRNGENMTERYPEI IRDF+AD   T TLILDCEAVAWD  
Sbjct: 419 YDGERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNE 478

Query: 431 QQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKP 490
           Q KILPFQVLSTRKRKDV+ KDVKV+VCLFAFDI+CHN E+ INKSLRERR++L +VTK 
Sbjct: 479 QNKILPFQVLSTRKRKDVDLKDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKS 538

Query: 491 VAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKK 550
           V GEFQYA E+T+S+++ELQKFLDQSV DSCEGLMVKMLDG ESHYEPSKRSRNWLKLKK
Sbjct: 539 VTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKK 598

Query: 551 DYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEFETCCKIGTGFSDEMLQQ 610
           DYL+G+GDSLDLCV+               FLLGCYNQD+GEFETCCKIGTGFSDEMLQQ
Sbjct: 599 DYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQ 658

Query: 611 LYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDKGVS 670
           LY R + T LDGPKAT+V+DSSAEPDVWFEPT LFEVLTADLSLSP+YKAG+STYDKG+S
Sbjct: 659 LYTRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGIS 718

Query: 671 LRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704
           LRFPRF+R R+DK VEDATSS QI+ELY++Q+H 
Sbjct: 719 LRFPRFIRTREDKGVEDATSSEQIIELYENQAHT 752

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score = 1021 bits (2639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/719 (70%), Positives = 582/719 (80%), Gaps = 26/719 (3%)

Query: 3   RVVGRPLVELLINKGMSSGKKQATLARFFSAVQKDDTKEKVN--GDVKIIESRDNQDEPV 60
           R++  P   L++ K      +QATLARFFS+V+KD   +K     DVK      N  E  
Sbjct: 15  RIIKEPTRPLIVMK------RQATLARFFSSVKKDADGDKKGEQADVKTAAVDLNSHEVD 68

Query: 61  TKKFKSSSPVKL----QTSSLSPVKSA--------GVESGDKPVSPDL-YYSKVPYSDVC 107
             K    SP+K      T SL+  K+         G      P   D  ++ KVPYSD+C
Sbjct: 69  ANK----SPLKKMKLESTGSLTATKNGNQGKEEHEGTPIASTPRQVDSKFFCKVPYSDLC 124

Query: 108 NVFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXXXXXXXXX 167
           N+F+EIEGTSSRL+IIK+CS+FF +IMK++PQNLIP TYLFIN+LGPDYEP         
Sbjct: 125 NLFEEIEGTSSRLAIIKLCSDFFIKIMKEDPQNLIPVTYLFINKLGPDYEPGLELGLGEN 184

Query: 168 XXMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIA 227
             MKTISE+CGKS+ Q+KN+YRE+GDLGQIALEARNVQPTMFKPKPL VGEVFENL+ IA
Sbjct: 185 LLMKTISESCGKSMQQIKNQYREIGDLGQIALEARNVQPTMFKPKPLVVGEVFENLKTIA 244

Query: 228 HSQGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTN-E 286
            SQGKDSQT+K+KLIKRMLTAC+G EAKFLIRSLESKLRIGLAEKTVLI+LSKALL + E
Sbjct: 245 KSQGKDSQTKKMKLIKRMLTACQGTEAKFLIRSLESKLRIGLAEKTVLIALSKALLIHDE 304

Query: 287 GETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPML 346
             + KEPSM++VEQAE KIRDAFCQVPNYE+VINACLDYGIM+LD+HC ++PGIPLKPML
Sbjct: 305 KYSNKEPSMDVVEQAEQKIRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPML 364

Query: 347 AKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIR 406
           AKPTK+I EVLDRFQGQTFTSEYKYDGERAQVHLL+DGTMRIYSRNGENMTERYPEI I+
Sbjct: 365 AKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIK 424

Query: 407 DFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIIC 466
           DF+AD   T +LILDCEAVAWDK Q KILPFQVL+TRKRKDV   +VKVRVCLFAFDI+ 
Sbjct: 425 DFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDILL 484

Query: 467 HNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMV 526
           HN  R IN+ L +RRE+L +VTKPV GEFQYA ++TTS+++ELQKFLD+SVK+SCEGLMV
Sbjct: 485 HNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMV 544

Query: 527 KMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCY 586
           KM+DG ES+YEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLGCY
Sbjct: 545 KMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCY 604

Query: 587 NQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFE 646
           N DS +FETCCKIGTGFS+EMLQ LYE+ S T +DGPK TYVFDSSAEPDVWFEPT LFE
Sbjct: 605 NADSEDFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFE 664

Query: 647 VLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHVA 705
           VLTADLSLSP+YKAG+S YDKG+SLRFPRF+R+RDDKSVEDATSS QI+E+YQ+QSHVA
Sbjct: 665 VLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHVA 723

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score = 1003 bits (2592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/725 (69%), Positives = 569/725 (78%), Gaps = 43/725 (5%)

Query: 17  GMSSGKKQ-ATLARFFSAVQ----------KDDTKEKVNGDVKIIESRDNQDEPVTKKF- 64
            +S G+KQ ATL RFFS++           K+++KE+        E++D+ D    KK  
Sbjct: 43  NVSKGRKQQATLGRFFSSINHKKPTKDTALKNESKEETKE-----ENKDDSDSIPRKKIR 97

Query: 65  --------------KSSSPVKLQTSSLSPVKSAGVES------GDKPVSPDLYYSK---- 100
                         K  SP+KL T   S   SA   +       D  + P    SK    
Sbjct: 98  LSTSSSSPSIMAESKPKSPIKLNTERSSSPASASASTTPTPIVADHTLDPKTAVSKPFLC 157

Query: 101 -VPYSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPX 159
            +PY +VC +FQEIE TSSRLSIIK+CS+F  +IMK +PQNLIP TYLFIN+LGPDYEP 
Sbjct: 158 AIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPG 217

Query: 160 XXXXXXXXXXMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEV 219
                     MKTISE+CGKSL Q++ +YRE+GDLGQIALEARNVQPTMFKPKPLTVGEV
Sbjct: 218 LELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEV 277

Query: 220 FENLRAIAHSQGKDSQTRKIKLIKRMLTACE-GVEAKFLIRSLESKLRIGLAEKTVLISL 278
           F NL+ IA + GKDSQT+KIKLIKRMLTACE GVEAKFLIRSLESKLRIGLAEKTVLISL
Sbjct: 278 FNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISL 337

Query: 279 SKALLTNEGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRP 338
           SKALL  E +  K+  MEL+E AE KIRDAFCQVPNYEIVIN+CL YGIM L++HC LRP
Sbjct: 338 SKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRP 397

Query: 339 GIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTE 398
           GIPLKPMLAKPTK+I E+LDRFQG+TFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTE
Sbjct: 398 GIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTE 457

Query: 399 RYPEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVC 458
           RYPEI I DFV D   TKTLILDCEAVAWDK QQKILPFQVLSTRKRKDV AKDVKVRVC
Sbjct: 458 RYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVC 517

Query: 459 LFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVK 518
           LFAFDI+CHN  + IN SL+ERRE+L +VT P  GEFQYA ELTTS+++ELQKFLDQSV 
Sbjct: 518 LFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVN 577

Query: 519 DSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXX 578
           DSCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL+G+GDSLDLCVL             
Sbjct: 578 DSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTY 637

Query: 579 XXFLLGCYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVW 638
             FLLGCYN ++GEFETCCKIGTGFSDEMLQQL+E+   T +DGPKATY++DSSAEPDVW
Sbjct: 638 GGFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVW 697

Query: 639 FEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELY 698
           FEP+ LFEVLTADLSLSP+YKAG+S YDKGVSLRFPRF+R+R+DK VEDATSS QI+ELY
Sbjct: 698 FEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELY 757

Query: 699 QDQSH 703
           ++QSH
Sbjct: 758 ENQSH 762

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  995 bits (2572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/712 (68%), Positives = 566/712 (79%), Gaps = 39/712 (5%)

Query: 23  KQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPVTKKFKSSSPVKLQTSS------ 76
           KQATLA+FFS+V+  ++  K N              P T   K  SPV+  ++       
Sbjct: 30  KQATLAKFFSSVKDRNSPTKKNATPAF---------PTTTNVKRESPVRSNSNEKESSPM 80

Query: 77  -------LSPVKSAGVESGDKPV----------------SPDLYYSKVPYSDVCNVFQEI 113
                   S   SAG+E    P                 + D ++S VPY+DVCN+FQEI
Sbjct: 81  FDDSNGRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNNQDDHFSTVPYADVCNIFQEI 140

Query: 114 EGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXXXXXXXXXXXMKTI 173
           E TSSRLSIIKICS+FF++I+K++ +NL+PTTYLFIN+LGPDYEP           MKTI
Sbjct: 141 ESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPGMELGLGEGLLMKTI 200

Query: 174 SEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKD 233
           SE+CGKSL QVKNRYREMGDLGQIA+EARNVQPTMFKPKPLTVGEVF NLR IA++QGKD
Sbjct: 201 SESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRNIANAQGKD 260

Query: 234 SQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEP 293
           SQ +KIKLIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLISLS ALL +E     EP
Sbjct: 261 SQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQGLDVEP 320

Query: 294 SMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSI 353
           S E V++AE  IRDAFCQVPNYEIVIN CL++GI +L KHC+L PGIPLKPMLAKPTK+I
Sbjct: 321 SDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAI 380

Query: 354 TEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLE 413
           TEVLDRFQGQ F SEYKYDGERAQ+HLL DGTMRIYSRNGENMTERYPEI IRDF++D  
Sbjct: 381 TEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFLSD-P 439

Query: 414 HTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQI 473
            T++LILDCEAVAWDK Q KILPFQVLSTRKRKDV+AKDVKVRVCLFAFD++CHNGE  I
Sbjct: 440 STESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVCLFAFDLLCHNGEPLI 499

