Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C020107.347ON19119110241e-144
ZYRO0F11638g7.347ON1911919501e-132
Suva_4.817.347ON1911919231e-128
YDL165W (CDC36)7.347ON1911919191e-128
Skud_4.927.347ON1911919181e-127
Smik_4.737.347ON1911919171e-127
NDAI0A019207.347ON1931939121e-126
KNAG0C037607.347ON1911918871e-123
KAFR0B008507.347ON1921928801e-122
Kpol_530.347.347ON1911918721e-120
CAGL0I03388g7.347ON1911918691e-120
NCAS0A141307.347ON1911918621e-119
TPHA0F029407.347ON1911918281e-114
TBLA0E005107.347ON2871678051e-109
KLTH0H01320g7.347ON1901927801e-106
SAKL0F11308g7.347ON1911927761e-106
Kwal_56.246347.347ON1901927751e-106
KLLA0D12408g7.347ON1841916862e-92
Ecym_47267.347ON1911986716e-90
ACL151C7.347ON2081986701e-89
SAKL0B08052g3.370ON576841072e-05
KLTH0F11880g3.370ON563851011e-04
ZYRO0C16588g3.370ON608821002e-04
Smik_16.3163.370ON560102983e-04
KAFR0H008603.370ON57882974e-04
CAGL0D01342g3.370ON54884975e-04
NDAI0A050803.370ON57582966e-04
Kwal_23.39623.370ON55385966e-04
YPR072W (NOT5)3.370ON56082957e-04
TPHA0A035003.370ON54882940.001
Skud_16.3613.370ON56082930.002
Suva_16.4013.370ON56582920.002
TBLA0H014903.370ON55283910.003
Kpol_1006.73.370ON54083890.004
CAGL0B01144g1.59ON391153880.006
KNAG0A072903.370ON50786880.007
ADL364C3.370ON50487840.018
KLLA0B09196g3.370ON59073840.021
Ecym_34563.370ON50887840.022
TDEL0C051203.370ON56269820.036
KLTH0A03652g7.214ON77267820.040
Kpol_1070.257.214ON686103770.18
CAGL0L00407g6.278ON1371159720.87
ZYRO0D16302g7.214ON829125710.88
TBLA0D042707.214ON84766711.1
NCAS0A112103.370ON58254681.9
CAGL0K00363g1.527ON122783682.4
Kwal_47.181147.214ON76382682.4
TDEL0H023307.214ON81281672.9
NDAI0A026907.214ON84666656.1
Smik_1.197.25ON17076627.0
KLLA0E04335g7.214ON75866648.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C02010
         (191 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   399   e-144
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   370   e-132
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   360   e-128
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   358   e-128
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   358   e-127
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   357   e-127
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   355   e-126
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   346   e-123
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   343   e-122
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   340   e-120
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   339   e-120
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   336   e-119
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   323   e-114
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   314   e-109
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   305   e-106
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   303   e-106
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   303   e-106
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   268   2e-92
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   263   6e-90
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   262   1e-89
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    46   2e-05
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    44   1e-04
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    43   2e-04
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    42   3e-04
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    42   4e-04
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    42   5e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    42   6e-04
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    42   6e-04
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    41   7e-04
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    41   0.001
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    40   0.002
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    40   0.002
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    40   0.003
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    39   0.004
CAGL0B01144g Chr2 complement(102067..103242) [1176 bp, 391 aa] {...    39   0.006
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    39   0.007
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    37   0.018
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    37   0.021
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    37   0.022
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    36   0.036
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    36   0.040
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    34   0.18 
CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} simila...    32   0.87 
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    32   0.88 
TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa] ...    32   1.1  
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    31   1.9  
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...    31   2.4  
Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038...    31   2.4  
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    30   2.9  
NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {O...    30   6.1  
Smik_1.19 Chr1 complement(40912..41424) [513 bp, 170 aa] {ON} YA...    28   7.0  
KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} simila...    29   8.2  

