Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C020207.346ON42542522410.0
ZYRO0F11616g7.346ON41541418810.0
SAKL0F11286g7.346ON42342618150.0
Kpol_530.357.346ON42540618010.0
Skud_12.2667.346ON43640717990.0
Smik_12.2617.346ON43640217850.0
YLR203C (MSS51)7.346ON43640217790.0
Suva_10.2977.346ON43640217790.0
TPHA0F029307.346ON43640517480.0
NCAS0E028807.346ON42940417400.0
KLTH0H01342g7.346ON42240417230.0
Kwal_56.246317.346ON42241617180.0
Ecym_47277.346ON42943117110.0
KLLA0D12430g7.346ON41841816880.0
CAGL0A03927g7.346ON43742916890.0
KNAG0B026307.346ON43841016280.0
NDAI0E044807.346ON44340216290.0
TBLA0E005007.346ON43741715620.0
NDAI0A019307.346ON45044615610.0
KAFR0B008407.346ON42640315520.0
NCAS0A141207.346ON42740415460.0
ACL152W7.346ON42842715310.0
KNAG0C037507.346ON42440115280.0
SAKL0G13662g5.172ON36188860.041
TDEL0E045705.172ON32871820.13
Suva_6.1261.331ON82072760.95
Kwal_33.153345.172ON329104731.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C02020
         (425 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   867   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   729   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   703   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   698   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   697   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   692   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   689   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   689   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   677   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   674   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   668   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   666   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   663   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   654   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   655   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   631   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   632   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   606   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   605   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   602   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   600   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   594   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   593   0.0  
SAKL0G13662g Chr7 complement(1169772..1170857) [1086 bp, 361 aa]...    38   0.041
TDEL0E04570 Chr5 complement(854538..855524) [987 bp, 328 aa] {ON...    36   0.13 
Suva_6.126 Chr6 complement(209913..212375) [2463 bp, 820 aa] {ON...    34   0.95 
Kwal_33.15334 s33 complement(1062502..1063491) [990 bp, 329 aa] ...    33   1.8  

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/425 (97%), Positives = 414/425 (97%)

Query: 1   MMLSATSRFPSLRAQRCGKVFNQRRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPV 60
           MMLSATSRFPSLRAQRCGKVFNQRRFIIGFVRNALGL           ENRFHPWDQSPV
Sbjct: 1   MMLSATSRFPSLRAQRCGKVFNQRRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPV 60

Query: 61  GDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVN 120
           GDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVN
Sbjct: 61  GDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVN 120

Query: 121 IYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYP 180
           IYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYP
Sbjct: 121 IYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYP 180

Query: 181 ISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISSTKDRPMRIFILGAR 240
           ISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISSTKDRPMRIFILGAR
Sbjct: 181 ISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISSTKDRPMRIFILGAR 240

Query: 241 AEAQLPGHVWKQLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYH 300
           AEAQLPGHVWKQLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYH
Sbjct: 241 AEAQLPGHVWKQLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYH 300

Query: 301 TDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFN 360
           TDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFN
Sbjct: 301 TDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFN 360

Query: 361 KADLLRDVDAVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY 420
           KADLLRDVDAVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY
Sbjct: 361 KADLLRDVDAVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY 420

Query: 421 HAIEV 425
           HAIEV
Sbjct: 421 HAIEV 425

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/414 (80%), Positives = 373/414 (90%)

Query: 12  LRAQRCGKVFNQRRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIR 71
           LR+ R  +   QRR IIGFVRNALGL           ENRFH WDQSP GDLRERAARIR
Sbjct: 2   LRSIRLCRPITQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIR 61

Query: 72  TLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRP 131
            LA+CPVTGKEINYTCPLSGIPTHHS+EAWEQDK+YH+SKK+E+LKKVNIYEHDLRSGRP
Sbjct: 62  ALAQCPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRP 121

Query: 132 FPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFS 191
           FPEFDFPQ  +FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPI+IASVL+QFS
Sbjct: 122 FPEFDFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFS 181

Query: 192 PYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISSTKDRPMRIFILGARAEAQLPGHVWK 251
           PYSLNPKGP+TLEGLKSLAALRYTLYP ENKT+++TKDRPMR+FILGARAEA LPGHVWK
Sbjct: 182 PYSLNPKGPITLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWK 241

Query: 252 QLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQ 311
           QLQ+LFPE  FELHF+GPECL+NKEKHQYV+S  PVVKR+DET+SFVYHTD+FHV H+AQ
Sbjct: 242 QLQFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQ 301

Query: 312 DFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAV 371
           DFFPYDPYLD FFCFHPGFGAPE++  WL +T+ GLLETKCAIF TG NK+ LLRD++AV
Sbjct: 302 DFFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAV 361

Query: 372 KDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
            DK+ KE+D+LMEP KN++GSTKWELND+NPQEVYQFNMYIAGFRGKRYHAIE+
Sbjct: 362 MDKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/426 (76%), Positives = 371/426 (87%), Gaps = 4/426 (0%)

Query: 1   MMLSATSRFPSLRAQRCGKVFNQRRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPV 60
           M+LSA  R  S+      ++  Q+R IIGFVRNALGL           +NRFHPWDQSP 
Sbjct: 1   MLLSAYKRC-SIAPASATRI--QKRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPS 57

Query: 61  GDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVN 120
            DLR RAA IR LARCPVTGKEINYTCP SGIPTHHSREAWEQD  YH +KKYEILKKVN
Sbjct: 58  PDLRTRAATIRALARCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVN 117