Query: 474 NKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPE 533
           NKSLRER++ L +VTKPV GEF+YA +L T+++EELQ FLDQSVKDSCEGLMVKMLDGPE
Sbjct: 500 NKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPE 559

Query: 534 SHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEF 593
           SHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLGCYNQD+GE+
Sbjct: 560 SHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEY 619

Query: 594 ETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLS 653
           ETCCKIGTGFS+E+LQQLY+R   T ++ P A YV+DS+ +PDVWFEPT LFEVL ADLS
Sbjct: 620 ETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAADLS 679

Query: 654 LSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHVA 705
           LSPVYKAG++ YDKG+SLRFPRF+R+RDDKSVE+ATSS Q+V+LY+ Q+H++
Sbjct: 680 LSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHLS 731

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/725 (67%), Positives = 572/725 (78%), Gaps = 21/725 (2%)

Query: 1   MFRVVGRPLVELLINKGMSSGKKQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPV 60
           M++ V +PL+   +       K+Q TL  FF++V+K DT    +   K +E  ++   P 
Sbjct: 1   MWKSVCKPLLTNRLTTIHPKMKRQMTLNNFFTSVKKSDTNTPASTTPKKMEKDESPQIPA 60

Query: 61  TKKFK--------------SSSPVK------LQTSSLSPVKSAGVESGDKPVSPDLYYSK 100
           TK  +              SSS V       L + S +PV S  ++  D+      +YS 
Sbjct: 61  TKTAEEKHENMDVDTDPVISSSEVSAKRNSPLTSPSPTPVVSKKIKIQDENNDTKEFYST 120

Query: 101 VPYSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXX 160
           VPY+D+CN+FQEIEG SSRL+IIK+CS F   +MK +P+NLIP TYLFIN+LGPDY P  
Sbjct: 121 VPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPGL 180

Query: 161 XXXXXXXXXMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVF 220
                    +KTI+E+CG+SL Q+K +Y E+GDLGQIALEAR VQPTMFKPKPLTVGEVF
Sbjct: 181 ELGLGENLLIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVF 240

Query: 221 ENLRAIAHSQGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSK 280
           +NL++IA SQGKDSQT+KIKLIKRMLT+C+GVEAKFLIRSLESKLRIGLAEKTVLISLSK
Sbjct: 241 QNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSK 300

Query: 281 ALLTNE-GETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPG 339
           ALL  E GE+ K+  ME VE AE KIRDAFCQVPNYE+VI++CL +GIM LD+HC LRP 
Sbjct: 301 ALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPA 360

Query: 340 IPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTER 399
           IPLKPMLAKPTKSI+E+ DRFQ Q FT EYKYDGERAQVHLLEDGTMRIYSRNGENMTER
Sbjct: 361 IPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTER 420

Query: 400 YPEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCL 459
           YPEI IRDFV DL HTK+LILDCEAVAWDK Q KILPFQVLSTRKRKDV+  ++KVRVCL
Sbjct: 421 YPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCL 480

Query: 460 FAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKD 519
           FAFDI+ HN E+ INKSL+ERR++L  +TK V GEFQ+A E+TT+++EELQ FLDQSVK+
Sbjct: 481 FAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKN 540

Query: 520 SCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXX 579
           SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL              
Sbjct: 541 SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYG 600

Query: 580 XFLLGCYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWF 639
            FLLGCYNQD+GEFET CKIGTGFSDE+LQQL+ER   T +D PKATYVFD SAEPDVWF
Sbjct: 601 GFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWF 660

Query: 640 EPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQ 699
           EPT LFEVLTADLSLSPVYKAG+STYDKGVSLRFPRF+RLR+DK VEDATSS QIVE+Y+
Sbjct: 661 EPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYE 720

Query: 700 DQSHV 704
           +Q+++
Sbjct: 721 NQANL 725

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  991 bits (2561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/726 (68%), Positives = 566/726 (77%), Gaps = 43/726 (5%)

Query: 19  SSGKK--QATLARFFSAVQKDDT----------KEKVNGDVKIIESRDNQDEPVTKKFKS 66
           S+GKK  QATLARFF++++   +          K K+      I S   +     KK K 
Sbjct: 31  SAGKKPKQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISS---EGASAIKKLKH 87

Query: 67  SSPVK------------------------LQTSSLSPVKSAGVESGDKPVSPDLYYSKVP 102
            S V+                        +  S  S   +  VE    P+  D Y S +P
Sbjct: 88  LSAVQTPVEQSDMSSSSSPLPSSAPSSSGVDASQKSRELTPKVEEEQGPIDNDHYSSNIP 147

Query: 103 YSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXXXX 162
           YS+VC VF EIE  SSRL II+ICS+FF +IMK + +NLIPTTYLFINRLGPDYEP    
Sbjct: 148 YSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEPGLEL 207

Query: 163 XXXXXXXMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFEN 222
                  MKTISE+CGKS+ Q+K +Y+E+GDLG+IA+ ARNVQPTMFKPKPLTVGEVF+N
Sbjct: 208 GLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKN 267

Query: 223 LRAIAHSQGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKAL 282
           LR+IA +QGKDSQ RK+KLIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLISLSKAL
Sbjct: 268 LRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKAL 327

Query: 283 LTNEGETGK----EPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRP 338
           L + G        +  M+++E A+ KIRDAFCQVPNYEIVIN+CL++GIM LDK C L+P
Sbjct: 328 LLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKP 387

Query: 339 GIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTE 398
           GIPLKPMLAKPTK+I EVLDRFQG+TFTSEYKYDGERAQVHLL+DGTMRIYSRNGENMTE
Sbjct: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGENMTE 447

Query: 399 RYPEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVC 458
           RYPEI I DF+ DL+ TK LILDCEAVAWDK Q KILPFQVLSTRKRKDVE  DVKVRVC
Sbjct: 448 RYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVRVC 507

Query: 459 LFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVK 518
           LFAFD++CHNGER INKSLRERRE L +VTK V GEFQYA ++ T +++ELQKFLD+SV 
Sbjct: 508 LFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVN 567

Query: 519 DSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXX 578
            SCEGLMVKML+GPESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL             
Sbjct: 568 QSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTY 627

Query: 579 XXFLLGCYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVW 638
             FLLGCYNQD+GEFETCCKIGTGFSDE LQQL+ER + T +DGPKAT+VFDSSAEPDVW
Sbjct: 628 GGFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPDVW 687

Query: 639 FEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELY 698
           FEPTTLFEVLTADLSLSP+YKAG++T+ KGVSLRFPRF+R+R+DK VEDATSS QIVELY
Sbjct: 688 FEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELY 747

Query: 699 QDQSHV 704
           ++QSHV
Sbjct: 748 ENQSHV 753

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/739 (66%), Positives = 575/739 (77%), Gaps = 45/739 (6%)

Query: 8   PLVELLINKGM--SSGKK--QATLARFFSAVQKDDT----------KEKVNGDVKIIESR 53
           P + LL+   +  S+GKK  QATLARFFS+++ + +          K K+  +   I++ 
Sbjct: 18  PRLSLLMPPSLPSSAGKKPKQATLARFFSSMKNEPSGSSSSPEKAPKHKLENN---IDNN 74

Query: 54  DNQDEPVTKKFKSSSPVK------------------------LQTSSLSPVKSAGVESGD 89
            ++    TKK K  S V+                        +  S  S   +  VE   
Sbjct: 75  SSEGADATKKLKQVSTVQTLVAPSTMGSSPFSLPSSAPSSSGVDVSQESREFTPQVEKEP 134

Query: 90  KPVSPDLYYSKVPYSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFI 149
                D Y S +PYS+VC VF +IE  SSRL II+ICS+FF +IM  + +NLIPTTYLFI
Sbjct: 135 SSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFI 194

Query: 150 NRLGPDYEPXXXXXXXXXXXMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMF 209
           NRLGPDYE            MKTISE+CGKS+ Q+K +Y+EMGDLG+IA+ ARNVQPTMF
Sbjct: 195 NRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMF 254

Query: 210 KPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGL 269
           KPK LTVGEVF+NLR IA +QGKDSQ RK+KLIKRMLTAC+GVEAKFLIRSLESKLRIGL
Sbjct: 255 KPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGL 314

Query: 270 AEKTVLISLSKALLTN----EGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDY 325
           AEKTVLISLSKALL +    E    KE  M+++E A+ +IRDAFCQVPNYEIVIN+CL++
Sbjct: 315 AEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNH 374

Query: 326 GIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGT 385
           GIM LDK+C LRPGIPLKPMLAKPTK+I EVLDRFQG+TFTSEYKYDGERAQVHLL DGT
Sbjct: 375 GIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT 434

Query: 386 MRIYSRNGENMTERYPEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKR 445
           MRIYSRNGENMTERYPEI I DF+ DL  TK LILDCEAVAWDK Q+KILPFQ+LSTRKR
Sbjct: 435 MRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKR 494

Query: 446 KDVEAKDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSS 505
           KDVE  DVKV+VCLFAFDI+C+N ER INKSLRERRE LA+VTK V GEFQYA ++ T++
Sbjct: 495 KDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNN 554

Query: 506 VEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVL 565
           ++ELQKFLD+SV +SCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL
Sbjct: 555 LDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614

Query: 566 XXXXXXXXXXXXXXXFLLGCYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKA 625
                          FLLGCYNQD+GEFETCCKIGTGFSDEMLQ L+ER + T +DGPKA
Sbjct: 615 GAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKA 674

Query: 626 TYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSV 685
           T+VFD+SAEPDVWFEPTTLFEVLTADLSLSP+YKAG++T+DKGVSLRFPRF+R+R+DK V
Sbjct: 675 TFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGV 734

