Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C020307.344ON31131116710.0
ZYRO0F11594g7.344ON30930611731e-162
SAKL0F11242g7.344ON30930511471e-158
KLLA0D12474g7.344ON31230710561e-145
KLTH0H01386g7.344ON30730410411e-142
Suva_10.2997.344ON32031310101e-137
YLR205C (HMX1)7.344ON3173069951e-135
Kwal_56.246247.344ON3073059871e-134
Smik_12.2637.344ON3182759781e-132
Skud_12.2687.344ON3183099761e-132
Ecym_47297.344ON3263019181e-123
Kpol_530.367.344ON3113168731e-117
NCAS0E028907.344ON3153158421e-112
NDAI0E045007.344ON3273217851e-103
TPHA0F029207.344ON3203187751e-102
CAGL0A03905g7.344ON2822547389e-97
ACL154W7.344ON3192806941e-89
KAFR0L014707.344ON3003065956e-75
KNAG0B026407.344ON3023095818e-73
KAFR0D040201.65ON637250712.1
TDEL0D026404.185ON80263712.2
CAGL0K09988g8.216ON196110692.3
Kwal_55.21046na 1ON374112693.0
NDAI0F046601.127ON1982114694.1
Kwal_26.82692.581ON35881667.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C02030
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   648   0.0  
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   456   e-162
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   446   e-158
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   411   e-145
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   405   e-142
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   393   e-137
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   387   e-135
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   384   e-134
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   381   e-132
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   380   e-132
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   358   e-123
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   340   e-117
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   328   e-112
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   306   e-103
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   303   e-102
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   288   9e-97
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   271   1e-89
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   233   6e-75
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   228   8e-73
KAFR0D04020 Chr4 complement(792970..794883) [1914 bp, 637 aa] {O...    32   2.1  
TDEL0D02640 Chr4 complement(502950..505358) [2409 bp, 802 aa] {O...    32   2.2  
CAGL0K09988g Chr11 (977846..978436) [591 bp, 196 aa] {ON} simila...    31   2.3  
Kwal_55.21046 s55 complement(664120..665244) [1125 bp, 374 aa] {...    31   3.0  
NDAI0F04660 Chr6 complement(1125701..1131649) [5949 bp, 1982 aa]...    31   4.1  
Kwal_26.8269 s26 (715282..716358) [1077 bp, 358 aa] {ON} YMR028W...    30   7.6  

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/311 (100%), Positives = 311/311 (100%)

Query: 1   MTSVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHI 60
           MTSVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHI
Sbjct: 1   MTSVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHI 60

Query: 61  FDAVEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLR 120
           FDAVEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLR
Sbjct: 61  FDAVEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLR 120

Query: 121 NFVEHQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFP 180
           NFVEHQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFP
Sbjct: 121 NFVEHQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFP 180

Query: 181 KFEYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSS 240
           KFEYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSS
Sbjct: 181 KFEYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSS 240

Query: 241 QIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQF 300
           QIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQF
Sbjct: 241 QIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQF 300

Query: 301 LVAYIVLRKFI 311
           LVAYIVLRKFI
Sbjct: 301 LVAYIVLRKFI 311

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  456 bits (1173), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 211/306 (68%), Positives = 261/306 (85%), Gaps = 1/306 (0%)

Query: 7   TIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQ 66
           TIPAPTDVGALANRINFHTRDAHNK+NAYMSVRLAFALKHG+I+RQGILA+Y+IF A+EQ
Sbjct: 3   TIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQ 62

Query: 67  ELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFV-EH 125
           ELDR+++  +N++E QMQ+VL +FW+ +FRRT+RIF+DL +LYSPE+    SL  F+   
Sbjct: 63  ELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSG 122

Query: 126 QPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYL 185
             LAP LQ+FVDSIH  VQ++ CTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKF++L
Sbjct: 123 NHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHL 182

Query: 186 TPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDW 245
           +P+ELV RGTNFFTFS+EGS+AENKLRW+YK GYELATR EL+E QK +I+ VSS+IF W
Sbjct: 183 SPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQW 242

Query: 246 NMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQFLVAYI 305
           NM+ I EIGE+NR ELM   SF+LLTYL EEWK++  LSK  KD +++  +++QFL+ Y+
Sbjct: 243 NMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDLLVLAVLVVQFLIVYL 302