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  399 bits (1024), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 191/191 (100%), Positives = 191/191 (100%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFLLFYNAIM 191
           REFLLFYNAIM
Sbjct: 181 REFLLFYNAIM 191

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  370 bits (950), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 173/191 (90%), Positives = 184/191 (96%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M+KFGL+ALVPL+KQE+RE +  YDHS+TLGADLSSMLHSLGIPRDSKRH+VLDTFQSPW
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+FFIP+SF NIP VL SQ+TPPCFNSVQ DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFLLFYNAIM 191
           R+FLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  360 bits (923), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 166/191 (86%), Positives = 183/191 (95%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M+KFGL+ALVPL+KQE++E +S YDHS+TLGADLSSML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+FF P+SFTNIP VLQS  TPPCFNS+Q+DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFLLFYNAIM 191
           R+FLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  358 bits (919), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 182/191 (95%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           MEKFGLKALVPL+K E++E +S YDHS+TLGADLSSML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+FF P+SFTNIP VLQS  TPPCFNS+Q+DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFLLFYNAIM 191
           R+FLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  358 bits (918), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 166/191 (86%), Positives = 182/191 (95%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           MEKFGL+ALVPL+K E++E +S YDHS+TLGADLSSML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+FF P+SFTNIP VLQS  TPPCFNS+Q+DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFLLFYNAIM 191
           R+FLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  357 bits (917), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 166/191 (86%), Positives = 182/191 (95%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           MEKFGL+ALVPL+K E++E +S YDHS+TLGADLSSML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+FF P+SFTNIP VLQS  TPPCFNS+Q+DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFLLFYNAIM 191
           R+FLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  355 bits (912), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 2/193 (1%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M+KFGL+ALVPLIK +++E + +YDHS+TLGADL+SMLHSLGIPRDSKRHRVLDTFQSPW
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQT--TPPCFNSVQHDQQRVALFQDETLFYLFYK 118
           AETSRSEVEP FFIPDSFT+IP VLQS T  TPP F+SVQ DQQRVALFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120

Query: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEK 178
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEPVVS+DGLSERGSYVFFDPQRWEK
Sbjct: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180

Query: 179 CQREFLLFYNAIM 191
           CQREFLLFYNAIM
Sbjct: 181 CQREFLLFYNAIM 193

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  346 bits (887), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 164/191 (85%), Positives = 175/191 (91%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M+KFGLKALVPL++Q + E AS YDHS+ LGADLSSMLHSLGIPRDSKR  VL TFQSPW
Sbjct: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP F+IP SF  I +VLQS++TPPCF+SVQ DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEPVVS DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFLLFYNAIM 191
           R+FLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  343 bits (880), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 175/192 (91%), Gaps = 1/192 (0%)

Query: 1   MEKFGLKALVPLIKQE-ERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSP 59
           M+KFGLKAL+PLIKQ+ + E    YDHS+TLGADLSSML+SLGIPRD + HRVLDTFQSP
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60

Query: 60  WAETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKH 119
           WAETSRSEVEPKF IPDSF NI  VLQS  TPPCF+S+Q+DQQRVALFQDETLFYLFYKH
Sbjct: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179
           P TVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS DGLSE+GSYVFFDPQRWEKC
Sbjct: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180

Query: 180 QREFLLFYNAIM 191
           QR+FLLFYNAIM
Sbjct: 181 QRDFLLFYNAIM 192

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  340 bits (872), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 154/191 (80%), Positives = 178/191 (93%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M+KFGL+AL+PLIKQ++ E +  Y+H++T+G DLSSMLHSLGIPRD++R+R+LDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+FF P+SF NIP VLQS+ TPP FNS+++DQQRV LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP +EP+VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180