Query: 686 EDATSSAQIVELYQDQSHV 704
           EDATSS QI+ELY++QSHV
Sbjct: 735 EDATSSDQIIELYENQSHV 753

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/614 (76%), Positives = 525/614 (85%), Gaps = 4/614 (0%)

Query: 95  DLYYSKVPYSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGP 154
           D Y S +PYSDVC VF +IE  SSRL II+ICS+FF ++MK + +NLIPTTYLFINRLGP
Sbjct: 230 DHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGP 289

Query: 155 DYEPXXXXXXXXXXXMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPL 214
           DYE            MKTISE+CGKS+ Q+K +Y+E+GDLG+IA+ ARNVQPTMFKPKPL
Sbjct: 290 DYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPL 349

Query: 215 TVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTV 274
           TVGEVF+NLR IA +QGKDSQ RKIKLIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTV
Sbjct: 350 TVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTV 409

Query: 275 LISLSKALLTN----EGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMEL 330
           LISLSKALL +    E    K+  M+++E A+ KIRDAFCQVPNYEIVIN+CL++GIM L
Sbjct: 410 LISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNL 469

Query: 331 DKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYS 390
           DK+C LRPGIPLKPMLAKPTK+I EVLDRFQG+TFTSEYKYDGERAQVHLL DGTMRIYS
Sbjct: 470 DKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYS 529

Query: 391 RNGENMTERYPEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEA 450
           RNGENMTERYPEI I DF+ DL+ TK LILDCEAVAWDK Q KILPFQVLSTRKRKDVE 
Sbjct: 530 RNGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVEL 589

Query: 451 KDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQ 510
            DVKVRVCLFAFDI+CHN ER IN SLRERRE L +VTK V GEFQYA ++ T++++ELQ
Sbjct: 590 NDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQ 649

Query: 511 KFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXX 570
           KFLD+SV  SCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL     
Sbjct: 650 KFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYG 709

Query: 571 XXXXXXXXXXFLLGCYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFD 630
                     FLLGCYNQD+GEFETCCKIGTGFSDEMLQ L+ R + T +DGPKATYVFD
Sbjct: 710 RGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFD 769

Query: 631 SSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATS 690
           SSAEPDVWFEPTTLFEVLTADLSLSP+YKAG++T+DKGVSLRFPRF+R+R+DK VEDATS
Sbjct: 770 SSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATS 829

Query: 691 SAQIVELYQDQSHV 704
           S QIVELY++QSHV
Sbjct: 830 SDQIVELYENQSHV 843

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  978 bits (2529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/717 (68%), Positives = 572/717 (79%), Gaps = 35/717 (4%)

Query: 23  KQATLARFFSAVQK---DDTKEKVNGDVKIIESR-DN---QDEPVTKKFKSSS------- 68
           KQATLARFF++++    + T         ++E R DN   ++E  TKK K ++       
Sbjct: 37  KQATLARFFTSMKNKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAA 96

Query: 69  PVKLQTS-------------SLSPVKS----AGVESGDKPVSPDLYYSKVPYSDVCNVFQ 111
           P  + ++             + SP +S      VE      + D Y S +PYS+VC VF 
Sbjct: 97  PSSMGSNFSSIPSSAPSSGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFN 156

Query: 112 EIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXXXXXXXXXXXMK 171
           +IE  SSRL II+ICS+FF +IMK + +NLIPTTYLFINRLGPDYE            MK
Sbjct: 157 KIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMK 216

Query: 172 TISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQG 231
           TISE CGKS+ Q+K +Y+++GDLG+IA+ ARNVQPTMFKPKPLTVGEVF+NLRAIA +QG
Sbjct: 217 TISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQG 276

Query: 232 KDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTN----EG 287
           KDSQ +K+KLIKRMLTAC+G+EAKFLIRSLESKLRIGLAEKTVLISLSKALL +    E 
Sbjct: 277 KDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRED 336

Query: 288 ETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLA 347
              K+  M+++E A+ KIRDAFCQVPNYEIVIN+CL++GIM LDK+C LRPGIPLKPMLA
Sbjct: 337 SPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLA 396

Query: 348 KPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRD 407
           KPTK+I EVLDRFQG+TFTSEYKYDGERAQVHLL DGTMRIYSRNGENMTERYPEI+I D
Sbjct: 397 KPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINITD 456

Query: 408 FVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICH 467
           F+ DL+ TK LILDCEAVAWDK Q KILPFQVLSTRKRKDVE  DVKV+VCLFAFDI+C+
Sbjct: 457 FIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCY 516

Query: 468 NGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVK 527
           N ER INKSL+ERRE L +VTK V GEFQYA ++TT++++ELQKFLD+SV  SCEGLMVK
Sbjct: 517 NDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVK 576

Query: 528 MLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYN 587
           ML+GPESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLGCYN
Sbjct: 577 MLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYN 636

Query: 588 QDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEV 647
           QD+GEFETCCKIGTGFSDEMLQ L++R + T +DGPKAT+VFDSSAEPDVWFEPTTLFEV
Sbjct: 637 QDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEV 696

Query: 648 LTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704
           LTADLSLSP+YKAG++T+DKGVSLRFPRF+R+R+DK VEDATSS QIVELY++QSH+
Sbjct: 697 LTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHM 753

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  976 bits (2523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/687 (69%), Positives = 555/687 (80%), Gaps = 7/687 (1%)

Query: 20  SGKKQATLARFFSAVQKDDTKE-KVNGDVKIIESRDNQDEPVTKKFKSSSPV-KLQTSSL 77
           S KKQ TLARFFS+ +K   KE K+    K    R   D   T +  ++  V +  +   
Sbjct: 10  STKKQVTLARFFSSAKKGGNKEDKLEPQAK----RAKVDPANTSELITNEAVARSVSPPT 65

Query: 78  SPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDN 137
             V  A + S   PV   +++SK+PYSDVCN+F EIE TSSRLSI+KICS FF  ++K N
Sbjct: 66  PVVPVAPIISTSTPVMAPVHHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQN 125

Query: 138 PQNLIPTTYLFINRLGPDYEPXXXXXXXXXXXMKTISEACGKSLVQVKNRYREMGDLGQI 197
           P NL+P TYLFINRLGPDYEP           MKTI+E+CGKSL QV+ +YRE+GDLG++
Sbjct: 126 PSNLVPITYLFINRLGPDYEPGLELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGEV 185

Query: 198 ALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLTACEGVEAKFL 257
           A EAR VQPTMFKPKPLTVGEVF NL++IA SQGKDSQTRKI+LIKRMLTAC+GVEAKFL
Sbjct: 186 AQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFL 245

Query: 258 IRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVEQAEAKIRDAFCQVPNYEI 317
           IRSLESKLRIGLAEKTVLISLSKALL+ E + G+EPS ELVE AE ++RDAFCQVPNYEI
Sbjct: 246 IRSLESKLRIGLAEKTVLISLSKALLSYEHD-GEEPSSELVENAEQRVRDAFCQVPNYEI 304

Query: 318 VINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQ 377
           VIN CL++GIME++KHC L+PGIPLKPMLAKP+KSITEVLDRF G+ FT EYKYDGERAQ
Sbjct: 305 VINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQ 364

Query: 378 VHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPF 437
           VHLL DG+M IYSRNGENMTERYPE+ IRD++AD E T +LILDCEAVAWD  Q KILPF
Sbjct: 365 VHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPF 424

Query: 438 QVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQY 497
           Q+LSTRKRK VEAKDVKVRVCLFAFD++C+NG+  IN SL ERRE L +V KPV G+FQ+
Sbjct: 425 QILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQF 484

Query: 498 AVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVG 557
           A EL +S++E++QK+L+QSVKD+CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL GVG
Sbjct: 485 ANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVG 544

Query: 558 DSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEFETCCKIGTGFSDEMLQQLYERFSK 617
           DSLDLCVL               FLLGCYNQD+GEFETCCKIGTGFSDEML  LYE+   
Sbjct: 545 DSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKP 604

Query: 618 TTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFV 677
           ++L+ PKA YV+DSSAEPDVWFEPT LFEVLTADLSLSP+YKAG S Y KG+SLRFPRF+
Sbjct: 605 SSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFI 664

Query: 678 RLRDDKSVEDATSSAQIVELYQDQSHV 704
           R+RDDK VEDATSS QIVELY+ Q ++
Sbjct: 665 RIRDDKDVEDATSSEQIVELYESQVNL 691

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/698 (67%), Positives = 560/698 (80%), Gaps = 5/698 (0%)

Query: 8   PLVELLINKGMSSGKKQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPVTKKFKSS 67
           PLV +      S+ K+QATLARFF++++   + +  N                +     S
Sbjct: 17  PLVYIYSGIMSSNSKRQATLARFFTSIKP--SADDQNSKTSSSPVPPPSSSSSSTTANGS 74

Query: 68  SPVKLQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRLSIIKICS 127
           SP+K     LSP++S+  +S +  V  + +   +PY+DVC +FQEIE  SSRL IIK+CS
Sbjct: 75  SPLK--KPKLSPIESSKTDSSETTVKQE-FVCDIPYADVCVLFQEIENISSRLQIIKLCS 131

Query: 128 EFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXXXXXXXXXXXMKTISEACGKSLVQVKNR 187
           EFF++ MK N  NLIP TYLFIN+LGPDYE            MKTISE+CGKSL QVK  
Sbjct: 132 EFFTKAMKQNTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLD 191

Query: 188 YREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLT 247
           Y+++GDLG IA+ ARNVQPTMFKPKPLTVG VF+NL+ IA S GKDSQ +KI+LIK++LT
Sbjct: 192 YKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLT 251

Query: 248 ACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVEQAEAKIRD 307
           AC+G+EAK+LIRSLESKLRIGLAEK+VLISLSKALL NE     +P MEL+E+AE KIRD
Sbjct: 252 ACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRD 311

