Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C020007.348ON2131899281e-128
Kpol_530.337.348ON1951857641e-104
NCAS0A141407.348ON2241867521e-101
KLLA0D12386g7.348ON2111837421e-100
NDAI0A019107.348ON2141867401e-100
TPHA0F029507.348ON2161837382e-99
KAFR0B008607.348ON2281817296e-98
SAKL0F11330g7.348ON2081837191e-96
KLTH0H01298g7.348ON2141867173e-96
TBLA0E005207.348ON2091886992e-93
ZYRO0F11660g7.348ON1981866954e-93
ACL150W7.348ON2191836957e-93
Ecym_47257.348ON2341836924e-92
Smik_4.727.348ON1971826851e-91
YDL166C (FAP7)7.348ON1971826781e-90
Kwal_56.246357.348ON2261836802e-90
CAGL0I03366g7.348ON2121886731e-89
KNAG0C037707.348ON2231826732e-89
Skud_4.917.348ON1941826693e-89
Suva_4.807.348ON2061826609e-88
KAFR0C037902.667ON202140730.38
YML065W (ORC1)4.327ON91452750.44
KAFR0B025608.236ON23446720.62
KNAG0G018808.236ON22537701.1
Smik_11.2292.667ON20463701.2
Suva_13.924.327ON92352701.9
Kwal_56.236388.295ON492220692.5
Smik_13.794.327ON93952682.6
KAFR0A078802.26ON56155673.2
Ecym_62781.308ON30143673.3
Kpol_1033.248.295ON491522673.9
NDAI0E025908.590ON685120665.6
Kpol_1062.587.125ON49158648.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C02000
         (213 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   362   e-128
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   298   e-104
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   294   e-101
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   290   e-100
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   289   e-100
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   288   2e-99
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   285   6e-98
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   281   1e-96
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   280   3e-96
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   273   2e-93
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   272   4e-93
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   272   7e-93
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   271   4e-92
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   268   1e-91
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   265   1e-90
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   266   2e-90
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   263   1e-89
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   263   2e-89
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   262   3e-89
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   258   9e-88
KAFR0C03790 Chr3 complement(771996..772604) [609 bp, 202 aa] {ON...    33   0.38 
YML065W Chr13 (142210..144954) [2745 bp, 914 aa] {ON}  ORC1Large...    33   0.44 
KAFR0B02560 Chr2 (510628..511332) [705 bp, 234 aa] {ON} Anc_8.23...    32   0.62 
KNAG0G01880 Chr7 (420542..421219) [678 bp, 225 aa] {ON} Anc_8.23...    32   1.1  
Smik_11.229 Chr11 complement(379526..380140) [615 bp, 204 aa] {O...    32   1.2  
Suva_13.92 Chr13 (144893..147664) [2772 bp, 923 aa] {ON} YML065W...    32   1.9  
Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR1...    31   2.5  
Smik_13.79 Chr13 (139688..142507) [2820 bp, 939 aa] {ON} YML065W...    31   2.6  
KAFR0A07880 Chr1 complement(1577607..1579292) [1686 bp, 561 aa] ...    30   3.2  
Ecym_6278 Chr6 complement(526852..527757) [906 bp, 301 aa] {ON} ...    30   3.3  
Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 ...    30   3.9  
NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {O...    30   5.6  
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...    29   8.7  

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  362 bits (928), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 176/189 (93%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI
Sbjct: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             REGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK
Sbjct: 61  VDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT
Sbjct: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180

Query: 181 NELLERTKG 189
           NELLERTKG
Sbjct: 181 NELLERTKG 189

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  298 bits (764), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 157/185 (84%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           M  RR KPNLLITGTPGCGKST+CELLQRRL DYKYYNISDFAKEHDC++GYDE RKS+I
Sbjct: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             REG +IVDWHVNDVFPERLIDLVVVLRCDN+ILYDRL +R YHD+K
Sbjct: 61  VDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           IQENLDAEIMGVVLQDA +SY +EIVVELQSD+TEQMEANVDRIV W +LWLKQHK G T
Sbjct: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180

Query: 181 NELLE 185
           NEL E
Sbjct: 181 NELEE 185

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  294 bits (752), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 135/186 (72%), Positives = 159/186 (85%)

Query: 4   RRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYIVXX 63
           RR++PNLLITGTPGCGKSTTCELLQRRLP+YKYYNISDFAKEHDC+DGYD+ RKS+IV  
Sbjct: 5   RRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVDE 64