Query: 306 VLRKFI 311
           VLR+ +
Sbjct: 303 VLRRIL 308

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  446 bits (1147), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 257/305 (84%)

Query: 5   AKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAV 64
           A TIP+PTDVGALANRINFHTRD+HNK+NA MSV+LAFA+KHG IYRQGILAFY+IF AV
Sbjct: 3   ATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAV 62

Query: 65  EQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVE 124
           EQE+D LL +     E Q Q +L QFW EEFRR+N IF+DLE+LYS EYS    L  F++
Sbjct: 63  EQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLD 122

Query: 125 HQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEY 184
              L PQ Q+FV+ IH TV++   TILAYCHVLYLALFAGGK+M+SN+YRHTGLFPKF++
Sbjct: 123 DNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQH 182

Query: 185 LTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFD 244
           LTP+++V RGTNFFTFS+EG+DAE KLRW+YK+GYELATR+EL+E QK  I++VSS+IFD
Sbjct: 183 LTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFD 242

Query: 245 WNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQFLVAY 304
           WNMDVIGE+GE+NRNELM KFSFKL++++ EEWKYS  LSK +K +I+V+  ++QFL+AY
Sbjct: 243 WNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLLAY 302

Query: 305 IVLRK 309
            +LRK
Sbjct: 303 WLLRK 307

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  411 bits (1056), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 246/307 (80%)

Query: 5   AKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAV 64
           A TIP+PTDVGALANRINF TRD HNK+NAYMS+++AFA++HGFIYRQGI+A+Y++F A+
Sbjct: 6   ATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAI 65

Query: 65  EQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVE 124
           EQE+DRLL  P   ++ +++ +L+QFW EEFRR++++  DL+VLY+ EY  SE L+ F++
Sbjct: 66  EQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLD 125

Query: 125 HQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEY 184
              L  +LQ FVD IHS VQ++  TILAYCHVLYLALFAGG+VM+SNLYRH GLFPKF +
Sbjct: 126 GFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGH 185

Query: 185 LTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFD 244
           L+PKELV R TNFFTFS+EG D EN+LRW+YK+GYELATR EL+E++K RI++VS  IF 
Sbjct: 186 LSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEVSQTIFQ 245

Query: 245 WNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQFLVAY 304
            NM+V+ EIGE+NR ELM KFS+KL+++LSEEWKYS  L+   K  I+   I+   +  Y
Sbjct: 246 RNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVY 305

Query: 305 IVLRKFI 311
            +LR+ I
Sbjct: 306 TILRRLI 312

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  405 bits (1041), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 187/304 (61%), Positives = 234/304 (76%)

Query: 7   TIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQ 66
           TIP+PTDVGALANRINFHTRD HNK++  MS + AFA+KHGFIYRQG+LAF+++F A+EQ
Sbjct: 3   TIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQ 62

Query: 67  ELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEHQ 126
           ELDRL  + Q  EE Q + +L QFW EEFRR  RI +DLE+LY+ E+  S SLR F+E  
Sbjct: 63  ELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEET 122

Query: 127 PLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYLT 186
            LAP+LQ FVD +H++++     ILAYCHVLYLALFAGG+VMRS +YR TGLFPKF  LT
Sbjct: 123 TLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNLT 182

Query: 187 PKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDWN 246
            +E+V RGTNFFTFSD G  AEN+LR  YK GYELATRQ L+E QK  IL VS+ IF+WN
Sbjct: 183 TEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWN 242

Query: 247 MDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQFLVAYIV 306
             V+ EIGE+NR ELM K SF+LLT++ EEW+YS  L+++ K  ++   +++Q L+ Y V
Sbjct: 243 TRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYWV 302

Query: 307 LRKF 310
           LRKF
Sbjct: 303 LRKF 306

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  393 bits (1010), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 178/313 (56%), Positives = 242/313 (77%), Gaps = 3/313 (0%)

Query: 2   TSVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIF 61
           TS +  IP+PTD+GALANRINFHTRDAHNK+N +M +++A A++HGFIYRQGILA+Y++F
Sbjct: 5   TSTSTIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVF 64