Query: 308 AFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTS 367
           AFCQ+PNYEIVIN+CL YGIM LD+HC LRPGIPLKPMLAKPTK+I EV DRFQ   FTS
Sbjct: 312 AFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTS 371

Query: 368 EYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHTKTLILDCEAVAW 427
           EYKYDGERAQVHL+ DG+MRIYSRNGENMTERYPEI++ DF+ DL  TK+LI+DCEAVAW
Sbjct: 372 EYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAW 431

Query: 428 DKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQV 487
           D+ ++KILPFQVLSTRKRKDV+ KD+KVR+CLFAFDI+CHN E+ INKSLRERRE+L  V
Sbjct: 432 DREEKKILPFQVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSV 491

Query: 488 TKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLK 547
           T+ V GEF YA EL+T++++ELQ FLDQSVKDSCEGLMVK+LDG +SHYEPSKRSRNWLK
Sbjct: 492 TREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLK 551

Query: 548 LKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEFETCCKIGTGFSDEM 607
           LKKDYLDGVGDSLDLCVL               FLLGCYNQD+GEFET CKIGTGFSDE+
Sbjct: 552 LKKDYLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETACKIGTGFSDEV 611

Query: 608 LQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDK 667
           LQ LY+R   TT+DGPKATY++DSSA+PDVWFEPT LFEVLTADLS+SP+YKAGASTY K
Sbjct: 612 LQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSK 671

Query: 668 GVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHVA 705
           G+SLRFPRF+RLR+DKSVE+ATSS QI+ELY++QSHVA
Sbjct: 672 GISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHVA 709

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  963 bits (2490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/711 (68%), Positives = 560/711 (78%), Gaps = 27/711 (3%)

Query: 14  INKGMSSGKKQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPVTKKFKSSSPVKLQ 73
           +N G    KKQATLARFFS++ K    +  + D   I   D+ D   +KK K +S     
Sbjct: 21  VNGG--GAKKQATLARFFSSMPKRKIDDDSSTDSTTINKDDDSD--TSKKIKLNSDETPT 76

Query: 74  TS------------SLSP----VKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTS 117
           TS            + SP    V  A V S  KPV    ++S VPY+D+C VFQE+E TS
Sbjct: 77  TSAGSVTSKDEPSLTSSPQKPIVTPAKVPSNTKPVK---FFSTVPYADLCEVFQEVESTS 133

Query: 118 SRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXXXXXXXXXXXMKTISEAC 177
           SRLSIIKICS+F  ++MK +PQNL+P TYLFIN+LGPDYEP           MKTISE+C
Sbjct: 134 SRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLGEGLLMKTISESC 193

Query: 178 GKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTR 237
           GKS+ Q+KN+YRE+GDLGQIA +ARNVQPTMFKPKPLTVGEVF+NL+ IA SQGKDSQ R
Sbjct: 194 GKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQR 253

Query: 238 KIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMEL 297
           K++LIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLISLSKALL NE ET K+PSMEL
Sbjct: 254 KMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMEL 313

Query: 298 VEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVL 357
           +E AE KIRDAFCQVPNYEI+I +CL+ GIMELD +C+LRPGIPLKPMLAKPTK+I EVL
Sbjct: 314 IETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVL 373

Query: 358 DRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDF-VADLEHTK 416
           D FQG+ FT EYKYDGER QVHLL +G MRIYSRNGENMTERYPE+ I DF V D  +T 
Sbjct: 374 DAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTD 433

Query: 417 ---TLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQI 473
              +LILDCE VAWD  Q KILPFQVLSTRKRK VE KDVKVRVCLFAFDI+ +NGE  I
Sbjct: 434 KEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLI 493

Query: 474 NKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPE 533
            K+LRERR++L +VTK V GEFQYA  L T+ ++E+QKFLDQ++KDSCEGLMVK+LDG E
Sbjct: 494 TKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEE 553

Query: 534 SHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEF 593
           S YEPSKRSRNWLKLKKDYL GVGDSLDLCV+               FLLGCYNQDSGE+
Sbjct: 554 SRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCYNQDSGEY 613

Query: 594 ETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLS 653
           ETCCKIGTGFSDEML +LYE F +  ++ PK+ Y FDSSAEPD+WFEP  LFEVLTADLS
Sbjct: 614 ETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLS 673

Query: 654 LSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704
           LSP+YKAG++TYDKG+SLRFPRF+R+RDDKSVEDATSS QI+E+Y++QSH+
Sbjct: 674 LSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHI 724

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/709 (66%), Positives = 548/709 (77%), Gaps = 25/709 (3%)

Query: 18  MSSGKKQATLARFFSAVQK-DDTKE---------KVNG-DVKIIESRDNQ---DE----- 58
           MSS KKQATLA+FFS+ ++ +D KE         ++N  D K   S+ +Q   DE     
Sbjct: 9   MSSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHET 68

Query: 59  ---PVTKKFKSSSPVKLQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEG 115
              P     +  +   +  + L+  KS G  +     +P    S V YS++C+VF EIEG
Sbjct: 69  LQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPK--DSNVMYSEMCSVFNEIEG 126

Query: 116 TSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXXXXXXXXXXXMKTISE 175
           TSSRL I+K+CS+F   ++    ++L+P TYL IN+LGPDY+P           MKTISE
Sbjct: 127 TSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPGLELGLGEGLLMKTISE 186

Query: 176 ACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQ 235
           +CGKSL QVK RYRE+GDLG+IA EAR+VQPTMFKPKPLT G VF NL+ IA +QGKDSQ
Sbjct: 187 SCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQGKDSQ 246

Query: 236 TRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSM 295
            RK++LIK+MLTACEGVEAKFLIRSLESKLRIGLAEK+VL++LSKA+LT+E   GKEPS 
Sbjct: 247 LRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHE-HGGKEPSS 305

Query: 296 ELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITE 355
           +LV+ AE KIRDAFCQVPNYEIVINA L++GIMEL+KHC L PGIPLKPMLAKP+KSI+E
Sbjct: 306 DLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSKSISE 365

Query: 356 VLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHT 415
           VLDRFQGQ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEI+I DFVA  + T
Sbjct: 366 VLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVAHPDET 425

Query: 416 KTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINK 475
            TLILDCEAVAWDK +  ILPFQVLSTRKRK V A+DVKVRVCLFAFDI+C+N E  INK
Sbjct: 426 HTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEPLINK 485

Query: 476 SLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESH 535
           SL ERR  L ++ KPV GE Q A E+TT S++E+Q +LDQSVKD CEGLMVK+LDG ESH
Sbjct: 486 SLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEESH 545

Query: 536 YEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEFET 595
           YEPSKRSRNWLKLKKDYL GVGDSLDLCVL               FLLGCYNQD+GEFET
Sbjct: 546 YEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFET 605

Query: 596 CCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLS 655
           CCKIGTGFSDEMLQ LYE+ S T +  PKA YV+  SA+PDVW EP+ LFEVLTADLSLS
Sbjct: 606 CCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTADLSLS 665

Query: 656 PVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704
           PVYKAG S+Y KG+SLRFPRF+R+RDDKSVEDATSS Q++E Y+ QSH+
Sbjct: 666 PVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  912 bits (2357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/721 (63%), Positives = 537/721 (74%), Gaps = 29/721 (4%)

Query: 13  LINKGMSSGKKQATLARFFSAVQKDDTKEKVNGDVKIIES--------RDNQDEPVTKKF 64
           L+   MSS KKQATLA+FFS+ ++   +EK +   K + S          +   P+    
Sbjct: 4   LVRAEMSSIKKQATLAKFFSSKKRSVEEEKSHEPAKKLHSDPIGAGSGSPSSSPPLATGS 63

Query: 65  KSSSPVKLQTSSLS-----------------PVKSAGVESGDKPVSPDLYY---SKVPYS 104
             +  VK++TS+ S                 P K A   +   P          SK+ Y+
Sbjct: 64  SDAGSVKVETSATSTGENTKAGTPTLPDSDEPAKRAVAATKGDPAKLGASAPKDSKILYA 123

Query: 105 DVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXXXXXX 164
           ++CNVF EIEGTSSRL I+K+C +F   ++    ++++P TYL IN+LGPDY+P      
Sbjct: 124 EMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQPGLELGL 183

Query: 165 XXXXXMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLR 224
                MKTISE+CGKSL Q+K RYRE+GDLG+IA EAR VQPTMFKPKPLT GEVF NL+
Sbjct: 184 GEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEVFSNLQ 243

Query: 225 AIAHSQGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLT 284
           AIA SQGKDSQ RK++LIKRMLTAC+G+EAKFLIRSLESKLRIGLAEK+VL++LSKALLT
Sbjct: 244 AIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALSKALLT 303

Query: 285 NEGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKP 344
            E   GKEPS ELV+ AE KIRDAFCQVPNY+IVI   L++GIMELDKHC L PGIPLKP
Sbjct: 304 YE-HNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKP 362

Query: 345 MLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIS 404
           MLAKP+KSI+EVLDRFQGQ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEI 
Sbjct: 363 MLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIR 422

Query: 405 IRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDI 464
           I DF+AD   T TLILDCEAVAWDK +  ILPFQVLSTRKRK V  +DVKVRVCLFAFDI
Sbjct: 423 ISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDI 482

Query: 465 ICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGL 524
           +C+N E  I + L ERR  L +   PV GE Q A E+TT S++ELQ +LDQ+V+D CEGL
Sbjct: 483 LCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGL 542

Query: 525 MVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 584
           MVK+L+G ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               FLLG
Sbjct: 543 MVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG 602

Query: 585 CYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTL 644
           CYNQDSGE+ETCCKIGTGFS+EMLQ L++R S T +  PKA YV   SA PDVWFEPT L
Sbjct: 603 CYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLL 662