Query: 121 IYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYP 180
           IYEHDLRSGRPFPEFDFPQ QD+DR VNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYP
Sbjct: 118 IYEHDLRSGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYP 177

Query: 181 ISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISS-TKDRPMRIFILGA 239
            ++ SVLH+FSPY+LNPKGP+TLEGLKSLAALRYTLYP +++ +S+ TKDRPMRIFILGA
Sbjct: 178 TTVGSVLHEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGA 237

Query: 240 RAEAQLPGHVWKQLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVY 299
           RAEAQLPGHVWKQ Q+LFPE  FELHF+GPE   ++EK +Y+TSSTP+V+RVDET+SFVY
Sbjct: 238 RAEAQLPGHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVY 297

Query: 300 HTDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGF 359
           HTD+FHV HEAQDFFPYDPYLD+FFCFHPGF APE++  W+ +TM+GLLETKCAIFTTGF
Sbjct: 298 HTDYFHVFHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGF 357

Query: 360 NKADLLRDVDAVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKR 419
           N+ DL+RD+ AV++KYG E+D+LMEPV+N+FGSTKWELNDMNPQEVYQFNMYIAGFRGKR
Sbjct: 358 NEQDLVRDMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKR 417

Query: 420 YHAIEV 425
           YHAIEV
Sbjct: 418 YHAIEV 423

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/406 (79%), Positives = 361/406 (88%), Gaps = 3/406 (0%)

Query: 23  QRRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGKE 82
           Q+R ++GFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTLA+CPVT K+
Sbjct: 20  QKRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKD 79

Query: 83  INYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQD 142
           INYTCPLSGIPTHH +EAW  DK YH+SK+YEILKKVNIYEHDLRSGRPFPEFDFPQ QD
Sbjct: 80  INYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQD 139

Query: 143 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVT 202
           +DR +N+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPI+I S+LHQFSPYSLNPKGPVT
Sbjct: 140 YDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVT 199

Query: 203 LEGLKSLAALRYTLYPLENKTIS---STKDRPMRIFILGARAEAQLPGHVWKQLQYLFPE 259
           LEGLKSLAALRYTLYP +NK+ +   +T+DRPMRIFILGARAEAQLPGHVWKQ QYLFPE
Sbjct: 200 LEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPE 259

Query: 260 QMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPY 319
           Q FE+HF+GPEC LNKEK+QY+TSSTP+VK+VD+T+  V+H D+FHV HEAQDFFPYDP+
Sbjct: 260 QEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPF 319

Query: 320 LDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEV 379
           LDVFF FHPG+  PET+  WL ETMK LL+TKCAIFTTGF+K DLLRD+D VK++YG E+
Sbjct: 320 LDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNEL 379

Query: 380 DVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           D+LM+PVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV
Sbjct: 380 DMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/407 (78%), Positives = 363/407 (89%), Gaps = 2/407 (0%)

Query: 20  VFNQ-RRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPV 78
           V++Q RR ++GFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTLA CPV
Sbjct: 28  VYHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPV 87

Query: 79  TGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFP 138
           TGK+INYTCPLSGIPTHHSREAWE DK YH SKKYEILKKVNIYEHDLRSGRPFPEFDFP
Sbjct: 88  TGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFP 147

Query: 139 QGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPK 198
           Q Q +D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPI+I SVLH+FSPYSLNPK
Sbjct: 148 QQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPK 207

Query: 199 GPVTLEGLKSLAALRYTLYPLENKTI-SSTKDRPMRIFILGARAEAQLPGHVWKQLQYLF 257
           GP+TLEGLKSLAALRYTLYPLEN+++ ++TK+R MRIFILGARAEAQLPGHVWKQLQ+LF
Sbjct: 208 GPITLEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLF 267

Query: 258 PEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYD 317
           PEQ FE+HFVGPECL  ++K +YV S+TPVV+RVDET+ F++HTDFF V HEAQDFFPYD
Sbjct: 268 PEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYD 327

Query: 318 PYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGK 377
           PY+DVFF FHPG+ +PE+  SW+ ETM+ LLETKCAIFTTGFNK DL+ D++AVK KYGK
Sbjct: 328 PYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGK 387

Query: 378 EVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           E+D+LM+PV+NVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 388 EMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/402 (78%), Positives = 356/402 (88%), Gaps = 1/402 (0%)

Query: 24  RRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEI 83
           RR ++GFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTLA CPVTGK+I
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 84  NYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDF 143
           NYTCPLSGIPTHHSREAWE DK YH SKKYEILKKVNIYEHDLRSGRPFPEFDFPQ Q +
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQGY 152

Query: 144 DRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTL 203
           D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPI+I S+LH+FSPYSLNPKGP+TL
Sbjct: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 204 EGLKSLAALRYTLYPLENKT-ISSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMF 262
           EGLKSLAALRYTLYPLEN++ +++TK+R MRIFILGARAEAQLPGHVWKQLQ+LFPEQ F
Sbjct: 213 EGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272

Query: 263 ELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDV 322
           E+HF+GPECL  ++K +YV S+TPVV+RVDET+ F++ TDFF V HEAQDFFPYDPY+DV
Sbjct: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEAQDFFPYDPYMDV 332

Query: 323 FFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVL 382
           FF FHPG+ +PE+  SW+ ETMK LLETKCAIFTTGFNK DL  D++ VK KYGKE+D+L
Sbjct: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKYGKEMDIL 392

