Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C019907.349ON60660628630.0
ZYRO0F11682g7.349ON59762415830.0
Kwal_56.246387.349ON52751714490.0
NCAS0A141507.349ON57052514030.0
Suva_4.797.349ON70839213461e-178
YDL167C (NRP1)7.349ON71939013421e-177
Smik_4.717.349ON75939113331e-175
Skud_4.907.349ON70739213261e-175
SAKL0F11352g7.349ON58337513061e-174
KAFR0B008707.349ON54252612981e-173
KLTH0H01276g7.349ON55742412561e-166
Kpol_530.327.349ON68442112231e-160
KLLA0D12364g7.349ON63164812081e-158
ACL149W7.349ON62843411821e-154
TPHA0F029607.349ON65439711011e-142
KNAG0C037807.349ON53837610681e-138
NDAI0A019007.349ON56551210431e-134
CAGL0I03344g7.349ON6036007981e-97
TBLA0E020607.349ON564301511e-09
KLLA0B08976g3.379ON30536820.19
Kpol_1039.503.379ON296137790.50
Kwal_27.103648.822ON44355790.55
NDAI0G040203.57ON39379780.70
Kwal_56.234868.229ON587122770.92
Kpol_1076.93.57ON51677771.1
KAFR0B045402.167ON22078722.5
SAKL0E10604g2.167ON22129722.8
TPHA0P012903.57ON36777732.9
TDEL0A009402.52ON68231733.2
CAGL0G05511g2.52ON67494733.2
NCAS0G025802.167ON22430704.1
CAGL0D05236g7.188ON44335724.1
NDAI0F027202.167ON22682704.2
Kpol_1069.88.822ON44997714.3
TBLA0B006002.52ON73431724.3
TPHA0H015205.382ON494111714.6
Kwal_23.45972.52ON66431715.2
KNAG0C006501.60ON74897715.9
KLTH0B07546g2.52ON63931716.0
SAKL0H17952g8.229ON58949706.6
KLTH0D01826g7.57ON132455707.0
NCAS0A027304.298ON35399689.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C01990
         (606 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...  1107   0.0  
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   614   0.0  
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   562   0.0  
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   545   0.0  
Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   523   e-178
YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   521   e-177
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   518   e-175
Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   515   e-175
SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   507   e-174
KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   504   e-173
KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...   488   e-166
Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   475   e-160
KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...   469   e-158
ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...   459   e-154
TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...   428   e-142
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   416   e-138
NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   406   e-134
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   311   1e-97
TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...    63   1e-09
KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {O...    36   0.19 
Kpol_1039.50 s1039 complement(146455..147322,147425..147447) [89...    35   0.50 
Kwal_27.10364 s27 (303432..304763) [1332 bp, 443 aa] {ON} YMR268...    35   0.55 
NDAI0G04020 Chr7 (957452..958633) [1182 bp, 393 aa] {ON} Anc_3.57      35   0.70 
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    34   0.92 
Kpol_1076.9 s1076 complement(18964..20514) [1551 bp, 516 aa] {ON...    34   1.1  
KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.16...    32   2.5  
SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar...    32   2.8  
TPHA0P01290 Chr16 complement(260217..261320) [1104 bp, 367 aa] {...    33   2.9  
TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {O...    33   3.2  
CAGL0G05511g Chr7 complement(522026..524050) [2025 bp, 674 aa] {...    33   3.2  
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    32   4.1  
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    32   4.1  
NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167      32   4.2  
Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON} (14170.....    32   4.3  
TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {O...    32   4.3  
TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.3...    32   4.6  
Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {O...    32   5.2  
KNAG0C00650 Chr3 (110325..112571) [2247 bp, 748 aa] {ON} Anc_1.6...    32   5.9  
KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some s...    32   6.0  
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    32   6.6  
KLTH0D01826g Chr4 complement(175846..179820) [3975 bp, 1324 aa] ...    32   7.0  
NCAS0A02730 Chr1 (522320..523381) [1062 bp, 353 aa] {ON} Anc_4.2...    31   9.5  

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score = 1107 bits (2863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/606 (88%), Positives = 539/606 (88%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY
Sbjct: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120

Query: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEITEKPVLGYTVDILLQLCER 180
           DRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEITEKPVLGYTVDILLQLCER
Sbjct: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEITEKPVLGYTVDILLQLCER 180

Query: 181 CTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVGF 240
           CTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVGF
Sbjct: 181 CTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVGF 240