Query: 64  XXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAKIQE 123
                      R+G +I+DWHVNDVFPERLIDLV VLRCDN++LYDRL  R YHD KI+E
Sbjct: 65  DKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIEE 124

Query: 124 NLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQTNEL 183
           N+DAEIMGVVLQDA +SY +EIVVELQSD+TEQM+ANVDRIV W+K+WL+QH+DG TNEL
Sbjct: 125 NMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNEL 184

Query: 184 LERTKG 189
            ++ + 
Sbjct: 185 EDKQRN 190

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  290 bits (742), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (84%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           MEP RFKPN++++GTPGCGKSTTCELL RRLP+Y YYNISDFAKEHDC+DGYD+ARKS I
Sbjct: 1   MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             R+G  I+DWHVNDVFPERL+DLVVVLRCDN ILYDRL  R YH+AK
Sbjct: 61  VDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           I+EN+DAEIMGVVLQDA DSY QEIVVELQSD+TE+M+ NVDRI++W+++WLKQHK G T
Sbjct: 121 IEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  289 bits (740), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 156/186 (83%)

Query: 4   RRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYIVXX 63
           RR++PNLLITGTPG GKSTTCELLQRRLP+Y YYNISDFAKE+DC++GYD+ RKS+IV  
Sbjct: 7   RRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVDE 66

Query: 64  XXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAKIQE 123
                      R+G +IVDWHVND+FPERLIDLVVVLRCDN+ILYDRL  R YHD+KIQE
Sbjct: 67  DKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQE 126

Query: 124 NLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQTNEL 183
           NLDAEIMGVVLQDA +SY+QEIVVELQSD TEQMEANV+RIV W K+W+ QHK+G TNEL
Sbjct: 127 NLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNEL 186

Query: 184 LERTKG 189
             + K 
Sbjct: 187 QGKNKN 192

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  288 bits (738), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 156/183 (85%)

Query: 4   RRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYIVXX 63
           RR++PNLLITGTPGCGKSTTCELLQRRL DY YYNISDFAKEH+C+DG+DE RKS+IV  
Sbjct: 3   RRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVDE 62

Query: 64  XXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAKIQE 123
                      R+G  IVDWHVNDVFPERLIDLVVVLRCDN++LYDRLKSR YHD+KI E
Sbjct: 63  DKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKIDE 122

Query: 124 NLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQTNEL 183
           N+DAEIMGVVLQDA +SY QEIVVELQSD+TEQM+ NVD+IV W +LW+KQHK+G TNEL
Sbjct: 123 NMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNEL 182

Query: 184 LER 186
            ++
Sbjct: 183 SKK 185

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  285 bits (729), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 155/181 (85%)

Query: 2   EPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYIV 61
           E RR+ PNLL+TGTPGCGKSTTCELL RRLPDY Y+NIS+FA++H C+DGYDE+RKS+IV
Sbjct: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66

Query: 62  XXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAKI 121
                        R G +I+DWHVNDVFPERLIDLVVVLRCDN+IL+DRL  R YH++KI
Sbjct: 67  DDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126

Query: 122 QENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQTN 181
           QENLDAEIMGVVLQDA DSYEQEIVVELQS+STE+M+ANV+RIV+W+++WL QHK+G TN
Sbjct: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186

Query: 182 E 182
           E
Sbjct: 187 E 187

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  281 bits (719), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 131/183 (71%), Positives = 151/183 (82%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           ME +R +PN+L+TGTPGCGKSTTCELL RRL DY YYNISDFA+EH C+DGYDE RKS+I
Sbjct: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             R+G +IVDWHVNDVFPERLIDLVVVLRCDN+ILYDRL  R YHD+K
Sbjct: 61  VDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           I+ENLDAEIMGVV+QDA +SY QEIVVELQSD+ E M+ANVDRIV W+++WL QH +G T
Sbjct: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  280 bits (717), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 153/186 (82%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           M   RF PN+L+TGTPGCGK++TCELLQRRL D  YYNISDFA++H+C+DGYDEARKS+I
Sbjct: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             R+G AIVDWHVND+FPERLIDLVVVLR DNT+LYDRLKSR YH+AK
Sbjct: 61  VDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           IQEN+DAEIMGVV+QDA DSYE+EIVVELQSD+ +QM+ NVDRI SW   WL+Q+  G T
Sbjct: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180