Query: 181 REFLLFYNAIM 191
           REF+LFYNAIM
Sbjct: 181 REFVLFYNAIM 191

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  339 bits (869), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 158/191 (82%), Positives = 174/191 (91%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M KFGL+ LVPLI+ +E +   +YDHS+T+G DLSSMLHSLGIPRDSK HRVLDTFQSPW
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPK++IP+SF NIP VLQS+TTPP F+ VQ DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDP MEPVV++DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFLLFYNAIM 191
           R+F LFY+AIM
Sbjct: 181 RDFPLFYSAIM 191

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  336 bits (862), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 174/191 (91%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M+KFGLKALVPL++Q+++E +  YDHS+TLGADLSSM+HSLGIPRD+ RHRVLDTFQSPW
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP FFIPDSF  I  VLQS  TPP F+S Q+DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP MEP VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 REFLLFYNAIM 191
           ++FLLFYNAIM
Sbjct: 181 KDFLLFYNAIM 191

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  323 bits (828), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 147/191 (76%), Positives = 175/191 (91%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           M+KFGL+AL+PLIKQ++ E +  Y+H++T+GADL+S+ HSLGIP ++KR+RVLDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIPNNNKRYRVLDTFQSPW 60

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP++F P SFTNIP+VLQS  TP  FNSV+ DQQR++LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDP +EP+V++DG SERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEKCQ 180

Query: 181 REFLLFYNAIM 191
           R+F+LFYNAIM
Sbjct: 181 RDFVLFYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  314 bits (805), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 140/167 (83%), Positives = 156/167 (93%)

Query: 25  DHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPWAETSRSEVEPKFFIPDSFTNIPQV 84
           DHS+T+GADLSSMLHSLG+PRD+KRHR+LDTFQSPWAETSRSEV+P+FFIP SF+NI  V
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISNV 180

Query: 85  LQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLK 144
           LQ  TTPP FN+++ DQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HK LK
Sbjct: 181 LQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILK 240

Query: 145 AWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQREFLLFYNAIM 191
            WLTKDP MEP+V++DG SERGSYVFFDPQRWEKCQREF+LFYNAIM
Sbjct: 241 TWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/17 (70%), Positives = 16/17 (94%)

Query: 1  MEKFGLKALVPLIKQEE 17
          M++FGLKALVPLI+ +E
Sbjct: 1  MDRFGLKALVPLIRLDE 17

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  305 bits (780), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 164/192 (85%), Gaps = 3/192 (1%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDS-KRHRVLDTFQSP 59
           MEK+GL AL+PLI++E++     YD S+TLG DLS +LHSLGIP +   R+RVLDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQSPD--YDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58

Query: 60  WAETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEPKFF+P+SF NIP VLQS   PP FNSVQ D  +++LFQDETLFYLFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDP MEPVV+  G SERGSYVFFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QREFLLFYNAIM 191
           QR+F+LFYNAIM
Sbjct: 179 QRDFVLFYNAIM 190

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  303 bits (776), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 147/192 (76%), Positives = 164/192 (85%), Gaps = 4/192 (2%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSK-RHRVLDTFQSP 59
           +EK+GLKAL+PLIKQE       YD ++T+G DLSSMLHSLGI  + + + RVLDTF SP
Sbjct: 3   VEKYGLKALLPLIKQETGNAE--YDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60

Query: 60  WAETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEPKFF P+SF NIP VLQS  +PP FNSVQ D  ++ALFQDETLFYLFYKH
Sbjct: 61  WVETSRSEVEPKFFTPESFVNIPNVLQS-PSPPSFNSVQQDHPKIALFQDETLFYLFYKH 119

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELRKRNWRYHKTLK WLTKDP MEPVVS DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179

Query: 180 QREFLLFYNAIM 191
           QR+F+LFYNAIM
Sbjct: 180 QRDFVLFYNAIM 191

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  303 bits (775), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 164/192 (85%), Gaps = 3/192 (1%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRD-SKRHRVLDTFQSP 59
           MEK+GL AL+PLI++E++     YD S+TLG DLS +LHSLGI  + S R+RVLDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQSPE--YDSSMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQSP 58