Query: 241 WTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNMAN 300
           WTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNMAN
Sbjct: 241 WTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNMAN 300

Query: 301 TKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACF 360
           TKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACF
Sbjct: 301 TKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACF 360

Query: 361 RCSFPAASAVQVNNKQYMNYNGNINSTNQGGNIYITKVGGSPTQSHYQINTQLPQTQAVR 420
           RCSFPAASAVQVNNKQYMNYNGNINSTNQGGNIYITKVGGSPTQSHYQINTQLPQTQAVR
Sbjct: 361 RCSFPAASAVQVNNKQYMNYNGNINSTNQGGNIYITKVGGSPTQSHYQINTQLPQTQAVR 420

Query: 421 TNANYNDQNSLKHSNSAYRFNGNNGGNSPIMNYSNNRFXXXXXXXXXXXXXXXXXPFRAG 480
           TNANYNDQNSLKHSNSAYRFNGNNGGNSPIMNYSNNRF                 PFRAG
Sbjct: 421 TNANYNDQNSLKHSNSAYRFNGNNGGNSPIMNYSNNRFNGQQVNNSNVNNGGSNVPFRAG 480

Query: 481 DWKCPTCTYHNFAKNLVCLRCGAAKVSIXXXXXXXXXVAXXXXXXXXXXXXXXXXXXXXX 540
           DWKCPTCTYHNFAKNLVCLRCGAAKVSI         VA                     
Sbjct: 481 DWKCPTCTYHNFAKNLVCLRCGAAKVSISDSNNDDNSVARSISNGNNNNNNNNNGNNGSI 540

Query: 541 XXXXXXXXLGNLVXXXXXXXXXXXXHDLGSNKRGNGYFTKRVGNLNENELGITLNTRSSS 600
                   LGNLV            HDLGSNKRGNGYFTKRVGNLNENELGITLNTRSSS
Sbjct: 541 YNRYGNGSLGNLVSTASSTASSAATHDLGSNKRGNGYFTKRVGNLNENELGITLNTRSSS 600

Query: 601 EPKWQK 606
           EPKWQK
Sbjct: 601 EPKWQK 606

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/624 (53%), Positives = 408/624 (65%), Gaps = 47/624 (7%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           M+YVVLEVE  H IE PKD  R+ K+SYQF++AE+++ +Y ++Q PL  + +  S +  E
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETLQVHYQENQAPLHIISENDSTNLHE 60

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           ++A  + ++  I G++ FVLCSL STWH+RVT+ RQARD+ F LPSYLQHP++FDLWKEY
Sbjct: 61  AVANLNEEINRIAGDEPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKIFDLWKEY 120

Query: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEITEKPV-LGYTVDILLQLCE 179
           +RWC NHPEV+ LRK+   G +R+KD  E+ +VL+++     +    L  +V+ILL+L +
Sbjct: 121 ERWCVNHPEVMPLRKN---GGRRMKDVAELARVLDINGLNFNDSSFDLSRSVEILLRLHQ 177

Query: 180 RCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVG 239
           RC+T ED++ VL+ PYDSH+D+RNFLQE SKVLYLNNLPPDTTQSELESWFTQFGARPVG
Sbjct: 178 RCSTPEDMAMVLTHPYDSHMDVRNFLQECSKVLYLNNLPPDTTQSELESWFTQFGARPVG 237

Query: 240 FWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNMA 299
           FWTVKNIVEET+N+NN WSMNNSPYVEEQDSISGFVVFQTHEEATEVL LNGRSILSNMA
Sbjct: 238 FWTVKNIVEETSNVNNNWSMNNSPYVEEQDSISGFVVFQTHEEATEVLTLNGRSILSNMA 297

Query: 300 NTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTAC 359
           NTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTAC
Sbjct: 298 NTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTAC 357

Query: 360 FRCSFPAASAVQVNNKQYMNYNGNINSTNQGGNIYITKVGGSPTQSHYQINTQ------L 413
           FRCSFPA +AVQVN KQY+       S     N+   K+  SP+Q++Y +N         
Sbjct: 358 FRCSFPATTAVQVNTKQYI-------SGGPAANLQNGKITPSPSQTYYPLNVTPTQTVPT 410