Query: 645 FEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704
           FEVLTADLSLSPVYKAG S+Y KG+SLRFPRF+RLRDDK+ E+ATSS Q+VE Y+ QSHV
Sbjct: 663 FEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHV 722

Query: 705 A 705
           +
Sbjct: 723 S 723

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/715 (61%), Positives = 544/715 (76%), Gaps = 27/715 (3%)

Query: 1   MFR-------VVGRPLVELLINKGMSSGK-KQATLARFFSAVQKDDTKEKVNGDVKIIES 52
           MFR       +V RP+   + ++ MS+ + KQ TL  F     + + K+KV+        
Sbjct: 1   MFRLPIIRNWIVQRPVTFKVPSQQMSTKRSKQLTLDGFL----RPNKKQKVD-------- 48

Query: 53  RDNQDEPVTKKFKSSSPVKLQTS--SLSPVKSAGVESGDKPVSPDL-YYSKVPYSDVCNV 109
            +  D  +  +  ++ PVK ++S  +++P KS G      PV   L ++S +P++++C+ 
Sbjct: 49  -EEGDSAMPDETAAAPPVKSESSLSNITPPKSRG--ETLTPVPSKLKFHSNIPFAELCDT 105

Query: 110 FQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXXXXXXXXXXX 169
           FQ IE TSSRL+I  ICS+F   +++ +P++L+P TYLFI++LGPDYEP           
Sbjct: 106 FQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKLGPDYEPGLELGLGESLL 165

Query: 170 MKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHS 229
           +KTISEACGKS+ Q++N+YRE+GDLG+IA++ARNVQPTMFKPKPLTVGEVF NL +IA S
Sbjct: 166 IKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKS 225

Query: 230 QGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGET 289
            GKDSQ+RK  LIK+MLTAC+G EAKFLIRSLESKLRIGLAEKTVLIS+SKA+LT+E   
Sbjct: 226 NGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHE-HN 284

Query: 290 GKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKP 349
           G+EPS E+VEQAE+ IRDAFCQVPNYE++IN  L YGIM L++H +LRPGIPL+PMLAKP
Sbjct: 285 GQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKP 344

Query: 350 TKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFV 409
           TKSI+EVLDRFQG  FT EYKYDGERAQVHL  DG+M+IYSRNGE+MTERYPEI ++ +V
Sbjct: 345 TKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYV 404

Query: 410 ADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNG 469
            DL  TK+ I+D EAVAWD+ Q KILPFQVLSTRKRK VE KDVKVRVCL+AFDI+C N 
Sbjct: 405 KDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLND 464

Query: 470 ERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKML 529
           E  INKS  ERR++L        G+F +A ELTT++ +ELQK+LDQSVKDSCEGLMVKML
Sbjct: 465 EPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKML 524

Query: 530 DGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQD 589
           +G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDL VL               FLLGCYN D
Sbjct: 525 EGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRGKRTGTYGGFLLGCYNLD 584

Query: 590 SGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLT 649
           S EFETCCKIGTGFSDEMLQ LY +   TT++ P    ++DSSA  DVWFEP+ LFEVLT
Sbjct: 585 SEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLT 644

Query: 650 ADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704
           ADLSLSPVYKAG   + KG+SLRFPRFVR+RDDK+V DATSS Q++E Y+ Q+H+
Sbjct: 645 ADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHM 699

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/720 (62%), Positives = 532/720 (73%), Gaps = 43/720 (5%)

Query: 12  LLINKGMSSG----KKQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPVTKKFKSS 67
           LL  + MS+     KKQATLARFF+++ K     K    V++   +++ +  V KK K  
Sbjct: 31  LLYTRTMSNSLEPSKKQATLARFFTSMGK-----KTPPAVEVATKQESPENHVDKKRKVE 85

Query: 68  SPVKLQTSSLSPVKSAGV-ESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRLSIIKIC 126
                    + P +S G  E  + P  PD   S V YS+VCN+FQ+IE TSSRL+IIK+C
Sbjct: 86  ---------VHPSQSVGASEKAESP--PDQTKSTVLYSEVCNLFQQIEETSSRLAIIKLC 134

Query: 127 SEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXXXXXXXXXXXMKTISEACGKSLVQVKN 186
           SEFF R++K+NP ++I   YLFINRLGPDYEP           +KTISEA GKS+ Q+K 
Sbjct: 135 SEFFIRVIKNNPSDIIIVAYLFINRLGPDYEPGLELGLGENLLIKTISEAYGKSIKQIKL 194

Query: 187 RYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRML 246
             +E GDLG IA +ARN+QPTMFKPKPLT+ +VF NL+ IA + GKDSQ RKIKLIK+ML
Sbjct: 195 ELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQML 254

Query: 247 TACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEG--ETGKEP-------SMEL 297
           +A +G+EAKFLIRSLESKLRIGLAEKTVLISLSKALL +E   E G+         SM+L
Sbjct: 255 SASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDL 314

Query: 298 VEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVL 357
           +EQAEAK+R+A CQVPNYEIVIN CL  GI+ +DK C LRPGIPLKPMLAKPTK+ITEVL
Sbjct: 315 IEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVL 374

Query: 358 DRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVA------- 410
           + FQG+ F SEYKYDGERAQVHLLE G MRIYSRNGENMTERYPE+ ++DF+        
Sbjct: 375 NAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITN 434

Query: 411 ------DLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDI 464
                  ++  K +ILDCE VAWD  Q+KILPFQVL+TRKRK+V+ KDVKVRVCLFAFD+
Sbjct: 435 DQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDL 494

Query: 465 ICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGL 524
           +  N E  INKSLRER+E+L +VT  V GEFQYA  L TS ++ELQ FLDQ+VK+SCEGL
Sbjct: 495 LYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGL 554

Query: 525 MVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 584
           MVKMLDG ESHYEPSKRSRNWLKLKKDYLDGVGDSLDL V+               FLLG
Sbjct: 555 MVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLG 614

Query: 585 CYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTL 644
           CYN+D+ EFETCCKIGTGFSDEML  L+     T +D P  TY++DSSAEPDVWF+   L
Sbjct: 615 CYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVL 674

Query: 645 FEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704
           FEVLTADLSLSPVYKAG S YDKG+SLRFPRF+R+R+DK V D T+S  I+E Y+ QSH+
Sbjct: 675 FEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHI 734

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/696 (61%), Positives = 509/696 (73%), Gaps = 12/696 (1%)

Query: 18  MSSGKKQATLARFFSAVQKDDTKEKVNGDVK----------IIESRDNQDEPVTKKFKSS 67
           MS+ KKQATL RFF+A+++          VK             +   QD  V       
Sbjct: 1   MSAPKKQATLGRFFTALKRPQDGATAAATVKKSKVEAAECLAAPAGHEQDAEVKNSLPEL 60

Query: 68  SPVKLQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRLSIIKICS 127
           +        L    SA   +   PV P    S V Y+D+C VF+ +E TSSRLSI K+C+
Sbjct: 61  ADKPAPGGVLPQAASAVPRAQSSPVKPAASTS-VMYADLCAVFEAVEATSSRLSITKLCA 119

Query: 128 EFFSRIMKDNPQNLIPTTYLFINRLGPDYEPXXXXXXXXXXXMKTISEACGKSLVQVKNR 187
           +F   ++K +P +LIP TYLFINRLGPDYEP           +KTIS+ACGKS  QV++ 
Sbjct: 120 DFMYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKTISDACGKSAAQVRSS 179

Query: 188 YREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLT 247
           YRE GDLG +A +AR VQPTMFKPKPLTV +VF  L+AIA ++GKDSQ +KI+LIK+MLT
Sbjct: 180 YRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLT 239

Query: 248 ACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVEQAEAKIRD 307
           AC+G+EAK+LIRSLESKLRIGLAEKTVL++LSKA+LT+E + GKEPS E V+ AEA +RD
Sbjct: 240 ACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHD-GKEPSPEQVDAAEALVRD 298

Query: 308 AFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTS 367
            FCQVPNYE++INA L YGIM L +HC L PGIPLKPMLAKPTKSITEVLDRFQGQ FT 
Sbjct: 299 TFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTC 358

Query: 368 EYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHTKTLILDCEAVAW 427
           EYKYDGERAQVHL+EDGT+RIYSRN ENMTERYPEI    F+A+ + T++LI+DCEAVAW
Sbjct: 359 EYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAW 418

Query: 428 DKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQV 487
           D  +QKILPFQVLSTRKRK VE KDVKVRVCLFAFD++  NGE  +  SL +RR+ L  V
Sbjct: 419 DNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSV 478

Query: 488 TKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLK 547
            K V GE Q+A E+TT  + ELQ +L+QSV  SCEGLMVKMLDG ES YEPSKRSRNWLK
Sbjct: 479 LKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLK 538

Query: 548 LKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEFETCCKIGTGFSDEM 607
           LKKDYL+GVGDSLDL VL               FLLGCYN D  EFETCCKIGTGFS+E+
Sbjct: 539 LKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLEEFETCCKIGTGFSEEV 598

Query: 608 LQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDK 667
           LQ L+ +   T +  P+    +D S+ PDVWFEP  LFEVLTADLSLSPVYKAG   Y K
Sbjct: 599 LQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTADLSLSPVYKAGRDVYGK 658

Query: 668 GVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSH 703
           G+SLRFPRF+R+R+DKSV DATSS QIVE YQ Q++
Sbjct: 659 GISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/692 (58%), Positives = 507/692 (73%), Gaps = 19/692 (2%)

Query: 21  GKKQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPVTKKFKSSS------PVKLQT 74
            KKQ TLARFF+  +  D +++ +  VK       Q +    K +         P ++ T
Sbjct: 38  SKKQVTLARFFAKREPKDEEKQSSSPVKEQVQIQGQPQQEQVKIQPQEQKQIVVPQEVTT 97