Query: 181 NELLER 186
           NEL+ER
Sbjct: 181 NELVER 186

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  273 bits (699), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 131/188 (69%), Positives = 153/188 (81%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           M+ RR+ PNLLI+GTPG GKS+TCELL+R L DYKY NISDFAKE +C+DG+D+ RKS+I
Sbjct: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             REG  IVDWHVNDVFPERLIDLVV+LR DN++LYDRL++R YHDAK
Sbjct: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           +QENLDAEIMGVVLQDA DSY QEIV+ELQS++TE+M +NVDRIVSW +LW KQH DG T
Sbjct: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180

Query: 181 NELLERTK 188
           NEL E  K
Sbjct: 181 NELGEIKK 188

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  272 bits (695), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 148/186 (79%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           ME RR+ PN+LITGTPG GKSTT ELLQRRL D++YYNISDFA+E+DC DGYDE RKS+I
Sbjct: 1   MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             R+G  I+DWHVNDVFPERLIDLVVVLRC+N+IL+ RLK R YH  K
Sbjct: 61  VDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           I EN+DAEIMGVV+QDA DSYE+EIVVEL SDSTEQME NVDRIVSW +LW  QH  G T
Sbjct: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180

Query: 181 NELLER 186
           NEL E+
Sbjct: 181 NELHEQ 186

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  272 bits (695), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 126/183 (68%), Positives = 149/183 (81%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           M+  R +PN+L++GTPGCGKSTTCELLQR LPDY+Y+NISDFA+EH+C+DGYDEARKS+I
Sbjct: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             R G AIVDWHVND+FPERLIDLVVVLRCDN IL+DRL+ R YH +K
Sbjct: 61  VDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           I+EN+DAEIMGVVLQDA DSY +EIVVELQSD TEQM+ NVDRI +WE  W+ +H DG +
Sbjct: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180

Query: 181 NEL 183
           N L
Sbjct: 181 NAL 183

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  271 bits (692), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 126/183 (68%), Positives = 146/183 (79%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           M+  R +PN+++TGTPGCGK+TTCELLQRRL D +YYNISDFAKEHDC++GYDE RKS+I
Sbjct: 15  MDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             R+G AI+DWHVNDVFPERLIDLVVVLRCDN+ LYDRL  R YHDAK
Sbjct: 75  VDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           I+EN+DAEIMGVVLQDA DSY  +IVVELQS++  QME NV RIV+WE  W+ QH  G T
Sbjct: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194

Query: 181 NEL 183
           NEL
Sbjct: 195 NEL 197

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  268 bits (685), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 123/182 (67%), Positives = 148/182 (81%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           ME RR+ PN+++TGTPGCGKS+ CELL+ +L DYKYYNISDFAK+HDC +GYDE RKS+I
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             R+G +IVDWHVND+FPERLIDLVVVLRCDN+ LY RL +R YHD+K
Sbjct: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           I+ENLDAEIMGVV QDA +SYE  IVVELQSD+ E ME+NV RI++WEK+WL+QH +G T
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  265 bits (678), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 147/182 (80%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           ME RR+ PN+++TGTPGCGKS+TCE L+ +L DYKYYNISDFAK++DC +GYDE RKS+I
Sbjct: 1   MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             R+G +IVDWHVNDVFPERLIDLVVVLRCDN+ LY RL +R YHD+K
Sbjct: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           I+ENLDAEIMGVV QDA +SYE  IVVELQSD+ E M +NV RIV+WEK+WL+QH DG T
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  266 bits (680), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 144/183 (78%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           M   R  PN+L+TGTPGCGK++TCELLQRRL   KYYNISDFAKE+ C+DGYDEARKS+I
Sbjct: 1   MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             R G AIVDWHVNDVFPERLIDLVVVLR DN+ L+DRL  R YH+AK
Sbjct: 61  VDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           IQEN+DAEIMGVV+ DA DSY QEIVVELQSD+TEQM+ NVDRIV+W   W +QH +G T
Sbjct: 121 IQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  263 bits (673), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 127/188 (67%), Positives = 150/188 (79%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           M  RRF PN+++TGTPGCGKSTTCELLQRRL  YKYYNIS+FA+EH C+DGYDE RKS+I
Sbjct: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V              EG +I+DWHVNDVFPERLIDLVVVLR +N  LYDRLK+R YHD+K
Sbjct: 61  VDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           I+ENLDAEIMGVVLQDA +SYE EIVVELQS++TE ME NVDRI +W   W+++HKDG +
Sbjct: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180

Query: 181 NELLERTK 188
           +EL +  K
Sbjct: 181 SELKDGKK 188

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  263 bits (673), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 143/182 (78%)

Query: 2   EPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYIV 61
           E RR  PN+L+TGTPG GKSTTCELL R LPDY YYNISDFA ++ C+DGYDEARKS+IV
Sbjct: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62