Query: 414 PQTQAVRTNANYNDQN-SLKHSNSA-------YRFNGNNGGN-----SPIMNYSNNRFXX 460
           PQ++   T   + DQ+ ++ H   A       YR+ G    N         N + N    
Sbjct: 411 PQSRHNTTMTPHMDQSMAMLHGTGAAGAGGNNYRYPGAQSLNFVANNVNNGNGNGNNNSG 470

Query: 461 XXXXXXXXXXXXXXXPFRAGDWKCPTCTYHNFAKNLVCLRCGAAKVSIXXXXXXXXXVAX 520
                          PFRAGDWKCP+C YHNFAKN+VCLRCG  K++             
Sbjct: 471 SNNRYNGQGNGGSNVPFRAGDWKCPSCIYHNFAKNVVCLRCGGPKITAVDLENAATTSNN 530

Query: 521 XXXXXXXXXXXXXXXXXXXXXXXXXXXXLGNLVXXXXXXXXXXXXHDLGSNKRGNGYFTK 580
                                       +G+ V                S+K  NG  T 
Sbjct: 531 INNNNGVNQHDAKVVAKNNSVSLLDLTSMGSTVSL--------------SDKLPNGNATS 576

Query: 581 RVGNLNENELGITLNTRSSSEPKW 604
                  +  G+ L++RS SEPKW
Sbjct: 577 SAA---YDGFGVALDSRSVSEPKW 597

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/517 (58%), Positives = 362/517 (70%), Gaps = 47/517 (9%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           MHYVVLEV+  HR ++PKD  ++    YQF+D E +K+ + +++  ++    +   S QE
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTEELKSVFQENKHIVL----ENGCSLQE 56

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           ++++ ++D+   + +D+FVLCSL STWH RVTIPRQARDE F+LP +LQHPRVFDLWKEY
Sbjct: 57  AVSQLEKDIGEHL-KDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRVFDLWKEY 115

Query: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEM------STEEITEKPVLGYTVDIL 174
           DRWC NHPE L LR+S   G K+VKD  E+  VLE+      ST    E   L  T+ I+
Sbjct: 116 DRWCVNHPETLALRRSNSMG-KKVKDVAELRSVLELDSATQDSTPGAAEPDALEQTIAII 174

Query: 175 LQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFG 234
            QL ++C T ED S VL+ PYDS+LD+RNFLQE+SKVLY+NNLPPDTTQSELESWFTQFG
Sbjct: 175 RQLHKKCVTAEDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFG 234

Query: 235 ARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSI 294
           ARPVGFWTVKNIVEET+N+NN WS NNS YVE QDSISGFVVFQ+HEEATE L LNGRSI
Sbjct: 235 ARPVGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSI 294

Query: 295 LSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQ 354
           LSN+ANTKQPRV+EHIVE+QPSS RVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQ
Sbjct: 295 LSNIANTKQPRVIEHIVEVQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQ 354

Query: 355 RRTACFRCSFPAASAVQVNNKQYMNYNGNINSTNQGGNIYITKVGGSPTQSHYQINTQ-- 412
           RRT+CFRCSFP+  +  +NN  Y      + +T Q  NI   +VGG   Q+ Y++ T   
Sbjct: 355 RRTSCFRCSFPSTGSAPMNNTGY------VKNTMQPHNI---QVGGQ-QQAAYKMRTAAG 404

Query: 413 LP--QTQAVRTNANYNDQNSLKHSNSAYRFNGNN--GGNSPIMNYSNNRFXXXXXXXXXX 468
           +P  QTQA       +     +      RFN     G N      SN             
Sbjct: 405 IPPVQTQASSQMGQPHMAQQHQQQQQRMRFNQGPRFGQNQQPQGGSN------------- 451

Query: 469 XXXXXXXPFRAGDWKCPTCTYHNFAKNLVCLRCGAAK 505
                  PFRAGDWKC TCTYHNFAKN+VCLRCG  K
Sbjct: 452 ------VPFRAGDWKCATCTYHNFAKNVVCLRCGGPK 482

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQYMN 379
           R GDW C +C + NF +   C RC  P ++  Q      +N
Sbjct: 455 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKGSAAVN 495

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/525 (53%), Positives = 362/525 (68%), Gaps = 38/525 (7%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLD-QQGSISFQ 59
           M YVVLE+E +H++E PKDH R+ K SYQFI++E+++A + + +    S+D    + +F+
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSETLQATFEEPK----SIDIPDMANAFK 56