Query: 383 MEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           M+PVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/402 (79%), Positives = 356/402 (88%), Gaps = 1/402 (0%)

Query: 24  RRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEI 83
           RR ++GFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTLA CPVTGK+I
Sbjct: 33  RRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 84  NYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDF 143
           NYTCPLSGIPTHHSREAWE DK YH SKKYEILKKVNIYEHDLRSGRPFPEFDFPQ Q +
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 144 DRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTL 203
           D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPI+I S+LH+FSPYSLNPKGP+TL
Sbjct: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 204 EGLKSLAALRYTLYPLENKTI-SSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMF 262
           EGLKSLAALRYTLYPLEN+++ ++TK+R MRIFILGARAEAQLPGHVWKQLQ+LFPEQ F
Sbjct: 213 EGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSF 272

Query: 263 ELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDV 322
           E+HF+GPECL  ++K +YV S+TPVV+RVDET+ F+Y T+FF V HEAQDFFPYDPY+DV
Sbjct: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDV 332

Query: 323 FFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVL 382
           FF FHPG+ +PE+  SW+ ETMK LLETKCAIFTTGFNK DL  D++ VK KYGKE+DVL
Sbjct: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVL 392

Query: 383 MEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           MEPV+NVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 393 MEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/402 (78%), Positives = 355/402 (88%), Gaps = 1/402 (0%)

Query: 24  RRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEI 83
           RR ++GFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTLA CPVTGK+I
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 84  NYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDF 143
           NYTCPLSGIPTHHSREAWE DK YH SKKYEILKKVNIYEHDLRSGRPFPEFDFPQ Q +
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 144 DRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTL 203
           D+ VN+TNWDLF YTR FYSMDTEFQLAAVTKMLSYPI+I S+LH+FSPYSLNPKGP+TL
Sbjct: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 204 EGLKSLAALRYTLYPLENKTI-SSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMF 262
           EGLKSLAALRYTLYPLEN+++ ++T++R MRIFILGARAEAQLPGHVWKQLQ+LFPEQ F
Sbjct: 213 EGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272

Query: 263 ELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDV 322
           E+HF+GPECL  ++K +YV S+TPVV+R+DET+ F +HTDFF V HEAQDFFPYDPY+DV
Sbjct: 273 EIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYMDV 332

Query: 323 FFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVL 382
           FF FHPG+ +PE+  SW+ ETM  LLETKCAIFTTGFNK DL+ D++ VK KYGKE+D+L
Sbjct: 333 FFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMDIL 392

Query: 383 MEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           M+PVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/405 (76%), Positives = 351/405 (86%), Gaps = 2/405 (0%)

Query: 22  NQRRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGK 81
           +Q+R ++GFV+NALGL           ENRFHPWDQSP  DLRERAARIRTLA+CPVT K
Sbjct: 31  SQKRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKK 90

Query: 82  EINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQ 141
           EINYTCPLSGIPTHHSREAWE DK YHQSK+YEILKKVNIYEHDLRSGRPFPEFDFP  Q
Sbjct: 91  EINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQ 150

Query: 142 DFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPV 201
             DR VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP++I S+LHQFSPYSLNPKGP+
Sbjct: 151 IHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPI 210

Query: 202 TLEGLKSLAALRYTLYPLENKTISSTK--DRPMRIFILGARAEAQLPGHVWKQLQYLFPE 259
           TLEGLKSLAALRY+LYP + K+  S K  DRPMRIFILGARAEAQLPGHVWKQLQ+LFP+
Sbjct: 211 TLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPD 270

Query: 260 QMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPY 319
           Q FE+HF+G ECLLN EK++Y+ S+ PVVK++DET+  +YH+D+FHV HEAQDF PYDPY
Sbjct: 271 QTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPY 330

Query: 320 LDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEV 379
           LDVFF FHPGF APETS  W+ +TMK LLETKCAIFTTGFNK D+  DV+ VK +YGKE+
Sbjct: 331 LDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEM 390

Query: 380 DVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           D LM+P+KN +GSTKWELNDMNPQE++QFNMY+AGFRGKRYH I+
Sbjct: 391 DTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/404 (76%), Positives = 349/404 (86%), Gaps = 1/404 (0%)

Query: 22  NQRRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGK 81
           NQ R ++GFVRNALGL           ENRFHPWDQSP  DLRERAARIRTLARCPVTGK
Sbjct: 25  NQTRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERAARIRTLARCPVTGK 84

Query: 82  EINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQ 141
           EINYTCP+SGIPTHHSREAWEQDK+YH SK+YE+LKKVNIYEHDLRSGRPFPEFDFP+ Q
Sbjct: 85  EINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQ 144

Query: 142 DFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPV 201
             DR VNMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYPI+I SVLHQFSPYSL PKGP+
Sbjct: 145 GQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPI 204

Query: 202 TLEGLKSLAALRYTLYPLENK-TISSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQ 260
           +LEGLKSLAALRYTLYP++N+  IS+TK RPMRIFILGARAE+QLPGHVWKQLQYLFPEQ
Sbjct: 205 SLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQ 264

Query: 261 MFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYL 320
            FE+HF+GPE   +K+K +Y+  +TP+ + VDET+  +YHT++FH LHEAQDFFPYDPY+
Sbjct: 265 TFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFPYDPYM 324