Query: 62  DAVEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRN 121
           DA+EQE+DRLLND  +++E Q   +L+QFWLE+FRR+ +I+KDL++LYS  +  +ESL  
Sbjct: 65  DAIEQEIDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNE 124

Query: 122 FVEHQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPK 181
           F+      P LQ FVD IH  ++Q+ CTIL+YCHVLYLALFAGGK++RSNLYR  GLFP 
Sbjct: 125 FLATFEKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPN 184

Query: 182 FEYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQ 241
           FE LT KELV +GTNFFTFS+ G   E +L+W+YK+ YELATR EL+E+QK +I+ V+  
Sbjct: 185 FEKLTQKELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEG 244

Query: 242 IFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKR---SKDSIIVMAILI 298
           IFDWN +++ EIGE+NR ELMSKFSFK +TY+ EEW +S   + R   S   +++++I  
Sbjct: 245 IFDWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSITA 304

Query: 299 QFLVAYIVLRKFI 311
            +++ Y V + F+
Sbjct: 305 VWILYYFVRQNFL 317

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  387 bits (995), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 174/306 (56%), Positives = 235/306 (76%), Gaps = 2/306 (0%)

Query: 8   IPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQE 67
           IP+PTDVGALANRINF TRDAHNK+N +M +++A A++HGFIYRQGILA+Y++FDA+EQE
Sbjct: 9   IPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68

Query: 68  LDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEHQP 127
           +DRLLNDP  +EE Q   +L+QFWLE+FRR+ +I+KDL++LYS  +  +ESL  F+    
Sbjct: 69  IDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFQ 128

Query: 128 LAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYLTP 187
             P LQ F+++IH  + ++ CTIL+YCHVLYLALFAGGK++RSNLYR  GLFP FE L+ 
Sbjct: 129 KPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQ 188

Query: 188 KELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDWNM 247
           KELV +GTNFFTFSD G   E +L+W+YK+ YELATR EL+E+QK +I+ V+  IFDWN 
Sbjct: 189 KELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDWNF 248

Query: 248 DVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAIL--IQFLVAYI 305
           +++ EIGE+NR ELM KFSFK +TYL EEW ++   + R     +++ +L  I   V Y 
Sbjct: 249 NIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSIIAIWVLYF 308

Query: 306 VLRKFI 311
           +++ F+
Sbjct: 309 LVKSFL 314

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  384 bits (987), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 176/305 (57%), Positives = 234/305 (76%)

Query: 7   TIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQ 66
           TIP+PTDVGALANRINF+TRD HNK++  MSV+ AFA+KHGFIYRQG+LAF+++F A+EQ
Sbjct: 3   TIPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAIEQ 62

Query: 67  ELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEHQ 126
           E+DRLL + Q  EE Q + +L QFW+  F RT RI++DL++LY+ E+   E L  F++  
Sbjct: 63  EIDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQQN 122

Query: 127 PLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYLT 186
            L P+ Q FVD +H +V+    +ILA+CHVLYLALFAGG+VMRS +YR TGLFPKF  LT
Sbjct: 123 TLPPEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPDLT 182

Query: 187 PKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDWN 246
           P+E+V +GTNFFTFSD+G  AEN+LR +YK GYELATR+ L+E QK  IL+V++  F+WN
Sbjct: 183 PEEVVRKGTNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFEWN 242

Query: 247 MDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQFLVAYIV 306
             VI EIGE+NR ELM K SFKL+++  +EWK++  L++R K  ++    +IQ LV Y +
Sbjct: 243 TRVISEIGEINRQELMGKLSFKLVSFAIDEWKHTEKLTRRQKSIVLATGAVIQILVMYWM 302

Query: 307 LRKFI 311
           LRKF+
Sbjct: 303 LRKFL 307

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  381 bits (978), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 168/275 (61%), Positives = 221/275 (80%)

Query: 6   KTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVE 65
           K IP+PTD+GALANRINFHTRDAHNK+N +M +++A A++HGFIYRQGILA+Y++FDA+E
Sbjct: 7   KIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIE 66

Query: 66  QELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEH 125
           QE+DRLLNDP   +E Q   +L+QFWLE+FRR+ +I+KDL++LYS  +  +ESL  F+  
Sbjct: 67  QEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLAT 126