Query: 60  WAETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEPKFF+P+SF NIP VLQ+   PP FNSVQ D  +++LFQDETLFYLFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDP MEPVV+  G SERGSYVFFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QREFLLFYNAIM 191
           QR+F+LFYNAIM
Sbjct: 179 QRDFVLFYNAIM 190

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  268 bits (686), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 152/191 (79%), Gaps = 7/191 (3%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60
           MEK+GLK LVP+++ +       YD ++TLG DL+S+L+SL I +D+K H  LD F+SPW
Sbjct: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55

Query: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
            ETSRSEV+P FFIP+SF NI  +L +      F SV  DQ R++L QDETLFYLFYKHP
Sbjct: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180
           G+VIQELTYLELRKRNWRYHKTLK WLTKDP MEPVV+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173

Query: 181 REFLLFYNAIM 191
           R+F+L YNAIM
Sbjct: 174 RDFVLHYNAIM 184

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  263 bits (671), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 134/198 (67%), Positives = 152/198 (76%), Gaps = 14/198 (7%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIP-RDS------KRHRVL 53
           M K+GLK+L+P+IK +++     YD S+TLG DL S+LHSL +  RDS        H  L
Sbjct: 1   MSKYGLKSLLPVIKHDKQ-----YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55

Query: 54  DTFQSPWAETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLF 113
           DTF SPW ETSRSEVEPKFFIP+SF NI  VL   +T   F SV  D  R++L QDETLF
Sbjct: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113

Query: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP MEP+VS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173

Query: 174 QRWEKCQREFLLFYNAIM 191
           QRWEKCQR+F+L YNAIM
Sbjct: 174 QRWEKCQRDFILNYNAIM 191

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  262 bits (670), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 150/198 (75%), Gaps = 14/198 (7%)

Query: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRD-------SKRHRVL 53
           M+K+GLK L+P+IK E++     YD  +TLG D+SS+LHSL +          S  H  L
Sbjct: 18  MDKYGLKGLLPVIKHEKQ-----YDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHAL 72

Query: 54  DTFQSPWAETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLF 113
           DTF SPW ETSRSEVEPKFFIP+SF NI  VL   +T   F SV  D  R++L QDETLF
Sbjct: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDETLF 130

Query: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP MEP+VS D  SERGSYVFFDP
Sbjct: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190

Query: 174 QRWEKCQREFLLFYNAIM 191
           QRWEKCQR+F+L Y+AIM
Sbjct: 191 QRWEKCQRDFILNYSAIM 208

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 6/84 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPKMEP--VVSSDGLS 163
           F  +TLF++FY + GT  Q L   EL + RNW+++K    W  K+ +  P  VVSS+   
Sbjct: 484 FDLDTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVVSSENKQ 543

Query: 164 ERGSYVFFDPQR-W--EKCQREFL 184
           E  S+ +FD Q+ W   +C  +F+
Sbjct: 544 EEISWRYFDYQKSWLARRCGSDFV 567

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 7/85 (8%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD-PKMEPVVSSDGL 162
           ++ F  +TLF++FY + GT  Q L+  EL  R W+++K  + W  K+  K+ P +     
Sbjct: 473 MSKFDLDTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKEVEKLPPGMEQ--- 529

Query: 163 SERGSYVFFDPQR-W--EKCQREFL 184
           SE  S+ +FD Q+ W   +C  EF+
Sbjct: 530 SEEISWRYFDYQKSWLARRCGAEFV 554

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +E +      SE 
Sbjct: 519 FDLDTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKE--VEKLPPGMAQSEE 576