Query: 321 DVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVD 380
           DVFF FHPGF + E    W+ +TMKGLL+TKCAIFTTGF K DLL D+  V+DKYGKE+D
Sbjct: 325 DVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGKELD 384

Query: 381 VLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           +LM+P KNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY  I+
Sbjct: 385 ILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/404 (77%), Positives = 350/404 (86%), Gaps = 1/404 (0%)

Query: 23  QRRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGKE 82
           Q+R I+GFVRNALGL           ENRFHPWDQSP  DLRERAA IR LA+CPVTG+E
Sbjct: 19  QKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGRE 78

Query: 83  INYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQD 142
           INYTCP SGIPTH+SREAWE D +Y QSK+ EILKKVNIYEHDLRSGRPFPEFDFP  QD
Sbjct: 79  INYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQD 138

Query: 143 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVT 202
           FDR VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP++I SVLHQFSPYSLNPKGPVT
Sbjct: 139 FDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVT 198

Query: 203 LEGLKSLAALRYTLYPLENKTISS-TKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQM 261
           LEGLKSLAALRYTLYP +N+ ++S TK+ P+RIFILGARAEAQLPGHVWKQLQ++FPE  
Sbjct: 199 LEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETN 258

Query: 262 FELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLD 321
            ELHFVGPE   ++ K +YV SS+P+V+RVDET+SFVYHTD+FHV HEAQDFFPYDPY D
Sbjct: 259 IELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTD 318

Query: 322 VFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDV 381
           +FFCFHPGF APE+  +W+ +TM+ LLETKCA+FTTGFN+ DL RDV  V  K+GKE+D+
Sbjct: 319 IFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDM 378

Query: 382 LMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           LMEPV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYHAIEV
Sbjct: 379 LMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/416 (74%), Positives = 354/416 (85%), Gaps = 4/416 (0%)

Query: 11  SLRAQRCGKVFNQRRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARI 70
           SLR   C     Q+R I+GFVRNALGL           ENRFHPWDQSP  DLRERAA I
Sbjct: 10  SLRNSHCSL---QKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATI 66

Query: 71  RTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGR 130
           R LA+CPVTG+EINYTCP SGIPTHHSREAWE+D  Y QSK+ EILKKVNIYEHDLRSGR
Sbjct: 67  RALAKCPVTGREINYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGR 126

Query: 131 PFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQF 190
           PFPEFDFP  QDFDR VN+TNWDLFFYTR F+SMDTEFQLAAVTKMLSYPI+I SVLHQF
Sbjct: 127 PFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQF 186

Query: 191 SPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISS-TKDRPMRIFILGARAEAQLPGHV 249
           SPYSLNPKGP+TLEGLKSLAALRYTLYP +N+ ++S  K+ P+RIF+LGARAEAQLPGHV
Sbjct: 187 SPYSLNPKGPITLEGLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHV 246

Query: 250 WKQLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHE 309
           WKQLQ++FPE   E+HFVGPE   ++ K +YV S+ P+++RVDET++FVYHTD+FHV HE
Sbjct: 247 WKQLQFMFPETQMEIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFHVFHE 306

Query: 310 AQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVD 369
           AQDFFPYDPY D+FFCFHPGF APE+  +W+ +TM+ LLETKCAIFTTGFN+ DL RD+D
Sbjct: 307 AQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLD 366

Query: 370 AVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           AV  +YGKE+D++M+P KN FGSTKWELND+NPQEVYQFNM++AGFRGKRYHAIEV
Sbjct: 367 AVVAEYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIEV 422

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/431 (70%), Positives = 359/431 (83%), Gaps = 8/431 (1%)

Query: 1   MMLSATSRF------PSLRAQRCGKVFNQRRFIIGFVRNALGLXXXXXXXXXXXENRFHP 54
           M+L  T R        S  ++ CGK   QRR I+GFVRNALGL           +NRFHP
Sbjct: 1   MLLPVTKRLGRPGFISSSSSRVCGK--QQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHP 58

Query: 55  WDQSPVGDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYE 114
           WDQSP  +LRERAARI+ LA+CPVTGK I ++C  SGIPTHHS EAW+ D +YH+SK+Y 
Sbjct: 59  WDQSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYR 118

Query: 115 ILKKVNIYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVT 174
           +LKKVNIYEHDLRSGRPF EFDFP+ QD+DR VNM NWDL+FYTR F+SMDTEFQLAAVT
Sbjct: 119 LLKKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVT 178

Query: 175 KMLSYPISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISSTKDRPMRI 234
           KMLSYPI+I S+LHQ+SPYSLNPKGP+TLEGLKSLAALRYTLYP +N+ + S +D+P+R+
Sbjct: 179 KMLSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRV 238

Query: 235 FILGARAEAQLPGHVWKQLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDET 294
           FILGARAEAQLPGHVWKQLQYLFPE + ELHFVGPE   ++EK +YVTSS PVVKR+D+T
Sbjct: 239 FILGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDT 298

Query: 295 ISFVYHTDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAI 354
           +   YHTD+FHV HEAQDFFPYDPY D+FFCFHPGFG+PET  +W+N T++ LL+TKCAI
Sbjct: 299 MKMHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAI 358

Query: 355 FTTGFNKADLLRDVDAVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAG 414
           FTTGFNK DL+ D+ AVK+KYG E+D+L++P KNVFGSTKWELND+NP EVYQFNMYIAG
Sbjct: 359 FTTGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAG 418