Query: 126 QPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYL 185
               P LQ FV++IH  +Q++ CTIL+YCHVLYLALFAGGK++RSNLYR  GLFP FE L
Sbjct: 127 FEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKL 186

Query: 186 TPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDW 245
           + KELV +GTNFFTFSD G   E +L+ +YK+ YELATR EL+E+QK +I+ V+  IFDW
Sbjct: 187 SQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDW 246

Query: 246 NMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYS 280
           N +++ EIGE+NR ELM KFSFK +TY+ EEW ++
Sbjct: 247 NFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFN 281

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  380 bits (976), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 174/309 (56%), Positives = 234/309 (75%), Gaps = 2/309 (0%)

Query: 3   SVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFD 62
           S    IP+PTDVGALANRINFHTRDAHNK+N +M +R+A A++HGFIYRQGILA+Y++FD
Sbjct: 4   STNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFD 63

Query: 63  AVEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNF 122
           A+EQE+DRLL+DP  ++E Q   +L+QFWLE+FRR+ +I+KDL++LYS  +  +ESL  F
Sbjct: 64  AIEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEF 123

Query: 123 VEHQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKF 182
           +      P LQ FV+ IH  ++++ CTIL+YCHVLYLALFAGGK++RSNLYR  GLFP F
Sbjct: 124 LAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNF 183

Query: 183 EYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQI 242
           E L+ KELV +GTNFFTFSD G   E +L+ +YK+ YELATR EL+E+QK +I+ V+  I
Sbjct: 184 ERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGI 243

Query: 243 FDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEW--KYSTILSKRSKDSIIVMAILIQF 300
           FDWN  ++ EIGE+NR ELM KFSFK +TY+ EEW     +   K    ++++M  +I  
Sbjct: 244 FDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSIIAV 303

Query: 301 LVAYIVLRK 309
            V Y++++K
Sbjct: 304 WVIYLLVKK 312

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  358 bits (918), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 172/301 (57%), Positives = 215/301 (71%)

Query: 8   IPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQE 67
           IP+PTDVGALANRINF TRD H K +A++  ++A A++HGFIYRQGILAFY+IF AVEQ+
Sbjct: 22  IPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQ 81

Query: 68  LDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEHQP 127
           +DRLL  P   EE Q+  +LRQFW EEFRR+ R+ +DLE  Y  EY     L+ F+    
Sbjct: 82  IDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFE 141

Query: 128 LAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYLTP 187
           L P+LQ FVD I     ++  TILAYCHVLY ALFAGGKVMRSN+YR+ GLFPK + ++ 
Sbjct: 142 LPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGISA 201

Query: 188 KELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDWNM 247
            E    GTNFFTFSD+G D ENKLRW+YK+ YELATR+ L E+QK  I+ VS   F   M
Sbjct: 202 AESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVM 261

Query: 248 DVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQFLVAYIVL 307
           D++GEIGE N+ ELM+ FSFKLLT+LS EW+Y+  LS   K ++ +    I FL+ Y  L
Sbjct: 262 DILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFFINFLMIYFTL 321

Query: 308 R 308
           R
Sbjct: 322 R 322

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  340 bits (873), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 164/316 (51%), Positives = 229/316 (72%), Gaps = 13/316 (4%)

Query: 4   VAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDA 63
           +  TIP+PTDVGALANRINF TRD HNKV+A+M +RLA ALKHGFIYR+G++ FYHIF+ 
Sbjct: 1   MTSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNT 60

Query: 64  VEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEY-SDSESLRNF 122
           +E E+D +LN   N ++ QM+ +L  F+L+EFRR ++I KDLE+LY PE+ +D   L  F
Sbjct: 61  IETEIDLVLN---NQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEF 117

Query: 123 VEHQPL---APQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLF 179
           +        + QLQ+FV  I +   +D CT+LAYCHVLYLALFAGGK+M+SN+ +H G+F
Sbjct: 118 INSDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIF 177