Query: 75  SSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRLSIIKICSEFFSRIM 134
           S+ +P  +       KP +     S +PY+D+C +F+ IE  SSRL+I  +C+ FFSR +
Sbjct: 98  STQTPRPT----KKSKPAT-----SSLPYADLCQLFETIESESSRLTITNLCTAFFSRTL 148

Query: 135 KDNPQNLIPTTYLFINRLGPDYEPXXXXXXXXXXXMKTISEACGKSLVQVKNRYREMGDL 194
           + +P  L+P TYL IN+LGPDY             +K I  ACG S  Q+K +YR++GDL
Sbjct: 149 QLDPSLLVPVTYLCINKLGPDYS-GVELGLGEGLLLKAIGSACGVSQQQLKLQYRKLGDL 207

Query: 195 GQIALEARNVQPT--MFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLTACEGV 252
           GQ+A+  R +QPT  MFK +PLT+ +VF+ L  IA SQGKDSQ +KI +IKR+LT+C+GV
Sbjct: 208 GQLAMSTRVLQPTITMFKLEPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGV 267

Query: 253 EAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVEQAEAKIRDAFCQV 312
           EAKFLIRSLESKLRIGLAEKTVL SL++AL+ +E +       +    AE  I+D+FCQ+
Sbjct: 268 EAKFLIRSLESKLRIGLAEKTVLTSLARALVIHE-KGNDNIQDDDYSNAEQIIKDSFCQI 326

Query: 313 PNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYD 372
           PNYEI+I   L YG+ +L  H +L PGIPLKPMLAKPTKSI+EVLD FQ   FTSEYKYD
Sbjct: 327 PNYEIIITTSLQYGVSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYD 386

Query: 373 GERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHTKTLILDCEAVAWDKVQQ 432
           GERAQVHLL DG+MRIYSRNGE+MT+RYPE++I+D++ D   T  LILDCEAVAWD   Q
Sbjct: 387 GERAQVHLLPDGSMRIYSRNGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQ 446

Query: 433 KILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVA 492
           KILPFQVLSTRKRK V+ KD+KVRVCLFAFDI+ HN +  IN +LRERR++L  +TKP  
Sbjct: 447 KILPFQVLSTRKRKSVDLKDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCP 506

Query: 493 GEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDY 552
           G+FQ+A ELTTS+++ELQ FLD+++KDSCEGLMVK LDG +SHYEPSKRSRNWLKLKKDY
Sbjct: 507 GQFQFATELTTSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDY 566

Query: 553 LDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEFETCCKIGTGFSDEMLQQLY 612
           L G+GDSLDLCVL               FLL CYNQD+ EFETCCKIGTGFSDEMLQ LY
Sbjct: 567 LQGMGDSLDLCVLGAYYGRGKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLY 626

Query: 613 ERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLR 672
               +T ++ P+A +VFDSSAEPDVWF PT +FEVLTADLSLSP+YKAG++ Y KG+SLR
Sbjct: 627 NGLKETAIESPRANFVFDSSAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLR 686

Query: 673 FPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704
           FPRF+R+R DKSV DATSS Q+++ Y++QSH+
Sbjct: 687 FPRFIRIRTDKSVNDATSSEQVIDFYENQSHL 718

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  105 bits (263), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 104/422 (24%), Positives = 175/422 (41%), Gaps = 69/422 (16%)

Query: 342 LKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY 400
            +P LAK      EVL R     FT E K DGER Q+H ++ G  ++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 401 PE----ISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVR 456
            +     +I  ++   E  K  ILD E V++DK +  ILPF ++ +     ++   ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 457 VC---LFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFL 513
           +C      FD++  NG    N  L +R+E L+ +  P     +          E ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 514 DQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXX 573
             ++    EG+++K  D   S Y    R+ +W+K+K +YL+  G++LDL V+        
Sbjct: 444 QAAISVGSEGIVLKKYD---SLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGRDPGKKD 500

Query: 574 XXXXXXXFL----------------LGCYNQDS---------------GEFETCCKIGTG 602
                   L                L   + DS                +F + C I  G
Sbjct: 501 SLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISFCVIANG 560

Query: 603 FSDEMLQQLYER----FSKTTLDGPKATYVFDSSAEPDVWFEP--TTLFEV----LTADL 652
            S+E  +++  +    + K + + P   Y+   +  P  W  P  + + EV    L  + 
Sbjct: 561 ISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVKARSLENNE 620

Query: 653 SLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIV----------ELYQDQS 702
           +L   +K G + Y  G   R     R+R DK   D  + + +V          ELY + S
Sbjct: 621 ALRDKFKTGYTLY--GAYCR-----RIRTDKDFNDCYTFSDLVIATNKKRSSSELYGNHS 673

Query: 703 HV 704
           H+
Sbjct: 674 HI 675

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 100/407 (24%), Positives = 168/407 (41%), Gaps = 66/407 (16%)

Query: 336 LRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGE 394
           +R G    P +A+  K   E +    G  F  E K DG+R QVH ++ G ++  +SRNG 
Sbjct: 288 VRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGI 347

Query: 395 NMTERYPEISIRDFVAD----LEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEA 450
           N T  Y E S +  +++    +E  K  ILD E V++DK  Q ILPF +  +     V  
Sbjct: 348 NYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNF 407

Query: 451 KDV-----KVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSS 505
           +         R     FD++  NG+   N+ + +R+E L ++  P             S 
Sbjct: 408 ETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSD 467

Query: 506 VEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVL 565
            E +   L  +V    EG+++K      S Y   KR  +W+K+K +YL+  G+++DL V+
Sbjct: 468 AEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVI 524

Query: 566 XXXXXXXXXXXXXXXFLLGCYNQDSGE----------------------------FETCC 597
                          F+      D  E                            F + C
Sbjct: 525 ------GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISFC 578

Query: 598 KIGTGFSDEMLQQLYERFSKTTL-----DGPKATYVFDSSAEPDVWFEP--TTLFEV--- 647
            I  G S+E  +++ +R ++          P   +V   +  P  W +P  + + EV   
Sbjct: 579 SIANGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKAR 637

Query: 648 -LTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQ 693
            +  + S S +YK G++ Y+           R+R DK+   A++ A+
Sbjct: 638 SIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAE 677

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 99.8 bits (247), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 115/238 (48%), Gaps = 11/238 (4%)

Query: 336 LRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGE 394
           ++ G    P LAK      + +       F  E K DGER Q+H +  G T++ +SR+G 
Sbjct: 269 IKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHGT 328

Query: 395 NMTERYPEI----SIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEA 450
           + T  Y       +I  F+   ++ K  +LD E V +D   +K+LPF ++ +     +  
Sbjct: 329 DYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLNK 388

Query: 451 KDV---KVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVE 507
           KD+           FDI+  NG   I+  L +R+E L  V  P     +    +  +   
Sbjct: 389 KDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDSI 448

Query: 508 ELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVL 565
           +++K LD ++    EG+++K      S Y P+ R  NW+K+K +YL+  G+++DL V+
Sbjct: 449 QIKKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLIVI 503

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 135/292 (46%), Gaps = 13/292 (4%)

Query: 282 LLTNEGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIP 341
           LL N    G E  +      +A+  D    V + E V     D      ++  ++  G+ 
Sbjct: 211 LLKNRPLGGHEHKLLNCWHPDAQ--DYLSVVSDLETVAKRLWDPSQRLGNQDLKINIGLA 268

Query: 342 LKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERY 400
             P LA       + +    G  F  E K DGER Q+H    G+ ++ YSR   + T  Y
Sbjct: 269 FAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYTYLY 328

Query: 401 PEI----SIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVR 456
                  ++ +F+   ++ K  +LDCE V +D   + +LPF ++ +  +  +    +  +
Sbjct: 329 GNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGIDTQ 388

Query: 457 ---VCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFL 513
                L  FD++  NG   ++    +RRE L Q+  P A   +    +  +  + ++K L
Sbjct: 389 GFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIKKSL 448

Query: 514 DQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVL 565
           ++++    EG+++K  D   S Y  + RS +W+K+K +YL+  G+++DL ++
Sbjct: 449 EKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLM 497

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 95/398 (23%), Positives = 169/398 (42%), Gaps = 45/398 (11%)

Query: 339 GIPLKPMLAKPTK-SITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENM 396
           G+P  P LAK    S  +V  R +   +  E K DGER Q+H ++ G  ++ +SR G + 
Sbjct: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDY 311

Query: 397 TERYPEI----SIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKD 452
           T  Y E     ++  ++      +  +LD E +++D  +  +LPF ++ +  R  + A+ 
Sbjct: 312 TYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEG 371

Query: 453 V---KVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEEL 509
           +     R      D +  NG   IN  L  R++ L+ +  P     +    +       +
Sbjct: 372 ILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSI 431

Query: 510 QKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXX 569
           +  L++++    EG+++K     +S YE   R+ NW+K+K +YL+  G++LDL V+    
Sbjct: 432 KSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDP 488

Query: 570 XXXXXXXXXXXFLLG-----------CYNQDSGE----------FETCCKIGTGFSDEML 608
                       L G             N DS E          F + C I  G S E  
Sbjct: 489 GKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEF 548

Query: 609 QQLYERFS---KTTLDGPKATYVFDSSAEPDVWFEP--TTLFEVLTADLSLSPVYKAGAS 663
           +Q+  + +   K T D      +   S  P+ W  P  + + EV    L  +   ++   
Sbjct: 549 KQIERKTAGKWKNTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNT---ESSGR 605

Query: 664 TYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQ 701
            +  G +L      R+R+DK   + T    + EL+Q++
Sbjct: 606 KFKVGCTLHGGYCRRIREDK---NWTECYTLYELWQER 640

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 101/435 (23%), Positives = 174/435 (40%), Gaps = 47/435 (10%)