Query: 62  XXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAKI 121
                          G  I+DWHVNDVFPERLIDLV VLRCD+++L+DRL  R+YH +KI
Sbjct: 63  DEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122

Query: 122 QENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQTN 181
            EN+DAEIMGVVLQDA DSYE++IVVELQSD TEQM ANVDR+V+W  +W +QH +G TN
Sbjct: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182

Query: 182 EL 183
           EL
Sbjct: 183 EL 184

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  262 bits (669), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 145/182 (79%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           ME RRF PN+++TGTPGCGKS+TCELL+  L  YKYYNISDFAK++DC + YDEARKS+I
Sbjct: 1   MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             R+G +I+DWHVNDVFPERLIDLVVVLRCDN+ LY RL +R YHD+K
Sbjct: 61  VDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           I+ENLDAEIMGVV QDA DSYE  IVVELQ D+ E M +NV RIV+WEK+WL+QH DG T
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  258 bits (660), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 120/182 (65%), Positives = 146/182 (80%)

Query: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60
           ME RR+ PN+++TGTPGCGKS+TCELL+  L  YKYYNISDFAK++DC +GYDE RKS+I
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120
           V             R+G +I+DWHVNDVFPERLIDLVVVLRCDN+ LY RL +R YHD+K
Sbjct: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120

Query: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180
           I+ENLDAEIMGVV QDA DSYE  IVVELQSD+ + + +NV RI++WEK+WL+QH +G T
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>KAFR0C03790 Chr3 complement(771996..772604) [609 bp, 202 aa] {ON}
           Anc_2.667 YKL024C possible ribosomal frameshifting
          Length = 202

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 28/140 (20%), Positives = 55/140 (39%), Gaps = 25/140 (17%)

Query: 10  LLITGTPGCGKSTTCELLQRRLPDYKYYNIS--DFAKEHDCHDG--YDEARKSYIVXXXX 65
           + + G PG GK T C  L   + DY + ++S  D  +     +G  +    K+YI     
Sbjct: 15  IFVLGGPGAGKGTQCAKL---VKDYGFVHLSAGDLLRAEQDREGSEFGSLIKNYIKEGLI 71

Query: 66  XXXXXXXXXREGAAIVDW------HVNDVFPERL------------IDLVVVLRCDNTIL 107
                     + A + ++      ++ D FP ++               V+   C  T++
Sbjct: 72  VPQEITIQLLKNAILENYEKGSTKYLVDGFPRKMDQAITFEQVIVKAKFVLFFDCSETVM 131

Query: 108 YDRLKSRDYHDAKIQENLDA 127
            +RL  R     +I +N+++
Sbjct: 132 LERLLERGKSSGRIDDNIES 151

>YML065W Chr13 (142210..144954) [2745 bp, 914 aa] {ON}  ORC1Largest
           subunit of the origin recognition complex, which directs
           DNA replication by binding to replication origins and is
           also involved in transcriptional silencing; exhibits
           ATPase activity
          Length = 914

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 10  LLITGTPGCGKSTTC-----ELL----QRRLPDYKYYNISDF--AKEHDCHD 50
           + + GTPG GK+ T      ELL    QR +PD+ Y  I+     K  DC++
Sbjct: 475 IYVAGTPGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYE 526

>KAFR0B02560 Chr2 (510628..511332) [705 bp, 234 aa] {ON} Anc_8.236
          YER170W
          Length = 234

 Score = 32.3 bits (72), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%)

Query: 1  MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEH 46
          M PR     LL+ G PG GK T  + L++ LP+    +  D  +E 
Sbjct: 1  MLPRINPLRLLLLGAPGSGKGTQTKKLKKLLPNILAISSGDLLREQ 46

>KNAG0G01880 Chr7 (420542..421219) [678 bp, 225 aa] {ON} Anc_8.236
          YER170W
          Length = 225

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 10 LLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEH 46
          LL+ G PG GK T  + L +R P+ K  +  D  +++
Sbjct: 10 LLLLGAPGAGKGTQTKRLIKRFPEIKAISSGDLLRKN 46

>Smik_11.229 Chr11 complement(379526..380140) [615 bp, 204 aa]
          {ON} YKL024C (REAL)
          Length = 204

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 11/63 (17%)