Query: 415 FRGKRYHAIEV 425
           FRGKRYHAIE+
Sbjct: 419 FRGKRYHAIEL 429

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/418 (73%), Positives = 346/418 (82%), Gaps = 4/418 (0%)

Query: 12  LRAQRCGKVFNQR---RFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAA 68
           + A R   V+  +   R I+GFVRNALGL           ENRFHPWDQSP  DLRERAA
Sbjct: 1   MLASRTPVVYRAKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAA 60

Query: 69  RIRTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRS 128
           RI+ +A CPVT K+I +TCPLSGIPTHHSREAWE+D +YH+SK+YE+LKKVNIYEHDLRS
Sbjct: 61  RIKAMATCPVTHKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRS 120

Query: 129 GRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLH 188
           GRPFPEFDFPQ QD+DR VNM+NWDLFFYTR FYSMDTEFQLAAVTKMLSYPI+I SVLH
Sbjct: 121 GRPFPEFDFPQDQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLH 180

Query: 189 QFSPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISSTKDRPMRIFILGARAEAQLPGH 248
           Q+SPYSLNPKGP+TLEGLKSLAALRYTLYP ++    + +D P+RIFILG RAEAQLPGH
Sbjct: 181 QYSPYSLNPKGPITLEGLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGH 240

Query: 249 VWKQLQYLFPEQMFELHFVGPECLLNKEKHQYVTSST-PVVKRVDETISFVYHTDFFHVL 307
           VWKQLQYL P+   ELHFVGPE   ++EK  YV SST  +VKR+DE +   YHTDFFHV 
Sbjct: 241 VWKQLQYLIPDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVF 300

Query: 308 HEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRD 367
           HEAQDFFPYDPY DVFFCFHPGF APET   W+ +TMK L++TKCA+FTTGF+K DLLRD
Sbjct: 301 HEAQDFFPYDPYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRD 360

Query: 368 VDAVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           +  V+DKYG E+D+LMEPV NVFGSTKWELND NP EVYQFNMYIAGFRGKRYHAIE+
Sbjct: 361 ISIVQDKYGSELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/429 (71%), Positives = 354/429 (82%), Gaps = 17/429 (3%)

Query: 14  AQRCGKVFN--QRRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIR 71
            Q  GK +    +R ++GFVRNALGL           +NRFHPWDQSP  DLRERAARI+
Sbjct: 9   VQNTGKFYACVSKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIK 68

Query: 72  TLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRP 131
           TLA+CPVT K I YTCP+SGIPTHHSREAWEQDK+YH SKKYEILKKVNIYEHDLRSGRP
Sbjct: 69  TLAKCPVTHKPIQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRP 128

Query: 132 FPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFS 191
           FPEFDFP+ Q  DRTVN+TNWDLF YTR FYSMDTEFQLAAVTKMLSYPI+I SVLHQFS
Sbjct: 129 FPEFDFPRDQGPDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFS 188

Query: 192 PYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISST-KDRPMRIFILGARAEAQLPGHVW 250
           PYSLNPKGP+TLEGLKSLAALRYTLYPL+N+ +++T K++PMRIFILGARAEAQLPGHVW
Sbjct: 189 PYSLNPKGPITLEGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVW 248

Query: 251 KQLQYLFPEQMFELHFVGPECLLNKEKHQYV--------------TSSTPVVKRVDETIS 296
           KQLQ+LFP+Q FE+HF+GPE L ++E+++Y+              TSS PV KR+DET+ 
Sbjct: 249 KQLQFLFPQQNFEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMK 308

Query: 297 FVYHTDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFT 356
           F YHTD+FH LH AQDFFPYDPY DVFF FHPG  +PE+  +W+ +T+KGLL+TKCAIFT
Sbjct: 309 FFYHTDYFHTLHTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFT 368

Query: 357 TGFNKADLLRDVDAVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFR 416
           TGFNK D+  D+  ++D YGKE+D+LM PVKNVFGSTKWEL+D +P  VYQFNMYIAGFR
Sbjct: 369 TGFNKKDMADDIQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFR 428

Query: 417 GKRYHAIEV 425
           GKRYH I+V
Sbjct: 429 GKRYHPIKV 437

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/410 (71%), Positives = 339/410 (82%), Gaps = 9/410 (2%)

Query: 24  RRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEI 83
           RR ++GFVRNALGL           ENRFHPWDQSPV  LRERAARI+TLA+CPVTG  +
Sbjct: 28  RRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGLNV 87

Query: 84  NYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDF 143
            YTCPLSGIPTHHSREAWEQD QYH +K+YE LKKVNIYEHDLRSGRPFPEFDFPQ Q +
Sbjct: 88  EYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQGY 147

Query: 144 DRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTL 203
           D+ VNMTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP++IAS+L QFSPYSLNPKGP+TL
Sbjct: 148 DKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPITL 207

Query: 204 EGLKSLAALRYTLY--PLENK-------TISSTKDRPMRIFILGARAEAQLPGHVWKQLQ 254
           EGLKSLAA+RYTLY     N        T  + K+RPMR+F+LGARAEAQLPGHVWKQL 
Sbjct: 208 EGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQLS 267

Query: 255 YLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFF 314
           YLFPEQ FE+ F+GPE   ++ + QYV S TPVV++VDET+ F+++TD+FHVLHE+QDFF
Sbjct: 268 YLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQDFF 327