Query: 180 PKFEYLTPKELVIRGTNFFTFSD----EGSDAENKLRWKYKEGYELATRQELSESQKTRI 235
           PKFE+L+ KE++ RGTNF+ F+D    E +D   KLRW YK+ YEL+TR EL E QK  +
Sbjct: 178 PKFEHLSHKEIIARGTNFYQFTDSTNPETTDV--KLRWLYKKNYELSTRDELLEQQKLTV 235

Query: 236 LQVSSQIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMA 295
           ++ S  +F    + I E+G  NRNELM+ FS+KL T++ EEWKY++ +S   K S++ + 
Sbjct: 236 IKTSKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFIL 295

Query: 296 ILIQFLVAYIVLRKFI 311
           I+IQF +A ++L ++I
Sbjct: 296 IIIQFTLASVLLNRYI 311

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  328 bits (842), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 153/315 (48%), Positives = 224/315 (71%), Gaps = 4/315 (1%)

Query: 1   MTSVAKTI-PAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYH 59
           M+S   TI P+PTD  ALANRINF TRDAHNK+N  MS++LA AL+HGFIYRQGIL +Y+
Sbjct: 1   MSSHTNTIIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYY 60

Query: 60  IFDAVEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESL 119
           IF  VE+E+ +L   P   EE ++ ++L + W+ EF RT  + KDL++LY  EY   E+L
Sbjct: 61  IFKVVEEEIIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEAL 120

Query: 120 RNFVEHQP--LAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTG 177
           + F+E     L P L SF+  IH ++ ++ C+I AYCHVLYLALFAGGK++RS +Y++ G
Sbjct: 121 QLFLETNATELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLG 180

Query: 178 LFPKFEYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQ 237
             P F +L+ KE+  +GTNFF F  +G   E KL+ ++K+ YEL TR+ L+E +K+ I++
Sbjct: 181 FLPNFNHLSSKEVFEKGTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIE 240

Query: 238 VSSQIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYS-TILSKRSKDSIIVMAI 296
            S +IFD+N+  + E+G +N+ +LMSK +FK++TYL EEWK++   LSKR K  I+V+ +
Sbjct: 241 TSKKIFDYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRGKHLIMVVMV 300

Query: 297 LIQFLVAYIVLRKFI 311
           L+  L A+ +L++F+
Sbjct: 301 LLHMLFAFFILKRFL 315

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  306 bits (785), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 150/321 (46%), Positives = 218/321 (67%), Gaps = 20/321 (6%)

Query: 2   TSVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIF 61
           +S    IP+PTD  ALANRINFHTRDAHNK++  M+++LA AL+HG IYRQGIL +Y+IF
Sbjct: 3   SSTVTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIF 62

Query: 62  DAVEQELDRLL--NDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESL 119
            AVE E++ LL  N     E+++   +L + WL EF RT+++FKDL++LYS  + + + L
Sbjct: 63  QAVESEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDL 122

Query: 120 RNFVE------HQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLY 173
            NF+       HQ    +L  FV+ IH ++Q + C ILAYCHVLYLALFAGGK+++S +Y
Sbjct: 123 LNFINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIY 182

Query: 174 RHTGLFPKFEYLTPKELVIRGTNFFTFSDEGSDA---------ENKLRWKYKEGYELATR 224
           ++ G  P F +L+ KEL    TNFF F+ E SD+         ENKL+ K+K  +EL TR
Sbjct: 183 KNLGFLPNFNHLSSKELFNNATNFFQFT-ENSDSLEGINSISNENKLKLKFKRNFELNTR 241

Query: 225 QELSESQKTRILQVSSQIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILS 284
             L+E++K  I++++ QIF WN++ + E+G+ N+ ELM+ FSFKL+ YL EEWK++  + 
Sbjct: 242 SNLNENEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIK 301

Query: 285 KRSKDSI--IVMAILIQFLVA 303
           K  K  +  +++ +LIQF V+
Sbjct: 302 KNFKAILMFVILLLLIQFFVS 322

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  303 bits (775), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 224/318 (70%), Gaps = 9/318 (2%)

Query: 3   SVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFD 62
           S  K IP+PTDV ALANRINF TRD HNK+ A+MS+RLA AL+HGFIYRQG++AFYHIF 
Sbjct: 2   SNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFG 61