Query: 6  FKPN----LLITGTPGCGKSTTCELLQRRLPDYKYYNIS--DFAKEHDCHDG--YDEARK 57
          F P+    + + G PG GK T CE   R + D+ + ++S  D  +     +G  Y E  +
Sbjct: 11 FSPDQVSVIFVLGGPGAGKGTQCE---RLVKDFSFVHLSAGDLLRAEQSREGSQYGELIR 67

Query: 58 SYI 60
          +YI
Sbjct: 68 NYI 70

>Suva_13.92 Chr13 (144893..147664) [2772 bp, 923 aa] {ON} YML065W
           (REAL)
          Length = 923

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 10  LLITGTPGCGKSTTC-----ELL----QRRLPDYKYYNISDF--AKEHDCHD 50
           + + GTPG GK+ T      EL+    Q+ LPD+ Y  I+     K  DC++
Sbjct: 485 IYVAGTPGVGKTLTVREVVKELISSSAQQELPDFLYVEINGLKMVKPTDCYE 536

>Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR106C
            (MDN1) - Protein required for cell viability [contig 175]
            FULL
          Length = 4922

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 15/20 (75%)

Query: 10   LLITGTPGCGKSTTCELLQR 29
            +L+ G  GCGK+T C+L+ R
Sbjct: 1366 ILLVGETGCGKTTVCQLIAR 1385

>Smik_13.79 Chr13 (139688..142507) [2820 bp, 939 aa] {ON} YML065W
           (REAL)
          Length = 939

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 10  LLITGTPGCGKSTTC-----ELL----QRRLPDYKYYNISDF--AKEHDCHD 50
           + + GTPG GK+ T      ELL    Q+ +PD+ Y  I+     K  DC++
Sbjct: 503 IYVAGTPGVGKTLTVREVVKELLSSSTQQEIPDFLYVEINGLKMVKPTDCYE 554

>KAFR0A07880 Chr1 complement(1577607..1579292) [1686 bp, 561 aa]
           {ON} Anc_2.26 YNL218W
          Length = 561

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 8   PNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDG---YDEARKSY 59
           P++++ G PG GK++   LL +   + KYY I   A + +  +    +D A+K +
Sbjct: 156 PSMILWGPPGVGKTSLARLLTKSATN-KYYMIETSATKANTQELRSIFDRAKKEF 209

>Ecym_6278 Chr6 complement(526852..527757) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AEL156W
          Length = 301

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%)

Query: 4   RRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEH 46
           ++ KP LL+T T G       +L      D+ YY +S F  EH
Sbjct: 248 KQLKPELLLTATAGTSWEGMVDLHMEDGFDHSYYFVSSFVPEH 290

>Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 bp,
            4915 aa] {ON} complement(49973..58081,58083..64721)
            [14748 nt, 4916 aa]
          Length = 4915

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 10   LLITGTPGCGKSTTCELLQRRL 31
            +L+ G  GCGK+T C++L   L
Sbjct: 1362 ILLVGETGCGKTTVCQILAEHL 1383

>NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {ON}
           Anc_8.590
          Length = 685

 Score = 30.0 bits (66), Expect = 5.6,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 49/120 (40%), Gaps = 32/120 (26%)

Query: 77  GAAIVDWHVNDV-FPE--RLIDLVVVLRCDNTILYDRLKSRDYHDAKIQENLDAEIMGVV 133
           GA I  W +  V  PE    + + VVLRCD + L+   ++   HD K+QE          
Sbjct: 456 GADIAKWEITGVEVPEGEESVPVKVVLRCDPSGLHIIEEAYTVHDIKVQE---------- 505

Query: 134 LQDATDSYEQEIVVELQSDSTEQMEA---NVDRIVSWEKLWLKQHK----DGQTNELLER 186
                       VV L +D+ E  E     V + V  + L +  H     D   NEL+E+
Sbjct: 506 ------------VVPLPADAPEDAEPEFREVTKTVKKDSLTVVAHTFALDDKTLNELIEK 553

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score = 29.3 bits (64), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 113 SRDYHDAKIQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTE-QMEANVDRIVSWEK 169
           S DY + K+Q+  D+ +   + Q+  D Y+   V+EL++D+ +  + + +D+++   K
Sbjct: 160 SYDYENGKLQKCDDSNLKKYIFQELDDCYKVHNVIELKTDNIDVNLSSLLDKVLVVRK 217

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,619,128
Number of extensions: 752009
Number of successful extensions: 3481
Number of sequences better than 10.0: 44
Number of HSP's gapped: 3553
Number of HSP's successfully gapped: 44
Length of query: 213
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 108
Effective length of database: 41,441,469
Effective search space: 4475678652
Effective search space used: 4475678652
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)