Query: 315 PYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDK 374
           PYDPY D FF FHPGF +PE   +WL+ T+  LL+TKCAIFTTGF++ DL+ DV  + +K
Sbjct: 328 PYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNEK 387

Query: 375 YGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424
           +G E+D+LMEP KNVFGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 388 FGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/402 (71%), Positives = 338/402 (84%), Gaps = 1/402 (0%)

Query: 25  RFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEIN 84
           R ++GFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTLA CPVT KEIN
Sbjct: 42  RSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEIN 101

Query: 85  YTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDFD 144
           YTCP+SGIPTHHS+ AWE D+ YH +K YEILKKVNIYEHDLRSGRPFPEF FPQ QDFD
Sbjct: 102 YTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFD 161

Query: 145 RTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTLE 204
           R +NMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYPI+I S+LHQFSPYSL PKGP+TLE
Sbjct: 162 RMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLE 221

Query: 205 GLKSLAALRYTLYPLENKT-ISSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMFE 263
           GLKS+AALRYTLYP  NK+ ++ TK+RPMRIF+LGARAEAQLPGH+WKQLQYLFPEQ FE
Sbjct: 222 GLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFE 281

Query: 264 LHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDVF 323
           L F+GPE   +KEK QY+    P+++ +D+T+   + T++FH LHE+QD FPYDPY+DVF
Sbjct: 282 LFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDVF 341

Query: 324 FCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVLM 383
           F FHPGF A ET+  W+N+TMK LLET+CAIF TGF++ D+L D++ + +KY  ++D+LM
Sbjct: 342 FIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDILM 401

Query: 384 EPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           +PVKNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRY  +E+
Sbjct: 402 KPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/417 (66%), Positives = 333/417 (79%), Gaps = 19/417 (4%)

Query: 23  QRRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGKE 82
            +R ++GFVR+ LGL           ENRFHPW+ SP  DLRERAARI+T+A+CPV+  +
Sbjct: 23  SKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTMAKCPVSNLD 82

Query: 83  INYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQD 142
           INYTCP+SGIPTHHSR+ WE D  YH++   +ILKKVNIYEHDLRSGRPFPEFDFP+ Q+
Sbjct: 83  INYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQE 142

Query: 143 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVT 202
           +D  +N+ NWDL+FYTR F+SMDTEFQLAAVTKMLSYP++IASVLHQFSPYSL PKGPVT
Sbjct: 143 YDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVT 202

Query: 203 LEGLKSLAALRYTLYPLENKTISST--------------KDRPMRIFILGARAEAQLPGH 248
           LEGLKSLAALRYT   L N ++S T              K+RPMRIFILGARAEAQLP H
Sbjct: 203 LEGLKSLAALRYT---LNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAEAQLPPH 259

Query: 249 VWKQLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLH 308
           VWKQLQYLFP   FE+HF+GPE LL+K+K  YVTS+TP+ KR+D+++S VYHTD+FHV H
Sbjct: 260 VWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHVYH 319

Query: 309 EAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDV 368
           +AQDF+PYDPY D+FF FHPG  A  T  +WLNETM+GLL++KC IF TGF++ D+  D+
Sbjct: 320 KAQDFYPYDPYFDIFFMFHPGLAA--TKETWLNETMQGLLDSKCPIFMTGFHEKDITADI 377

Query: 369 DAVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
             +   + K++D+LM+PVKNVFGSTKWELND NPQEVYQFNMYIAG+RGKRYHA E 
Sbjct: 378 SVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATET 434

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/446 (64%), Positives = 344/446 (77%), Gaps = 26/446 (5%)

Query: 2   MLSATSRFPSLRAQRCG--------KVFNQRRFIIGFVRNALGLXXXXXXXXXXXENRFH 53
           M +A     S+  Q C         + F+ R F+ GFV+NALG+           ENRFH
Sbjct: 9   MTTANMILKSIPLQECSISYFKNNYQKFSNRHFV-GFVKNALGMEPPPSPNEPAFENRFH 67

Query: 54  PWDQSPVGDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKY 113
           PWDQSP  DLRERAARIR LA+CPVTGKEINYTCP+SGIPTHHS+EAWE D  YHQ+K Y
Sbjct: 68  PWDQSPSPDLRERAARIRALAKCPVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIY 127

Query: 114 EILKKVNIYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAV 173
           +ILKKVN++EHDLRSGR FPEF+FPQ QD D  V+M NWD+FFYTRQF SMD+EFQLA V
Sbjct: 128 DILKKVNVFEHDLRSGRSFPEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATV 187

Query: 174 TKMLSYPISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISSTKDRPMR 233
           TKMLSYPI+IAS+LH++ PY+L P GP+TLEGLKS+AAL+Y+   L +    +TK+RPMR
Sbjct: 188 TKMLSYPITIASILHKYCPYALEPNGPITLEGLKSIAALKYS---LRHNEFETTKERPMR 244

Query: 234 IFILGARAEAQLPGHVWKQLQYLFPEQMFELHFVGPECLL-------NKEKHQYVTSST- 285
           IFILGARAE+QLP H+WKQ  YLFP Q FE++F+GPEC +       N E+    TS + 
Sbjct: 245 IFILGARAESQLPEHIWKQFSYLFPFQNFEINFIGPECSVLMNNNNMNAEETNTTTSGSM 304

Query: 286 ------PVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASW 339
                  +VKR+DE ++ VYHTDFFH LH A+DFFPYD Y DVFF FHPGF +PE + SW
Sbjct: 305 TEIRPNRIVKRIDERLNLVYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSW 364