Query: 63  AVEQELDRLLN--DPQNDE-ERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEY-SDSES 118
            +E E+D LLN  D + D  + Q + +L+ F++ EFRR + + +DL VLY PE+  + + 
Sbjct: 62  TIENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQD 121

Query: 119 LRNFVEHQPLA----PQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYR 174
           + +F+  +       P+L  F D I  T ++   TI+AYCHVLYLALFAGGK+M+SN+ +
Sbjct: 122 VLDFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLK 181

Query: 175 HTGLFPKFEYLTPKELVIRGTNFFTFSDEGS-DAENKLRWKYKEGYELATRQELSESQKT 233
           + GLFPKF++++ +E+  +G+NFF F+ E + D ++KLR++YK+ YEL+TR EL+E QK 
Sbjct: 182 NVGLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKN 241

Query: 234 RILQVSSQIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIV 293
            I++VS  IF    +VI EIG  NR +LM  F+ K +TYL EEWKY+  L+K +K  I++
Sbjct: 242 DIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNKQIILL 301

Query: 294 MAILIQFLVAYIVLRKFI 311
           +  +I  L+ Y +++ F+
Sbjct: 302 IISIINILITYTIIKWFL 319

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  288 bits (738), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 186/254 (73%), Gaps = 11/254 (4%)

Query: 36  MSVRLAFALKHGFIYRQGILAFYHIFDAVEQELDRLLN----------DPQNDEERQMQH 85
           MSVR A AL+HG +YRQGILAFY++F A+EQE+D LL+             +D++     
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 86  VLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEHQPLAPQLQSFVDSIHSTVQQ 145
           +++QFW+ EFRRT +++KDL +LYSPEY  S  L   +    L PQLQ FVD +H+TV+Q
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120

Query: 146 DSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYLTPKELVIRGTNFFTFSDEGS 205
           +  T+LAYCHV+YLALFAGGKVMRS LYR+TGLFPKFE+L+ KEL  +GTNFFTFSD G 
Sbjct: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180

Query: 206 DAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDWNMDVIGEIGEMNRNELMSKF 265
           D EN+L+W+YK+ YELATR+ L+E+ K  I+ V+ +IF+ NMD+I EIG++N+ E ++  
Sbjct: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNK-EALTNN 239

Query: 266 SFKLLTYLSEEWKY 279
              LL Y+ EE K+
Sbjct: 240 KLDLLQYVFEELKF 253

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  271 bits (694), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 181/280 (64%), Gaps = 1/280 (0%)

Query: 2   TSVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIF 61
           T  +  +P PTD GALANRINFHTR+ H+K +A++S + A AL+H  IYRQG+LA Y+IF
Sbjct: 12  TQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIF 71

Query: 62  DAVEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRN 121
            +VEQ +DRLL  P   +E ++  +LR FW  EF R   + +D EV Y+ EYS S  L  
Sbjct: 72  RSVEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQ 131

Query: 122 FVEHQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPK 181
           F++   L P+L + V  I +   +   TILA+CHVLYLALFAGG+VMRS L R  GL P+
Sbjct: 132 FLDSYELPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPR 191

Query: 182 FEYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQ 241
              L+ +E  +RGT+FFTF   G+  ENK R  YK  YELATR  LSE++K  ++  +  
Sbjct: 192 AAGLSARETQLRGTHFFTFG-AGAGEENKARVAYKRAYELATRTALSEAEKADVIDAARA 250

Query: 242 IFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYST 281
            FD    V+ E+   NR EL+   S++LLT+L EEW+Y T
Sbjct: 251 DFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRT 290

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  233 bits (595), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 116/306 (37%), Positives = 199/306 (65%), Gaps = 18/306 (5%)

Query: 8   IPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQE 67
           +P+PTD  ALANRINFHTRD HN ++  MS++  FAL+H FIY+  +L++Y++F  +E E
Sbjct: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64

Query: 68  LDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVL-YSPEYSDSESLRNFVEHQ 126
           +D ++    +++   +  +LR F+ ++FRR ++I KDL+ L    + SD + L +     
Sbjct: 65  IDFII----SNDRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDDQWLSS----- 115

Query: 127 PLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLF--PKFEY 184
              P+L  F++ I S + +    +LAYCHVLYLALFAGG++MR+++ ++   F  PKF+ 
Sbjct: 116 --RPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDK 173