Query: 60  ESIAKFDRDVMS-IVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWK 118
           ++I++ + D+ + IV   +FVLCSL+S W IRVT+PRQA D GF+LPSYL+HPRVF+LWK
Sbjct: 57  DTISQLEADIKAEIVDFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPRVFNLWK 116

Query: 119 EYDRWCANHPEVLTLRKSCR--TGIKRVKDQTEILKVLEMSTEE----ITEKPVLGYTV- 171
           E+D+WC NHPEV+ +RKS       K   D ++I+ +LE+ T       T  P    ++ 
Sbjct: 117 EFDKWCGNHPEVIPMRKSNLRVKSPKTAGDISDIVNILEIDTSLQVPLSTSNPQTLLSIQ 176

Query: 172 ---DILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELES 228
              +IL +L ++CTT +D+  VL+RPYDS+ DI+ FLQE+S+VLY+NNLP DTTQSELES
Sbjct: 177 DSTNILTKLRKKCTTLDDVQLVLTRPYDSYADIKTFLQERSRVLYMNNLPSDTTQSELES 236

Query: 229 WFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLV 288
           WFTQFGARP+GFWT KN +EET++IN+ WS+N +P V+EQD ++GFVVFQ+HEEATE LV
Sbjct: 237 WFTQFGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCVAGFVVFQSHEEATEALV 296

Query: 289 LNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSC 348
           LNGRSILSN+ANTKQPRVVEHIVEIQPSSTRVLD  Q+ILS FPQSKNKPRPGDW+CPSC
Sbjct: 297 LNGRSILSNIANTKQPRVVEHIVEIQPSSTRVLDAGQDILSAFPQSKNKPRPGDWSCPSC 356

Query: 349 GFSNFQRRTACFRCSFPAASAVQVNNKQYMNYNG--NINSTNQGGNIYITKVGGSPTQSH 406
           GFSNFQRRTACFRCSFPA      NN + +N +G  NI STNQ            P  + 
Sbjct: 357 GFSNFQRRTACFRCSFPAP-----NNNKGLNISGTSNIASTNQ-----------MPVVNR 400

Query: 407 YQINTQLPQTQAVRTNANYNDQNS-LKHSNSAYR---FNGNNGGNSPIMNYSNNRFXXXX 462
            Q    +PQ+     +  +   N  L  SNS  R   F  N   N+   N +        
Sbjct: 401 IQSTFPIPQSHQSSISQTFQQYNKPLTPSNSGSRTQNFRHNGSNNTNNNNNNRYNTNSQF 460

Query: 463 XXXXXXXXXXXXXPFRAGDWKCPTCTYHNFAKNLVCLRCGAAKVS 507
                        PFRAGDWKCP+CTYHNFAKN+VCLRC   K+S
Sbjct: 461 SMTSGGITTGSNVPFRAGDWKCPSCTYHNFAKNVVCLRCRIPKIS 505

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  523 bits (1346), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 252/392 (64%), Positives = 317/392 (80%), Gaps = 19/392 (4%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           MHYVVLE++  H  ++PKD  R+  ++YQ +DAE++ ++Y +   P I +D +   S + 
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKK-SLES 59

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           ++ + D+D+  I+G D+FVL SL STWHIRVT+PRQARD+GF+L SYLQHPR+FDLWKE+
Sbjct: 60  AMGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEF 119

Query: 121 DRWCANHPEVLTLRKSCR------------TGIKRVKDQTEILKVLEM--STEE----IT 162
           +RWC NHPE++ LRK+              T IK  KD  E++++LE+  + EE    + 
Sbjct: 120 ERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALD 179

Query: 163 EKPVLGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTT 222
              +L  T+D+LLQL ++C++ ED+  VL++PYDSH DIR+FLQE+SKVLY+NNLPPDTT
Sbjct: 180 NHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTT 239

Query: 223 QSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEE 282
           QSELESWFTQ+GARPVGFWTVKNIVE+T+N+NN WS+NNSPYVE+QDSISGFVVFQTHEE
Sbjct: 240 QSELESWFTQYGARPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEE 299

Query: 283 ATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGD 342
           ATEVL LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD+AQEILSPFPQSKNKPRPGD
Sbjct: 300 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 359

Query: 343 WNCPSCGFSNFQRRTACFRCSFPAASAVQVNN 374
           WNCPSCGFSNFQRRTACFRCSFPA S  Q++N
Sbjct: 360 WNCPSCGFSNFQRRTACFRCSFPAPSNSQMHN 391