Query: 340 LNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVLMEPVKNVFGSTKWELND 399
           + ETMK LL+TKCAIFTTGFNK DLL+D+D V++ YGKEVD+LM+P KNVFGSTKWELND
Sbjct: 365 MGETMKALLDTKCAIFTTGFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELND 424

Query: 400 MNPQEVYQFNMYIAGFRGKRYHAIEV 425
           M+PQEVYQ+NMYIAGFRGKRYHA++V
Sbjct: 425 MDPQEVYQYNMYIAGFRGKRYHAVKV 450

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/403 (69%), Positives = 327/403 (81%), Gaps = 3/403 (0%)

Query: 25  RFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEIN 84
           R ++GFVRNALGL            NRF+PWDQSP  +LRERAA+I+ +ARCP+TGKEIN
Sbjct: 25  RTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGKEIN 84

Query: 85  YTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDFD 144
           YTCP+SGIPTHHSREAWEQD+ YH++K  +ILKKVNIYEHDLRSGR FPEFDFP  Q FD
Sbjct: 85  YTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQTFD 144

Query: 145 RTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTLE 204
           R VN+ NWDL+FYTR FYSMDTEFQLA VTKMLSYPI+IASVLHQ+SPYSL P GP+TLE
Sbjct: 145 RAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPITLE 204

Query: 205 GLKSLAALRYTLYPLENKTISST--KDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMF 262
           GLKS+AALRY+LYP ++K+  S   K RPMRIFILGARAE+QLPGHVWKQ QYLFP Q F
Sbjct: 205 GLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGARAESQLPGHVWKQFQYLFPLQTF 264

Query: 263 ELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDV 322
           E+ F+GPEC L +E    V  +  +VKR+D+TIS VYH   FH +H+AQDFFPYDPY DV
Sbjct: 265 EIIFIGPECQL-REPSNSVGGANNIVKRIDDTISLVYHPKLFHDIHKAQDFFPYDPYNDV 323

Query: 323 FFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVL 382
           FF FHPGF +PET   W+N+T+K LL+TKCA+F TGF+K DL  DV  +   YG ++D L
Sbjct: 324 FFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNKMYGDKLDTL 383

Query: 383 MEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           M PVKN+FGSTKWELND+NPQEVYQFNMYI+ FRGKRYH IE+
Sbjct: 384 MTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIEI 426

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/404 (66%), Positives = 334/404 (82%), Gaps = 3/404 (0%)

Query: 22  NQRRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGK 81
           +  R ++GFV+NALG+            NRF+PWD+SP   +RERAARI+  A+CPVTGK
Sbjct: 27  SSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGK 86

Query: 82  EINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQ 141
           EI +TCPLSGIPTH+S+EAWE D  YH++K YE L+KVNIYEHDLRSGRPFPEFDFP  Q
Sbjct: 87  EIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQ 146

Query: 142 DFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPV 201
             D TVNMTNWDLFFYTRQFYSMDTEFQLA VTKMLSYPI+I S+L+++SPY+L PKGPV
Sbjct: 147 ARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPV 206

Query: 202 TLEGLKSLAALRYTLYPLENKTISSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQM 261
           TLEGLKSLAALRYTL    N   ++TK RPMRIFILGARAE+QLP H+WKQLQ+LFP Q 
Sbjct: 207 TLEGLKSLAALRYTL---RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQA 263

Query: 262 FELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLD 321
           FE++F+GPEC L ++   Y++S + +VKRVDE+++  Y+ D+F   H+AQDFFPYDPY D
Sbjct: 264 FEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYND 323

Query: 322 VFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDV 381
           +FF FHPGF +PE+S +W+ +TMK LL+TKCAIFTTGF++ D+++D+ +V+D YG+EVD+
Sbjct: 324 IFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVDM 383

Query: 382 LMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           LM P+KNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRYH ++ 
Sbjct: 384 LMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA 427

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/427 (68%), Positives = 341/427 (79%), Gaps = 8/427 (1%)

Query: 6   TSRFPSLRAQR-------CGKVFNQRRFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQS 58
            SR P L A+              QRR I+GFVRNALGL           ENRFH W+QS
Sbjct: 3   VSRLPQLAARPYAVGRGCAAGACGQRRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQS 62

Query: 59  PVGDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKK 118
           P  DLRERAARIR LARCPVTGK+I Y+C  SGIPTHHSREAWEQD++YH+SK++  L+K
Sbjct: 63  PSPDLRERAARIRALARCPVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRK 122

Query: 119 VNIYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLS 178
           VN+YEHDLRSGRPF EFDFPQ Q  DR VNM NWDLF YTRQFYSMDT+FQLAAVTKMLS
Sbjct: 123 VNVYEHDLRSGRPFAEFDFPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLS 182

Query: 179 YPISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISSTKDRPMRIFILG 238
           YPI+I S+LHQFSPY+L P+GP+TLEGLKSLAALRYTLYP E+++  + + +PMRIFILG
Sbjct: 183 YPITIGSLLHQFSPYALEPRGPITLEGLKSLAALRYTLYP-ESESARAVRSKPMRIFILG 241

Query: 239 ARAEAQLPGHVWKQLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFV 298
           ARAEAQLPGHVWKQLQYLFP    E+HF+GPE L ++++ +YV SSTPV KRVD T+  V
Sbjct: 242 ARAEAQLPGHVWKQLQYLFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLV 301