Query: 166 GSYVFFDPQR-W--EKCQREFL 184
            S+ +FD QR W   +C  +F+
Sbjct: 577 ESWRYFDYQRSWLARRCNSDFI 598

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (52%), Gaps = 14/102 (13%)

Query: 95  NSVQHDQ--QRVAL------FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKA 145
           NS +HD    R +L      F  +TLF++FY + G+  Q L   EL + RNW ++K  + 
Sbjct: 452 NSRKHDDIYSRTSLARIFMKFDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRC 511

Query: 146 WLTKDPKMEPVVSSDGLSERGSYVFFDPQR-W--EKCQREFL 184
           W  K+  +E +    G SE  S+ +FD ++ W   +C  +F+
Sbjct: 512 WYYKE--IEKLPPGMGKSEEESWRYFDYKKSWLARRCGNDFV 551

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + GT  Q L+  EL K RNW+++K  + W  K+  +E +      SE 
Sbjct: 490 FDLDTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--IEKLPPGMNKSEE 547

Query: 166 GSYVFFDPQR-W--EKCQREFL 184
            S+ +FD ++ W   +C  +F+
Sbjct: 548 ESWRYFDYKKSWLARRCSPDFV 569

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 8/84 (9%)

Query: 106 LFQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKD-PKMEPVVSSDGLS 163
           +F  +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+  K+ P ++    S
Sbjct: 459 MFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKEIEKLPPGMTK---S 515

Query: 164 ERGSYVFFD-PQRW--EKCQREFL 184
           E  S+ +FD  + W   +C  +F+
Sbjct: 516 EEESWRYFDFKKSWLSRRCGSDFV 539

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + GT  Q L   EL K R+W+Y+K    W  K+ +  P  ++    E 
Sbjct: 485 FDLDTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGANYNKDEE 544

Query: 166 GSYVFFDPQR-W--EKCQREFL 184
            S+ +FD ++ W   +C  +F+
Sbjct: 545 ESWRYFDYKKSWLSRRCGNDFV 566

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 47/85 (55%), Gaps = 7/85 (8%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD-PKMEPVVSSDGL 162
           ++ F  +TLF++FY + GT  Q L   EL  R W+++K  + W  K+  K+ P +     
Sbjct: 463 MSKFDLDTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKEVEKLPPGMEQ--- 519

Query: 163 SERGSYVFFDPQR-W--EKCQREFL 184
           SE  S+ +FD Q+ W   +C  +F+
Sbjct: 520 SEEISWRYFDYQKSWLARRCGTDFV 544

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQREFL 184
            S+ +FD ++ W   +C  +F+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 8/82 (9%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKD-PKMEPVVSSDGLSE 164
           F  +TLF++FY + GT  Q L   EL K RNW+Y+K  + W  K+  K  P ++    +E
Sbjct: 460 FDLDTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKEVTKSAPDMAQ---TE 516

Query: 165 RGSYVFFDPQR-W--EKCQREF 183
             ++ +FD Q  W   +C  +F
Sbjct: 517 EETWRYFDYQNSWLARRCNHDF 538

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQREFL 184
            S+ +FD ++ W   +C  +F+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 477 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 534

Query: 166 GSYVFFDPQR-W--EKCQREFL 184
            S+ +FD ++ W   +C  +F+
Sbjct: 535 ESWRYFDYKKSWLARRCGNDFV 556

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 10/83 (12%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPKMEPVVSSDGL--S 163
           F  +TLF++FY + GT  Q L+  EL K RNW ++K  + W  ++ +  P     GL  S
Sbjct: 463 FDLDTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYREVEKLPP----GLPQS 518

Query: 164 ERGSYVFFDPQR-W--EKCQREF 183
           E  S+ +FD Q+ W   +C   F
Sbjct: 519 EEISWRYFDYQKSWLSRRCNSNF 541

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 10/83 (12%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPKMEPVVSSDGL--S 163
           F  +TLF++FY + GT  Q L   EL K RNW+++K  + W  K    E   S  G+  +
Sbjct: 452 FDLDTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYK----EVTKSPPGMQQA 507