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 478 RAGDWKCPTCTYHNFAKNLVCLRC 501
           R GDW CP+C + NF +   C RC
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRC 379

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 19/39 (48%)

Query: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQY 377
           R GDW C +C + NF +   C RC  P +    V+   +
Sbjct: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNH 601

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  521 bits (1342), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 251/390 (64%), Positives = 313/390 (80%), Gaps = 18/390 (4%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           MHYVVLE++  H  + PKD  R+  +++Q ++AE++  +Y  + +P I ++   + S + 
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGT-TKSLES 59

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           ++ + D+D+  ++G D+FVL SLYSTWHIRVT+PRQARD+GF+L SYLQHP+VFDLWKE+
Sbjct: 60  AMVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEF 119

Query: 121 DRWCANHPEVLTLRKS-----CRT------GIKRVKDQTEILKVLEMS--TEEITEKP-- 165
           DRWC NHPE+L  +K+     C T        K  KD  EI+++LE+S  TEE    P  
Sbjct: 120 DRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEI 179

Query: 166 --VLGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQ 223
             +L  T DIL+QL ++CT+ ED+  VL++PYDSH DIR FLQE+SK+LY+NNLPPDTTQ
Sbjct: 180 YSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQ 239

Query: 224 SELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEA 283
           SELESWFTQ+G RPVGFWTVKNIVE+T+N+NN WS+NNSPYVE+QDSISGFVVFQTHEEA
Sbjct: 240 SELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEA 299

Query: 284 TEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDW 343
           TEVL LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD+AQEILSPFPQSKNKPRPGDW
Sbjct: 300 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 359

Query: 344 NCPSCGFSNFQRRTACFRCSFPAASAVQVN 373
           NCPSCGFSNFQRRTACFRCSFPA S  Q++
Sbjct: 360 NCPSCGFSNFQRRTACFRCSFPAPSNSQIH 389

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 26/30 (86%), Positives = 27/30 (90%)

Query: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAK 505
           PFRAGDWKC TCTYHNFAKN+VCLRCG  K
Sbjct: 579 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 608

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 3/66 (4%)

Query: 339 RPGDWNCPSCGFSNFQRRTACFRCSFP---AASAVQVNNKQYMNYNGNINSTNQGGNIYI 395
           R GDW C +C + NF +   C RC  P   +  A + N+    +  G  + T    NI +
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNNISV 640

Query: 396 TKVGGS 401
              GGS
Sbjct: 641 NTNGGS 646

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 478 RAGDWKCPTCTYHNFAKNLVCLRC 501
           R GDW CP+C + NF +   C RC
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRC 378

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  518 bits (1333), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 252/391 (64%), Positives = 310/391 (79%), Gaps = 19/391 (4%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           MHYVVLE++  H   +PKD  R+  ++YQF+DAE++  +Y ++ +P I +D++ + S + 
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAETLACHYENNSLPNIEVDRE-TRSLET 59

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           ++ + D+ +  I+G DEFVL SLYSTWHIRVT+PRQARD+GF+L SYLQHP++FDLWKE+
Sbjct: 60  AMIQLDKAIQDILGNDEFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKLFDLWKEF 119

Query: 121 DRWCANHPEVLTLRKSCRTG------------IKRVKDQTEILKVLEMS--TEEITEKP- 165
           DRWC NHPE+L   K+                 K  KD  E++++LE+S  TEE    P 
Sbjct: 120 DRWCVNHPEILEQMKTASNNNNSGTKGNSGGLAKNAKDLDEMIRILEISSSTEEAVSVPE 179

Query: 166 ---VLGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTT 222
              +L  T DIL+ L  +C + ED+  VL++PYDSH DIR FLQE+SKVLY+NNLPPDTT
Sbjct: 180 EYSLLRRTTDILIHLHRKCCSSEDMKFVLTQPYDSHTDIRTFLQERSKVLYMNNLPPDTT 239

Query: 223 QSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEE 282
           QSELESWFTQ+G RPVGFWTVKNIVE+T+NINN WS+NNSPYVE+QDSISGFVVFQTHEE
Sbjct: 240 QSELESWFTQYGVRPVGFWTVKNIVEDTSNINNNWSLNNSPYVEDQDSISGFVVFQTHEE 299

Query: 283 ATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGD 342
           ATEVL LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD+AQEILSPFPQSKNKPRPGD
Sbjct: 300 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 359