Query: 299 YHTDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTG 358
           +HTD+ HV HEAQDFFPYDPY DVFFCFHPGF + E  +SW+++T+  LLETKCAIF TG
Sbjct: 302 HHTDYLHVFHEAQDFFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTG 361

Query: 359 FNKADLLRDVDAVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGK 418
           F++ D+  D +A++  +  E+DVLM P KN+FGSTKWELNDMNP EVYQFNMYIAGFRGK
Sbjct: 362 FHRDDMFGDFEALRASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGK 421

Query: 419 RYHAIEV 425
           RYHAI+V
Sbjct: 422 RYHAIQV 428

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/401 (68%), Positives = 323/401 (80%), Gaps = 5/401 (1%)

Query: 25  RFIIGFVRNALGLXXXXXXXXXXXENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEIN 84
           R I+G+VRNA GL            NRFHPW++SP  DLR+RAARI+TLARCPVTGK IN
Sbjct: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88

Query: 85  YTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDFD 144
           YTCP+SGIPTHHSR+AWE D  YH++K YE LKKVNIYEHDLRSGR FPEFDFP  Q  D
Sbjct: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148

Query: 145 RTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTLE 204
           R VN+ NWDLF YTRQFYSMDTEF LA VTKMLSYPI+IASVLH+FSPY L P+GPVTLE
Sbjct: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208

Query: 205 GLKSLAALRYTLYPLENKTISSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMFEL 264
           GLKS+AALRYTLYP   KT S + + PMRIFI+G RAE+QLPGHVWKQLQYLF E++FE+
Sbjct: 209 GLKSIAALRYTLYPKLGKT-SLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFEI 267

Query: 265 HFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDVFF 324
           HF+GPEC L + K+    +STP++K+VD+T+S +YH  +FH LH++ D FPY+PY DVFF
Sbjct: 268 HFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVFF 323

Query: 325 CFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVLME 384
            FHPGF  P+T   WL+ET+  LLETKCAIF TGFN+ D+  DV  +   Y  E+DVLM+
Sbjct: 324 IFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLMK 383

Query: 385 PVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425
           P+KNVFGS KWELND+NPQEVYQFNMYIAGFRGKRYH I++
Sbjct: 384 PIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424

>SAKL0G13662g Chr7 complement(1169772..1170857) [1086 bp, 361 aa]
           {ON} similar to uniprot|P47065 Saccharomyces cerevisiae
           YJL023C PET130 Protein required for respiratory growth
          Length = 361

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 17/88 (19%)

Query: 296 SFVYHTDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIF 355
           S VYH DFF +L     +FP D +L +F    PG         +LN  + G         
Sbjct: 104 SKVYHCDFFRLL-----YFPPDHFLSIFRKSKPGLNVRTVGEVFLNGNISG--------- 149

Query: 356 TTGFNKADLLR--DVDAVKDKYGKEVDV 381
             G  +A+ +R  + ++  DKY K+ DV
Sbjct: 150 -DGLKQAENVRVFEENSKIDKYRKKKDV 176

>TDEL0E04570 Chr5 complement(854538..855524) [987 bp, 328 aa] {ON}
           Anc_5.172 YJL023C
          Length = 328

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 296 SFVYHTDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIF 355
           S+VYH DFF ++     +FP D +L +F    P          +LN  M G  +++ +IF
Sbjct: 111 SYVYHCDFFRLM-----YFPPDHFLSLFRKSKPAINVRTVGRVFLNGNM-GASDSEMSIF 164

Query: 356 TTGFNKADLLR 366
           T    K   ++
Sbjct: 165 TRNSQKNGFVK 175

>Suva_6.126 Chr6 complement(209913..212375) [2463 bp, 820 aa] {ON}
           YJL051W (REAL)
          Length = 820

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 10/72 (13%)

Query: 92  IPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDFDRTVNMTN 151
           +P H + E WE+D++        IL+KV     +L   +  P F F    D DR  + T 
Sbjct: 455 LPAHVTLEMWEKDQE-------NILRKVTT---NLADSKLLPPFRFTSKSDIDRNSSPTE 504

Query: 152 WDLFFYTRQFYS 163
            ++  +T+  +S
Sbjct: 505 LEVELHTQNNFS 516

>Kwal_33.15334 s33 complement(1062502..1063491) [990 bp, 329 aa]
           {ON} YJL023C (PET130) - Nuclear gene encoding
           mitochondrial protein [contig 290] FULL
          Length = 329

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 45/104 (43%), Gaps = 14/104 (13%)

Query: 290 RVDETISFVYHTDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLE 349
           R+    S VYH DFF +L     +FP D +L VF    P          +LN  + G   
Sbjct: 92  RIFSAQSKVYHCDFFRLL-----YFPPDHFLSVFRKSKPAVNVRIVGEVFLNGNVTGTDG 146

Query: 350 TKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVL-MEPVKNVFGS 392
            + A  T  F K   +       D YG+  D+  ++ ++++F S
Sbjct: 147 QRVA-NTDAFVKGSRM-------DGYGRSQDMSNLKRLQSLFAS 182

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,136,194
Number of extensions: 1957315
Number of successful extensions: 4457
Number of sequences better than 10.0: 29
Number of HSP's gapped: 4511
Number of HSP's successfully gapped: 29
Length of query: 425
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 313
Effective length of database: 40,638,807
Effective search space: 12719946591
Effective search space used: 12719946591
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 67 (30.4 bits)