Query: 164 ERGSYVFFDPQR-W--EKCQREF 183
           E  ++ +FD Q  W   +C  +F
Sbjct: 508 EEETWRYFDYQNSWLARRCNSDF 530

>CAGL0B01144g Chr2 complement(102067..103242) [1176 bp, 391 aa] {ON}
           similar to uniprot|Q06263 Saccharomyces cerevisiae
           YLR181c
          Length = 391

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 66/153 (43%), Gaps = 10/153 (6%)

Query: 10  VPLIKQEERETASLY----DHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPWAETSR 65
           VPL K EE E   L     D+++T   D+  +++ L +  +   +   D ++S   E   
Sbjct: 210 VPLDKSEEEEVNKLVGDSQDNAVTED-DVDDLINKLKMADEDSENEPDDLYRSQADENGG 268

Query: 66  SEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQ--DETLFYLFYKHPGTV 123
           SE      +PD+  NIP   +   TP   +S   DQ   A  +  D+ +  + +     +
Sbjct: 269 SEEPSNLGLPDTPANIPS--RKLDTPAFVDSSDEDQGSDADVEEKDDAVEPVVHTSSTPM 326

Query: 124 IQELTYLELRKRNWRYHKTLKAWLTKDPKMEPV 156
            QEL  LE  K  +  +  L   + K  K+E +
Sbjct: 327 EQELEELETSKPTYTKND-LANMMDKADKIEKI 358

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 8/86 (9%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELR-KRNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + GT  Q L   EL   R+W+++K  + W  K+  +E +      SE 
Sbjct: 419 FDLDTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNKSEE 476

Query: 166 GSYVFFDPQR-W--EKCQREFLLFYN 188
            S+ +FD ++ W   +C  +F+  YN
Sbjct: 477 ESWRYFDYKKSWLARRCNSDFV--YN 500

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 5/87 (5%)

Query: 102 QRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDG 161
           Q +  F  +TLF++FY + GT  Q L   EL  R W +++  + W  K+  +E +     
Sbjct: 412 QIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKE--VEKLPPGMD 469

Query: 162 LSERGSYVFFDPQR-W--EKCQREFLL 185
             E  S+ +FD Q+ W   +C  +F+ 
Sbjct: 470 QKEEVSWRYFDYQKSWLARRCGPDFVF 496

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD-PKMEPVVSSDGL 162
           ++ F  +TLF++FY + G+  Q L   EL  R W ++K  + W  K+  K+ P +     
Sbjct: 499 MSKFALDTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKEVEKLPPGIEG--- 555

Query: 163 SERGSYVFFDPQR 175
            E  ++ +FD Q+
Sbjct: 556 KEEVTWRYFDYQK 568

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 102 QRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD-PKMEPVVSSD 160
           Q +  F  +TLF++FY + GT  Q L   EL  R W +++  + W  ++  K+ P +   
Sbjct: 416 QILTKFDLDTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYREVEKLPPGMEQ- 474

Query: 161 GLSERGSYVFFDPQR-W--EKCQREFL 184
              E  S+ +FD Q+ W   +C  +F+
Sbjct: 475 --KEEVSWRYFDYQKSWLARRCGPDFV 499

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 36.2 bits (82), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPKMEPVVSSDGLSER 165
           F  +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +E +      +E 
Sbjct: 473 FDLDTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKE--VEKLPPGMLQAEE 530

Query: 166 GSYVFFDPQ 174
            S+ +FD Q
Sbjct: 531 ESWRYFDYQ 539

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 36.2 bits (82), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 7/67 (10%)

Query: 112 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD--PKMEPVVSSDGLSERGSYV 169
           LFY FY     + QE+ Y  L +RNW+  KT + W ++   PK      S+ L E   + 
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSRHSLPKF-----SNELCEVADFK 721