Query: 343 WNCPSCGFSNFQRRTACFRCSFPAASAVQVN 373
           WNCPSCGFSNFQRRTACFRCSFPA S +Q +
Sbjct: 360 WNCPSCGFSNFQRRTACFRCSFPAPSNIQTH 390

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 26/30 (86%), Positives = 27/30 (90%)

Query: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAK 505
           PFRAGDWKC TCTYHNFAKN+VCLRCG  K
Sbjct: 619 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 648

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 19/39 (48%)

Query: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQY 377
           R GDW C +C + NF +   C RC  P + +   N   +
Sbjct: 621 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVSTDANETNH 659

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 478 RAGDWKCPTCTYHNFAKNLVCLRC 501
           R GDW CP+C + NF +   C RC
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRC 379

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  515 bits (1326), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 250/392 (63%), Positives = 310/392 (79%), Gaps = 20/392 (5%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           MHYVVLE++  +  ++PKD  R+  ++YQ +DAE++  +Y  D +P I +D +   S + 
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAK-SLES 59

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           ++ + D+D+  ++G DEFVL SL STWHIRVT+ RQARD+GF+L SYLQHPR+FDLWKE+
Sbjct: 60  AMIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEF 119

Query: 121 DRWCANHPEVLTLRKSCRTG-------------IKRVKDQTEILKVLEMSTEE------I 161
           DRWC NHPE+L  RK+                  K  KD  E++++LE+ST         
Sbjct: 120 DRWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIP 179

Query: 162 TEKPVLGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDT 221
            E+ +L  T DILLQL ++C++ ED+  VL++PYDS+ DIR FLQE+SKVLY+NNLPPDT
Sbjct: 180 EEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDT 239

Query: 222 TQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHE 281
           TQSELESWFTQ+G RPVGFWTVKNIVE+T+N+NN WS+NNSPYVEEQDSISGFVVFQTHE
Sbjct: 240 TQSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEEQDSISGFVVFQTHE 299

Query: 282 EATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPG 341
           EATEVL LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD+AQEILSPFPQSKNKPRPG
Sbjct: 300 EATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPG 359

Query: 342 DWNCPSCGFSNFQRRTACFRCSFPAASAVQVN 373
           DWNCPSCGFSNFQRRTACFRCSFPA S +Q++
Sbjct: 360 DWNCPSCGFSNFQRRTACFRCSFPAPSNIQMH 391

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 26/30 (86%), Positives = 27/30 (90%)

Query: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAK 505
           PFRAGDWKC TCTYHNFAKN+VCLRCG  K
Sbjct: 581 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 610

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 478 RAGDWKCPTCTYHNFAKNLVCLRC 501
           R GDW CP+C + NF +   C RC
Sbjct: 357 RPGDWNCPSCGFSNFQRRTACFRC 380

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 17/35 (48%)

Query: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVN 373
           R GDW C +C + NF +   C RC  P +     N
Sbjct: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADAN 617

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  507 bits (1306), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 258/375 (68%), Positives = 298/375 (79%), Gaps = 12/375 (3%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           M+YVVLE E  H  E PKDH RV+++ YQFI ++++++ +     P+I   + G    +E
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQ---PIIV--EVGPGQLRE 55

Query: 61  SIAKFDRDVMSIVGED--EFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWK 118
            +A+ D+ V S +  D  EF L SL STWHIRVTIPRQARDEGF+LP YLQHP+VFDLWK
Sbjct: 56  QVAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWK 115

Query: 119 EYDRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEITEKPVLGYTVDILLQLC 178
           EYDRWC NHPE L LRK+   G K+ +D  E+ +VLE   +       L  T+ IL QL 
Sbjct: 116 EYDRWCVNHPETLPLRKNSNLG-KKSRDLPELSRVLEAPLQTFP----LDQTIGILSQLH 170

Query: 179 ERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPV 238
           ++C   ED S VL+ PYDS+LD+R FLQE+SKVLY+NNLPPDTTQSELESWFTQFGARPV
Sbjct: 171 KKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPV 230

Query: 239 GFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNM 298
           GFWTVKN+VEET+N+NN WS NNS YVEEQDSISGFVVFQTHEEATE L LNGRSILSNM
Sbjct: 231 GFWTVKNVVEETSNVNNNWSCNNSSYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNM 290

Query: 299 ANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTA 358
           ANTKQPRVVEH+VE+QPSSTRVLDRA E+LSPFPQSKNKPRPGDWNCPSCGFSNFQRRTA
Sbjct: 291 ANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTA 350