Query: 306 RDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTF 365
           +D    V + ++V +   D  +   +    ++ G    P LAK      E + R     F
Sbjct: 218 QDYLSVVSDLKVVASKLYDPRVRLKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDF 277

Query: 366 TSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY----PEISIRDFVADLEHTKTLIL 420
             E K DGER QVH +  G ++R YSR G + T  Y       +I   +   ++ +  +L
Sbjct: 278 LVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVL 337

Query: 421 DCEAVAWDKVQQKILPFQVLSTRKRKDVE---AKDVKVRVCLFAFDIICHNGERQINKSL 477
           D E V +D  ++ ILPF ++    +  +      +V        FD++  NG       L
Sbjct: 338 DGEMVTFDARRKVILPFGLVKGSAKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPL 397

Query: 478 RERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYE 537
            +R+E L  +  PV    +        +VE ++K L+ ++    EG+++K  +   S Y 
Sbjct: 398 HQRKEYLESILTPVKNVVEMVRTSRCYNVESIKKSLEVAISLGSEGVVLKYYN---SSYN 454

Query: 538 PSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFL-------------LG 584
            + R+ NW+K+K +YL+  G++LDL ++                L              G
Sbjct: 455 VASRNNNWIKVKPEYLEEFGENLDLVIIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSG 514

Query: 585 CYNQDSGE-----------FETCCKIGTGFSDEMLQQLYER----FSKTTLDGPKATYVF 629
             N    E             + C +  G S E  +++  +    + KT+   P A+   
Sbjct: 515 IANNSKNENILYSQKKVKKILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFE 574

Query: 630 DSSAEPDVWFEP--TTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVED 687
             S  P  W EP  + + E+ +  L  +   +     Y    +L      R+R DK   D
Sbjct: 575 FGSKIPAEWIEPNESIVLEIKSRSLDNT---ETNMQKYATSCTLYGGYCKRIRFDK---D 628

Query: 688 ATSSAQIVELYQDQS 702
            T    + ELY  +S
Sbjct: 629 WTDCFTLNELYDSRS 643

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 93.6 bits (231), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 97/407 (23%), Positives = 171/407 (42%), Gaps = 51/407 (12%)

Query: 339 GIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMT 397
           G    P LAK      E +       F  E K DGER QVH ++ G  +R  SR G + T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 398 ERYPEI----SIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDV 453
           + Y E     ++ +++    + +  +LD E + +D  +  +LPF ++ +  R+ +  + +
Sbjct: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387

Query: 454 ---KVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQ 510
                R  L   D++  NG   I   L +R+E L +V KP     +    +  S    ++
Sbjct: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447

Query: 511 KFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXX 570
           K L++S+    EG+++K     ++ YE   R+  W+K+K +YL+  G++LDL ++     
Sbjct: 448 KSLEKSISMGSEGIVLKSY---KARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPG 504

Query: 571 XXXXXXXXXXFLLG--------------CYNQDS-GE-------------FETCCKIGTG 602
                        G                N DS G+             F + C I  G
Sbjct: 505 KKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANG 564

Query: 603 FSDEMLQQLYER----FSKTTLDGPKATYVFDSSAEPDVWFEP--TTLFEVLTADLSLSP 656
            S +  +++  +    + K+    P A  +   S  P+ W +P  + + EV    L  + 
Sbjct: 565 ISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNT- 623

Query: 657 VYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSH 703
             ++    +  G +L      R+RDDK   D T      EL+Q++ H
Sbjct: 624 --ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 93.2 bits (230), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 88/380 (23%), Positives = 164/380 (43%), Gaps = 37/380 (9%)

Query: 342 LKPMLAKPTK-SITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTER 399
            +P LAK T  S   V  + Q   F  E K DGER Q+H +  G  ++  SR G + +  
Sbjct: 247 FEPQLAKRTHLSYERVASKLQ-HDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYL 305

Query: 400 YPEIS----IRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKV 455
           Y E S    I   +    + K  ILD E + +D  +  +LPF ++ +     ++++   +
Sbjct: 306 YGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGI 365

Query: 456 ------RVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEEL 509
                 +    AFD++  NG+   N +L  R++ L ++  PV    +    +   + E +
Sbjct: 366 APTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAI 425

Query: 510 QKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXX 569
           +  L+Q++    EG+++K L    S Y    R+ +W+K+K +YL+  G+++DL ++    
Sbjct: 426 KDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLII---- 478

Query: 570 XXXXXXXXXXXFLLGCYNQDSGE------FETCCKIGTGFSDEMLQQL----YERFSKTT 619
                      F  G    D  E      F + C I  G S+E  + +    + ++   +
Sbjct: 479 --GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFS 536

Query: 620 LDGPKATYVFDSSAEPDVWFEP--TTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFV 677
            D P    +   +  P  W  P  + + EV    +      ++    Y  G +L F    
Sbjct: 537 EDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCK 593

Query: 678 RLRDDKSVEDATSSAQIVEL 697
           ++R DK  +   S ++  ++
Sbjct: 594 QIRYDKDWKTVASFSEFEDM 613

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 89/383 (23%), Positives = 159/383 (41%), Gaps = 59/383 (15%)

Query: 306 RDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTF 365
           +D    + + ++V +   D  +   D    ++ G    P LAK      E + R     F
Sbjct: 218 QDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDF 277

Query: 366 TSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY----PEISIRDFVADLEHTKTLIL 420
             E K DGER QVH +  G +++ +SR G + T  Y       +I   +   +  K  +L
Sbjct: 278 LVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVL 337

Query: 421 DCEAVAWDKVQQKILPFQVLSTRKRKDVE---AKDVKVRVCLFAFDIICHNGERQINKSL 477
           D E V +D  ++ ILPF ++    ++ +      +V        FD++  NG       L
Sbjct: 338 DGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPL 397

Query: 478 RERRELLAQVTKPVAGEFQYAVELTTSS----VEELQKFLDQSVKDSCEGLMVKMLDGPE 533
            +R++ L  +  P+       VE+  SS    VE ++K L+ ++    EG+++K  +   
Sbjct: 398 HQRKQYLNSILSPLKN----IVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN--- 450

Query: 534 SHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEF 593
           S Y  + R+ NW+K+K +YL+  G++LDL V+               F+LG    D  E+
Sbjct: 451 SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDSFMLGLLVLDEEEY 504

Query: 594 E------------------------------TCCKIGTGFSDEMLQQLYER----FSKTT 619
           +                              + C I  G S E  +++  +    + +T+
Sbjct: 505 KKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEEFKEIDRKTRGHWKRTS 564

Query: 620 LDGPKATYVFDSSAEPDVWFEPT 642
              P A+ +   S  P  W +P+
Sbjct: 565 EVAPPASILEFGSKIPAEWIDPS 587

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 118/238 (49%), Gaps = 11/238 (4%)

Query: 336 LRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGT-MRIYSRNGE 394
           L+ G    P LAK      E + +  G  F+ E K DGER Q+H ++ G  ++  SR G 
Sbjct: 249 LKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGT 308

Query: 395 NMTERY----PEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEA 450
           + T  Y       +I  ++   E+ K  ILD E V +D+ +Q ILPF ++ +  +  +  
Sbjct: 309 DYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSK 368

Query: 451 KDV---KVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVE 507
           + +          AFD++  NG   ++  L +R++ L+++     G          +++E
Sbjct: 369 ESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLE 428

Query: 508 ELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVL 565
            + K L  ++    EG+++K L+   S Y  + R+ +W+K+K  YL   G+++DL ++
Sbjct: 429 SITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQFGENMDLIII 483

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 98/429 (22%), Positives = 174/429 (40%), Gaps = 57/429 (13%)

Query: 310 CQVPNYEIVINACLDYGIM---------ELDKH-CRLRPGIPLKPMLAKPTKSITEVLDR 359
           C  P+ +I +    D  I+          LDK    +  G    P LAK      E +  
Sbjct: 223 CWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICS 282

Query: 360 FQGQTFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEISIRDFVADLEHTKTL 418
                F  E K DGER Q+H +  G+ ++  SR G + +  Y +   R  ++     K+ 
Sbjct: 283 KLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSD 342

Query: 419 ILDC----EAVAWDKVQQKILPFQVLSTRK-----RKDVEAKDVKVRVCLFAFDIICHNG 469
           + DC    E V++DK ++ ILPF ++ +         +V  ++   R     FD++  NG
Sbjct: 343 VRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNG 402

Query: 470 ERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKML 529
                  L  R+E L ++  PV    +    +     + ++ F+ ++++   EG++VK  
Sbjct: 403 VSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQ- 461

Query: 530 DGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQD 589
               S YE   R+ +W+K+K +Y + +G+++DL V+                + G    D
Sbjct: 462 --ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVI------GRDPGKKDSLMCGLLVSD 513

Query: 590 S-------GEFE------------TCCKIGTGFSDEMLQQLYERFSKTTLD----GPKAT 626
           S       G  E            + C +  G SDE  +++  +   + +      P  +
Sbjct: 514 SEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLS 573

Query: 627 YVFDSSAEPDVWFEP--TTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKS 684
            +   S  P  W +P  + + EV    +  S   +  +  Y  G +L      R+R+DK 
Sbjct: 574 LLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSKRYRAGSTLHSAYCRRIRNDKD 630

Query: 685 VEDATSSAQ 693
               TS AQ
Sbjct: 631 WTTCTSVAQ 639

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 120/260 (46%), Gaps = 17/260 (6%)

Query: 316 EIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGER 375
           E + N  +  G  EL     +  G    P LAK      E +     Q F  E K DGER
Sbjct: 257 ETLWNPTMRLGKNELS----INIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312

Query: 376 AQVHLLEDGT-MRIYSRNGENMTERYPEISIRDFVADLEHTKTLILDC----EAVAWDKV 430
            Q+H +E G  +R  SR G + T  Y +      ++     K  + DC    E V++DK 
Sbjct: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372