Query: 170 FFDPQRW 176
            F+   W
Sbjct: 722 IFNLDDW 728

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 95  NSVQHDQQRVAL--FQDETLFYLFYKH--PGTVIQ-ELTYLELRKRNWRYHKTLKAWLTK 149
           ++   D+ R+ L  F+   +F LFY +  P T +Q +++ + L +R+W+  K    W  K
Sbjct: 543 DNTNEDKLRLVLERFRPTEIFTLFYHYYFPLTPLQKQISSILLIERDWKLLKNGTMWFLK 602

Query: 150 DPKMEPVVSSDGLSERGSYVFFDPQRWEKCQR-EFLLFYNAIM 191
             + EP  S++   E G+Y  F    W   ++  F L +N++M
Sbjct: 603 --QGEPKFSNESF-EVGNYKIFKADDWTVIEKFNFKLDFNSLM 642

>CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} similar
           to uniprot|P35187 Saccharomyces cerevisiae YMR190c SGS1
           DNA helicase
          Length = 1371

 Score = 32.3 bits (72), Expect = 0.87,   Method: Composition-based stats.
 Identities = 36/159 (22%), Positives = 66/159 (41%), Gaps = 12/159 (7%)

Query: 11  PLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPWAETSRSEVEP 70
           P IK ++ E   +     TL  ++ ++ H L    D     V    +S   ++ R+ +  
Sbjct: 217 PKIKSKQSEIEKMELKLETLSQEIKNISHILS---DISNENVFKNIKSQKFDSQRASITA 273

Query: 71  KFFIPD-----SFTNIPQVLQSQTTPPCFNSVQHDQQ-RVALFQDETLFYLFYKHPGTVI 124
              + D      F N          P   NSV   QQ  ++ FQ+E+L+   Y  P T  
Sbjct: 274 NNSLTDLQINEGFNNNITKNNRDFNPIPDNSVIRGQQVNMSSFQEESLYIDSYNEPNTQS 333

Query: 125 QELTYLELRKR---NWRYHKTLKAWLTKDPKMEPVVSSD 160
           +     ++R R   N+R  +  + +  +  K++P ++SD
Sbjct: 334 RAPYTRQMRDRHQINYRIPEADEPFEYRVGKLQPTIASD 372

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 52/125 (41%), Gaps = 13/125 (10%)

Query: 76  DSFTNIPQ--VLQSQTTPPCFNSVQHDQQRVALFQDE-------TLFYLFYKHPGTVIQE 126
           D+F +  Q  +L+    P   NS  +DQ++     +        TLFY +Y     + QE
Sbjct: 668 DAFRSTEQWDILRCSLRPIIQNSELNDQEKYEAILENFRSLEMFTLFYNYYFAVTPLEQE 727

Query: 127 LTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQR-EFLL 185
           +  + L +R+W+  K    W  +  + +    ++ L E   Y  F    W    R  F L
Sbjct: 728 IASIILSERDWKVSKNCAMWFLRQSETK---FANELCEVADYKIFKLDDWTVIDRLNFKL 784

Query: 186 FYNAI 190
            Y A+
Sbjct: 785 DYAAL 789

>TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa]
           {ON} Anc_7.214 YIL038C
          Length = 847

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVF 170
           TLFY +Y     + +E++ + L +R+WR       W ++  + +    SD L E G Y  
Sbjct: 725 TLFYNYYFSVTPLEKEVSMVVLAERDWRITNNETMWFSRQGEAKL---SDELYEIGDYRI 781

Query: 171 FDPQRW 176
           F  + W
Sbjct: 782 FSLEDW 787

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKD-PKMEPVVS 158
           F  +TLF++FY + GT  Q L   EL + R+W ++K    W  ++  K+ P ++
Sbjct: 480 FDLDTLFFIFYHYQGTYDQFLAARELSQNRHWLFNKVDSCWYFREIEKLPPTIN 533