Query: 359 CFRCSFPAASAVQVN 373
           CFRCSFPA SAV VN
Sbjct: 351 CFRCSFPATSAVNVN 365

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%)

Query: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAK 505
           PFRAGDWKC +CTYHNFAKN+VCLRCG  K
Sbjct: 498 PFRAGDWKCVSCTYHNFAKNVVCLRCGGPK 527

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 16/30 (53%)

Query: 478 RAGDWKCPTCTYHNFAKNLVCLRCGAAKVS 507
           R GDW CP+C + NF +   C RC     S
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATS 360

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 339 RPGDWNCPSCGFSNFQRRTACFRCSFP 365
           R GDW C SC + NF +   C RC  P
Sbjct: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  504 bits (1298), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 260/526 (49%), Positives = 332/526 (63%), Gaps = 58/526 (11%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           M YV+LE++  H++E PKDH R+ K+++Q ++A ++       ++  I +D+Q   SF+ 
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGE--VPTKVDQIVIDEQAE-SFKA 57

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           +  K +  + SI  +  F+LCSL+STW IRVT+ RQARD G  +P +LQ+P++FDL KEY
Sbjct: 58  AFEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEY 117

Query: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQT--------------EILKVLEMSTEEITEKPV 166
            RWC NHPEV++ +    +      D+               ++    E +   I +K  
Sbjct: 118 QRWCLNHPEVMSWKPKLESDKTINMDKKKLGLLELLTVLGLEDMYNFKEENDGAIDDKMF 177

Query: 167 -----LGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDT 221
                +  +  +LLQL  RCTT +D  +VL+ PYDS  D+R+FLQE+S+VLY+NNLP DT
Sbjct: 178 KNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDT 237

Query: 222 TQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHE 281
           TQSELESWFTQFG RPVGFWT KN+V +T+++ N W+ NNSPYVEE DSI GFVVFQTHE
Sbjct: 238 TQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHE 297

Query: 282 EATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPG 341
           EA EVL LNGR+ILSN+ANTKQPRVVEH+VEIQPSST VLD+A EILS FPQSKNKPRPG
Sbjct: 298 EAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPG 357

Query: 342 DWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQYMNYNGNINSTNQGGNIYITKVGGS 401
           DW+CPSCGFSNFQRRTACFRCSFPA S            NG+IN  +Q  + +       
Sbjct: 358 DWSCPSCGFSNFQRRTACFRCSFPAPS------------NGHINIKSQNNSHHPEITSEH 405

Query: 402 PTQSHYQINTQLPQTQAVRTNANYNDQNSLKHSNSAYRFNGNNGGNSPIMNYSNNRFXXX 461
            T+   Q NT        R NA++N        NS YR+N           Y N      
Sbjct: 406 NTEGSQQNNTN-------RANASFN--------NSMYRYN---------TRYVNGSSYNQ 441

Query: 462 XXXXXXXXXXXXXXPFRAGDWKCPTCTYHNFAKNLVCLRCGAAKVS 507
                         PFRAGDW C +CTYHNFAKN++CLRCG  K S
Sbjct: 442 MNNNNHNNNTGSNIPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%)

Query: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAV 370
           R GDWNC SC + NF +   C RC  P  S +
Sbjct: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score =  488 bits (1256), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 254/424 (59%), Positives = 307/424 (72%), Gaps = 53/424 (12%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           MHYVVLEVE  HR ++PKD  ++ K +YQF+D E+++  + +++     ++     + Q+
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENK----HVELGNGCTLQD 56

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           ++A+ ++D+ S   +D+FVLCSL STWH RVTIPRQARDE F+LP +LQHP+VFDLWKEY
Sbjct: 57  AVAQLEKDI-SEHAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEY 115

Query: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVL-------------------------- 154
           DRWC NHPE   +R++     KR KD  E+  VL                          
Sbjct: 116 DRWCMNHPETSAMRQNPLG--KRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQS 173

Query: 155 -----------------EMSTEEIT--EKP-VLGYTVDILLQLCERCTTKEDISDVLSRP 194
                            E+S+ E +  E+P  +   V I+ QL ++C T +D S VL+ P
Sbjct: 174 GAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHP 233

Query: 195 YDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETANIN 254
           YDS+LD+RNFLQE+SKVLY+NNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEET+N+N
Sbjct: 234 YDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVN 293