Query: 431 QQKILPFQVLSTRKRKDVEAKDVKV-----RVCLFAFDIICHNGERQINKSLRERRELLA 485
           +  +LPF ++ +   +++   D KV     R     FD++  NG       L  R+  L 
Sbjct: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432

Query: 486 QVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNW 545
            +  PVA   +   ++  S    ++  L+++++   EG+++K    P   YE   R+ +W
Sbjct: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSP---YEIGARNDSW 489

Query: 546 LKLKKDYLDGVGDSLDLCVL 565
           +K+K +Y + +G+++DL V+
Sbjct: 490 IKIKPEYFEELGETMDLVVI 509

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 117/243 (48%), Gaps = 21/243 (8%)

Query: 336 LRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGE 394
           + PG    P LAK      E +       F  E K DGER Q+H  + G  ++ +SR G 
Sbjct: 256 INPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGT 315

Query: 395 NMTERYPEISIRD-FVADL----EHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVE 449
           + T  Y E SI D F+       +  K  ILD E + +DK Q  ILPF ++ +  R  + 
Sbjct: 316 DYTYLYGE-SIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374

Query: 450 AKDVK---VRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTS-- 504
              +     +     FD+I  NG    N  L  R+E L  +  P      + +EL +S  
Sbjct: 375 KDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEP----HIIELLSSYH 430

Query: 505 --SVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDL 562
             + + ++K L+ ++    EG+++K  D   S Y  + R+ +W+K+K +YL+  G+++DL
Sbjct: 431 RFNEDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDL 487

Query: 563 CVL 565
            V+
Sbjct: 488 IVI 490

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 102/444 (22%), Positives = 178/444 (40%), Gaps = 66/444 (14%)

Query: 306 RDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTF 365
           +D    V + ++V +   D  +   +    ++ G    P LAK      E + R     F
Sbjct: 218 QDYLSVVSDLKVVTSKLYDPRVRLKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDF 277

Query: 366 TSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY----PEISIRDFVADLEHTKTLIL 420
             E K DGER QVH +  G +++ +SR G + T  Y       +I  ++      K  +L
Sbjct: 278 LIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVL 337

Query: 421 DCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVK---VRVCLFAFDIICHNGERQINKSL 477
           D E V +D  ++ ILPF ++    +  +   D+     R     FD++  N        L
Sbjct: 338 DGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPL 397

Query: 478 RERRELLAQVTKPVAGEFQYAVELTTSS----VEELQKFLDQSVKDSCEGLMVKMLDGPE 533
            +R++ L+ +  P    F+  VE+  S+    V+ ++  L+ ++    EG+++K  +   
Sbjct: 398 HQRKKYLSSILTP----FKNVVEIVQSTRCYDVQSVKNSLEVAISLGSEGVVLKYYN--- 450

Query: 534 SHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEF 593
           S Y  + R+ NW+K+K +YL+  G++LDL ++               F+LG    D  E 
Sbjct: 451 SSYNIASRNYNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGLLVIDEREM 504

Query: 594 E--------------------------------TCCKIGTGFSDEMLQQLYER----FSK 617
           E                                + C +  G S E  +++  R    + +
Sbjct: 505 EERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCSVANGISHEEFKEINRRTRGHWKR 564

Query: 618 TTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFV 677
           T+   P +   F S   P  W EP+    +     SL    +     Y    +L      
Sbjct: 565 TSDFSPPSILQFGSRI-PAEWIEPSDSIVLEIKSRSLDNT-ETSIRRYATSCTLYGGYCR 622

Query: 678 RLRDDKSVEDATSSAQIVELYQDQ 701
           R+R DK   D  + AQ   LY+D+
Sbjct: 623 RIRYDKDWTDCYTLAQ---LYEDR 643

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 104/463 (22%), Positives = 184/463 (39%), Gaps = 58/463 (12%)

Query: 282 LLTNEGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIP 341
           LL N    G+E   +L+       +D    V +  +V +   D  I   +    ++ G  
Sbjct: 196 LLKNRVIGGQE--HKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFA 253

Query: 342 LKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY 400
             P LAK      E +       F  E K DGER QVH +  G +++ +SR G + T  Y
Sbjct: 254 FAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLY 313

Query: 401 P----EISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVK-- 454
                  +I  ++   +  K  +LD E V +D +++ ILPF ++    ++ +   D+   
Sbjct: 314 GVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNN 373

Query: 455 -VRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFL 513
                   FD++  NG       L +R+E L+ +  P     +          E ++K L
Sbjct: 374 DFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSL 433

Query: 514 DQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXXXXXXX 573
           + ++    EG+++K      S Y  + R+ NW+K+K +YL+  G++LDL ++        
Sbjct: 434 EVAISLGSEGVVLKHY---SSSYNVASRNNNWIKVKPEYLEEFGENLDLIII------GR 484

Query: 574 XXXXXXXFLLGCY---NQDSGEFE----------------------------TCCKIGTG 602
                  F+LG      Q++G+ +                            + C I  G
Sbjct: 485 DSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANG 544

Query: 603 FSDEMLQQLYER----FSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVY 658
            S E  +++  +    + KT+   P  + +   S  P  W EP+    +     SL    
Sbjct: 545 ISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNT- 603

Query: 659 KAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQ 701
           +     Y    +L      R+R DK   D T    + ELY+++
Sbjct: 604 ETNMQKYATNCTLYGGYCRRIRYDK---DWTECYTLDELYENR 643

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 103/409 (25%), Positives = 174/409 (42%), Gaps = 61/409 (14%)

Query: 339 GIPLKPMLAKP-TKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENM 396
           G    P LAK  + S  ++  + +   F  E K DGER Q+H ++ G  ++  SR G + 
Sbjct: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRRGVDY 309

Query: 397 TERYPEI----SIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKD 452
           T  Y E     +I  ++      K  +LD E V +D+ Q  +LPF ++ +     +  ++
Sbjct: 310 TYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEE 369

Query: 453 VK---VRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEE- 508
           +        L  FD++  NG   +   L +R++ LA V +P     Q  V  T  S E  
Sbjct: 370 ISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQ-IVNFTRCSNENI 428

Query: 509 LQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLXXX 568
           ++K L+ ++    EG+++K  +   S Y    R+ +W+K+K +YL+  G+++DL V+   
Sbjct: 429 IRKSLEHAISVGSEGIVLKNYN---SRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRD 485

Query: 569 XXXXXXXXXXXXFL------------LGCYN--QDSGEFE------------TCCKIGTG 602
                        L             G  N   D  ++E            + C I  G
Sbjct: 486 SAKKDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCMIANG 545

Query: 603 FSDEMLQQLYER---FSKTTLDGPKATYVFDSSAE-PDVWFEP--TTLFEVLTADL---- 652
            S    +++Y +   F K T + P    + +   + P  W EP  + + E+    L    
Sbjct: 546 ISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNTE 605

Query: 653 SLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQ 701
           S    +KAG + Y  G   R     R+RDD    D  SS  + EL +D+
Sbjct: 606 SSCKRFKAGCTLY--GGYCR-----RIRDDV---DWKSSFSLAELRRDR 644

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 122/269 (45%), Gaps = 13/269 (4%)

Query: 306 RDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTF 365
           +D    V + + V N   D  +   +    +  G P  P  AK      E +       F
Sbjct: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293

Query: 366 TSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEISIRD-----FVADLEHTKTLI 419
             E K DGER Q+H  + G  +   SR G + T  Y E SI+D     ++    + +  +
Sbjct: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGE-SIKDGTVSKYLHLDNNVQNCV 352

Query: 420 LDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVK---VRVCLFAFDIICHNGERQINKS 476
           LD E V +DK +  +LPF ++ +  R  +  + V     R  L  FD++  NG   +N  
Sbjct: 353 LDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIP 412

Query: 477 LRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHY 536
           L +R+  L ++  P     +       S    ++  L+ ++    EG+++K  +   S Y
Sbjct: 413 LYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRY 469

Query: 537 EPSKRSRNWLKLKKDYLDGVGDSLDLCVL 565
             + R+ +W+K+K +YL+  G+++DL V+
Sbjct: 470 TVASRNDDWIKVKPEYLEQFGENMDLIVI 498

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 110/224 (49%), Gaps = 12/224 (5%)

Query: 350 TKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEI----S 404
           T S   +  R +   F  E K DGER Q+H +  G  ++  SR G + +  Y +     +
Sbjct: 285 TYSYDTIARRLKNDFFIEE-KMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGA 343

Query: 405 IRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVK---VRVCLFA 461
           I  ++   +  K  ILD E V +D V+  ILPF ++ +   + +   D++         A
Sbjct: 344 IGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMA 403

Query: 462 FDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSC 521
           FD++  NG       L +R+  L ++  P     +    L  +    ++  L+++++   
Sbjct: 404 FDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGS 463

Query: 522 EGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVL 565
           EG+++K  D   S Y  +KRS +W+K+K +YL+  G+++DL V+
Sbjct: 464 EGIILKRFD---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

>TBLA0D01680 Chr4 complement(416752..418764) [2013 bp, 670 aa] {ON}
           Anc_5.523 YDR419W
          Length = 670

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 481 RELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLD 530
           +EL+  +  P +G  +Y   +  +S +ELQ  LD+S+KD+ E  ++  +D
Sbjct: 318 KELVEILNLPESGSLKYIRNMWPNSFKELQDKLDESLKDTMESNILTSID 367

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,277,849
Number of extensions: 2810530
Number of successful extensions: 9201
Number of sequences better than 10.0: 47
Number of HSP's gapped: 9425
Number of HSP's successfully gapped: 47
Length of query: 705
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 588
Effective length of database: 40,065,477
Effective search space: 23558500476
Effective search space used: 23558500476
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)