Query: 185 LTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFD 244
           ++  ++++  TNFF F D+   +ENKL+ +YK  Y++ T+ +L+E +K  I+ +S +IF 
Sbjct: 174 MSHTDVIMNATNFFKF-DKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFK 232

Query: 245 WNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQFLVAY 304
           +N +++ EIG +N++ELM  F++K++TY+ EEWK+      + K  +I+  I+    V  
Sbjct: 233 FNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFR---KPQIKKYVILFLIIFHLFVFI 289

Query: 305 IVLRKF 310
            + +KF
Sbjct: 290 NLFKKF 295

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  228 bits (581), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 185/309 (59%), Gaps = 25/309 (8%)

Query: 7   TIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQ 66
           TIP+PTD  ALANRINFHTRD HN+V+   SV+   AL+H FIY   +  FY +F  VEQ
Sbjct: 4   TIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVEQ 63

Query: 67  ELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEHQ 126
            +D L+     D    +  +L +F++ EFRR ++I +DL  ++  E+   ES     +  
Sbjct: 64  RIDELIASEGGD---GVGAILGEFYVPEFRRADKIKRDL--VFLGEWDTVES----GQWT 114

Query: 127 PLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKF---- 182
           P  PQL  F+  + S + +D  T+LA CHVLYLALFAGG+V +S+L+++ G  P F    
Sbjct: 115 P-PPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDKN 173

Query: 183 ---EYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVS 239
              E ++   LV   TNFF F++   D ENKLRW YK  YELATR  L+E QK  ++  S
Sbjct: 174 GPGEEMSDHTLVSNATNFFQFAETIED-ENKLRWTYKRNYELATRDTLTEDQKLAVIAAS 232

Query: 240 SQIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSII-VMAILI 298
             +F     VI EI + N +ELMS  SFK++TY  EEWK+    +K  K  ++  +A L 
Sbjct: 233 RDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKF----NKNFKRGVLWGVAFLA 288

Query: 299 QFLVAYIVL 307
           QFL  ++VL
Sbjct: 289 QFL--FVVL 295

>KAFR0D04020 Chr4 complement(792970..794883) [1914 bp, 637 aa] {ON}
           Anc_1.65 YNL279W
          Length = 637

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 104/250 (41%), Gaps = 39/250 (15%)

Query: 12  TDVGALANRINFHTRDAHNKVNAYMS----VRLAF-----------ALKHGFIYRQGILA 56
           T VG +AN ++    DA   +N  +S    V   F           ++ H  +    +  
Sbjct: 146 TTVGTIANDLDDGLEDASEVINKVLSAVSEVESWFTDDDDDDDGSESIAHVNLTISALRN 205

Query: 57  FYHIFDAVEQELDRLLNDPQNDEE-----RQMQHVLRQFWLEEFRRTN--RIFKDLEVLY 109
            Y I  ++  +L+ L ND  N  E     ++M  V  +    +   TN  +I  +   L+
Sbjct: 206 LY-IPSSINTKLEELANDVPNFAEVKNLTKEMLSVPFEAVRNDIESTNVSKIIGNQTFLF 264

Query: 110 SPEYSD--SESLRNFVEHQPLAPQLQS-FVDSIHSTVQQDSCTILAYCHVLYLALFAGGK 166
            P   +  S S      H+PL  ++ S  V S+H T+      ILA C V  L   A  +
Sbjct: 265 VPSLDETVSNSSNTCSAHKPLIREVYSDTVASLH-TLTLIFIIILAVCAVAALFPVAFSE 323

Query: 167 VMRSNLYRHTGLFPKFEYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYE-LATRQ 225
                 YR   L+ +   +T +EL I   +FFT +D+       L+   +E Y+ +++ Q
Sbjct: 324 ------YR---LWKRL--VTMRELYISKQDFFTTTDDDYSDSTTLKSVREEPYDVISSYQ 372

Query: 226 ELSESQKTRI 235
           E     +TR+
Sbjct: 373 EAFHRWQTRV 382

>TDEL0D02640 Chr4 complement(502950..505358) [2409 bp, 802 aa] {ON}
           Anc_4.185 YLR352W
          Length = 802