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score = 30.8 bits (68), Expect = 2.4,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 14/83 (16%)

Query: 70   PKFFIPDSFTN---------IPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120
            PK  I D  T+         I  ++ S++  P    V H ++ + L   + +F+L     
Sbjct: 1148 PKVLILDECTSALDVTSAKKINDIIGSRSLAPVTIIVSHQKETIKLC--DKIFFLV---D 1202

Query: 121  GTVIQELTYLELRKRNWRYHKTL 143
            GTV    TY EL + NW + K L
Sbjct: 1203 GTVAMMGTYEELMENNWEFRKLL 1225

>Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038C
           (NOT3) - CCR4 trascriptional complex component [contig
           198] FULL
          Length = 763

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 112 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKD--PKMEPVVSSDGLSERGSYV 169
           LFY FY     + +E+ Y  L +R+W+  K+  +W ++   PK      S+ L E   + 
Sbjct: 674 LFYCFYYSITPLEREIAYTLLIERSWKVSKSGDSWFSRHGVPKF-----SNELCEVADFK 728

Query: 170 FFDPQRWEKCQR-EFLLFYNAI 190
            F+   W   ++  F L Y+ +
Sbjct: 729 IFNLDDWTVSEKLNFKLDYSIL 750

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVF 170
           TLFY +Y     + Q +  L L +RNW+  K+   W  +  + EP  +++ + E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLR--QGEPKFANE-VCEVADYKI 748

Query: 171 FDPQRWEKCQR-EFLLFYNAI 190
           F    W    +  F L Y A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

>NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {ON}
           Anc_7.214
          Length = 846

 Score = 29.6 bits (65), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 28/66 (42%), Gaps = 3/66 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVF 170
           TLFY +Y     + +E+  + L +RNW+       W     +  P+   + L E G Y  
Sbjct: 719 TLFYNYYFAVTPLEKEIANVILNERNWKVSFDETMWFL---RQGPIKFQNELCELGDYKI 775

Query: 171 FDPQRW 176
           F    W
Sbjct: 776 FKLDEW 781

>Smik_1.19 Chr1 complement(40912..41424) [513 bp, 170 aa] {ON}
           YAL044C (REAL)
          Length = 170

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 63  TSRSEVEPKFFIPDSFTN------IPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLF 116
           T+R     K F+ +S +N      +P +  SQ       + QH  + +A+ QD+T F   
Sbjct: 9   TTRIPTAGKLFLRNSSSNALNKNKLPFLYSSQGPQAVRYTTQH--EWIAVHQDKTAFVGI 66

Query: 117 YKHPGTVIQELTYLEL 132
            K+    + + TY+EL
Sbjct: 67  TKYATDALGDATYVEL 82

>KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q75AN0 Ashbya gossypii ADL108C ADL108Cp and
           some similarites with YIL038C uniprot|P06102
           Saccharomyces cerevisiae YIL038C NOT3 Subunit of the
           CCR4- NOT complex which is a global transcriptional
           regulator with roles in transcription initiation and
           elongation and in mRNA degradation
          Length = 758

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 27/66 (40%), Gaps = 3/66 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVF 170
           TLFY +Y     + Q +  L L++R WR  KT   W     +   V  S+   E   Y  
Sbjct: 641 TLFYHYYFSVTPLEQRICALLLKQREWRVLKTGDCWFL---RQGAVKFSNDQCEVADYKI 697

Query: 171 FDPQRW 176
           F    W
Sbjct: 698 FKMDIW 703

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,108,969
Number of extensions: 877361
Number of successful extensions: 2268
Number of sequences better than 10.0: 65
Number of HSP's gapped: 2250
Number of HSP's successfully gapped: 66
Length of query: 191
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 88
Effective length of database: 41,670,801
Effective search space: 3667030488
Effective search space used: 3667030488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)