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 179 FPKFEYLTPKELVIRGTNF-FTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQ 237
           F K+ +   K L IRG+NF  T   +     N+  ++ K GYEL  + EL E QK + L 
Sbjct: 364 FIKYNFPKLKSLSIRGSNFPITRICDFLTPVNEQNFEVKSGYELG-KDELPEIQKLKFLN 422

Query: 238 VSS 240
           +S+
Sbjct: 423 ISN 425

>CAGL0K09988g Chr11 (977846..978436) [591 bp, 196 aa] {ON} similar
           to uniprot|P38962 Saccharomyces cerevisiae YDR084c
          Length = 196

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 43/110 (39%), Gaps = 6/110 (5%)

Query: 149 TILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYLTPKELVIRGTNFFTFSDEGSDAE 208
           TIL   H L +A    GK      Y    LFP F  L    +++   +F+   +      
Sbjct: 10  TILRSSHPLLMAFHLAGKAAPLAFYIAGFLFPSFTALFITIVLLLAADFYFTKNISGRRL 69

Query: 209 NKLRWKYKEGYELATRQELSESQK-----TRILQVSSQIFDWNMDVIGEI 253
            +LRW Y      +T     ES K       I  + S++F W+M +   I
Sbjct: 70  VQLRWWYDSS-ATSTETFTFESHKQYTAGPPINPIDSKLFWWSMYLTPAI 118

>Kwal_55.21046 s55 complement(664120..665244) [1125 bp, 374 aa] {ON}
           [contig 134] FULL
          Length = 374

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 46/112 (41%), Gaps = 17/112 (15%)

Query: 33  NAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQELDRLLNDPQND--EERQMQHVLRQF 90
           NA   V  A     GF  RQ         D ++Q++D L ++ Q +  E   +Q ++RQ 
Sbjct: 5   NANSGVASALGDDEGF--RQAFQFMKERMDLLQQQVDSLQSELQTERLEREALQKLVRQK 62

Query: 91  WLEEFRRTN-------------RIFKDLEVLYSPEYSDSESLRNFVEHQPLA 129
             E  R T+             R F+D+  ++    S S S  N  +H P A
Sbjct: 63  LREAPRGTHQQDTAILLDDHNIRDFEDVRAIFDAAGSPSNSDSNVSQHTPTA 114

>NDAI0F04660 Chr6 complement(1125701..1131649) [5949 bp, 1982 aa] {ON}
            Anc_1.127
          Length = 1982

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 50/114 (43%), Gaps = 8/114 (7%)

Query: 1    MTSVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHI 60
            ++++ K +  P  V  ++ + N   +   +    Y  +  A +L   F Y     +FY I
Sbjct: 936  VSAIGKGMAEPQRVEFISEQTNIFVKVVIDVEEPYSRIFHALSLAAIFKYNPKATSFYPI 995

Query: 61   FDAVEQELDRLLNDP----QNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYS 110
            FD     L  L+NDP     +   + MQ ++ ++ + E    +++   LE L S
Sbjct: 996  FDT----LFSLINDPHPVVHSWSLKAMQALIEEYLVIEISTLSKLLMTLEKLLS 1045

>Kwal_26.8269 s26 (715282..716358) [1077 bp, 358 aa] {ON} YMR028W
           (TAP42) - 42 kDa protein that pysically associates with
           the PP2A and SIT4 protein phosphatase catalytic subunits
           [contig 280] FULL
          Length = 358

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 6/81 (7%)

Query: 49  IYRQGILAFYHIFDAVEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRI---FKDL 105
           +  Q +  F +++D   QEL      P + ++    H+ RQ  +E F++T R+    KDL
Sbjct: 128 VLSQKLDNFENVYDPKLQEL---YAQPSDSKDLSNAHLKRQQKIEAFQQTKRLEAQIKDL 184

Query: 106 EVLYSPEYSDSESLRNFVEHQ 126
           E  +  +  + E LR   ++Q
Sbjct: 185 ESRHVEDSGNDEELRELRKYQ 205

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,704,924
Number of extensions: 1371857
Number of successful extensions: 4362
Number of sequences better than 10.0: 39
Number of HSP's gapped: 4450
Number of HSP's successfully gapped: 39
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)