Query: 255 NKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNMANTKQPRVVEHIVEIQ 314
           N WS NNS YVE QDSISGFVVFQ+HEEATE L LNGRSILSN+ANTKQPRV+EHIVEIQ
Sbjct: 294 NNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQ 353

Query: 315 PSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNN 374
           PSS RVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRCSFPAAS   +NN
Sbjct: 354 PSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNN 413

Query: 375 KQYM 378
             YM
Sbjct: 414 NGYM 417

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 25/57 (43%)

Query: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQYMNYNGNINSTNQGGNIYI 395
           R GDW C +C + NF +   C RC  P ++  Q      +N   +I     G  I +
Sbjct: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIGNGMGISL 547

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  475 bits (1223), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 237/421 (56%), Positives = 304/421 (72%), Gaps = 44/421 (10%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           M+Y+V+E +  H +E PKDH R++KLSYQF+DAES++ YY  D++ +IS+D + +ISF++
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
            I + D D+ ++VG+DEFV CSL S W +RVTIPRQARDE   LP YLQ  +VFDLWKE+
Sbjct: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120

Query: 121 DRWCANHPEVLTLRKS-------------CRTGIKRVKDQTEILKVLEMSTE-------- 159
           +RW  NH + +T++KS               T  K   +  EI +  +   E        
Sbjct: 121 NRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKTTVETKEIEENSDKEDEVHANTGAE 180

Query: 160 ---------------------EITEKPV-LGYTVDILLQLCERCTTKEDISDVLSRPYDS 197
                                E+ E P+ +    +IL  + ++CTT+EDI+ VL++PYDS
Sbjct: 181 ESGNATITTAADDDNNEDDSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYDS 240

Query: 198 HLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETANINNKW 257
           + D + F +E SK+LY+NNLPPDTTQSELESWF QFG++PV FWTVKNIVEET+N+NN W
Sbjct: 241 NSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETSNVNNNW 300

Query: 258 SMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSS 317
           SMNNSPYVEEQDSISGFV FQ+H+EAT+ L+LNGRSILSNMANTKQPRVVEHIVEIQPSS
Sbjct: 301 SMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSS 360

Query: 318 TRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQY 377
             VL+R Q+I +PFPQSKNKPRPGDWNC SCGFSNFQRRTACFRCS+PAAS   +N+++Y
Sbjct: 361 VTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN-NLNSRKY 419

Query: 378 M 378
           +
Sbjct: 420 V 420

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score =  469 bits (1208), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 286/648 (44%), Positives = 368/648 (56%), Gaps = 69/648 (10%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           M YV+ E E  +  EAPKDH  ++ ++YQ I  E++K  + + +   I      + S + 
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSI----DATHSLKN 56

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           +I   +  VM  V  +EFVLCSL STW +RVT+ RQARDE +LLPS+LQHP+VFDLW+E 
Sbjct: 57  TIQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREV 116

Query: 121 DRWCANHPEVL-------------TLRKSCRTGIKRVKDQTEILKVLEM------STEEI 161
           DRW  NHPE               T   + R   K VK    +L  L +      +T++ 
Sbjct: 117 DRWYRNHPEQYEKGTDRGGGNVANTNTTTQRNKHKLVKSIDALLVFLNIDLDNKSTTDQR 176

Query: 162 TEK-----------PVLGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSK 210
            E+           P +     +L +L   CT+  D + VL+ P+DS+LDI+NFL E+S 
Sbjct: 177 MEQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKST 236

Query: 211 VLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDS 270
           VLY+NNLPPDTTQSELESWF QFG+RPVGFWTVKN+VE+T+N+NN WS NN+ YV+EQDS
Sbjct: 237 VLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNNNWSTNNNLYVDEQDS 296

Query: 271 ISGFVVFQTHEEATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSP 330
           ISGFVV+Q HEEA + L LNGRSILSNM+NTKQPRVVEH+VEIQPSS  VLDRAQEIL+ 
Sbjct: 297 ISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTA 356

Query: 331 FPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQYMNYNGNINSTNQG 390
           FPQSKNKPRPGDW CPSC FSNFQRRTACFRCSFP +SA+Q++N    NYN N       
Sbjct: 357 FPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGN--NYNKN------- 407

Query: 391 GNIYITKVGGS-PTQSHYQINTQ--------LPQTQAVRTNANYND---QNSLKHSNSA- 437
            +++  K   S P  + Y  N Q        L       T+A+  D   +  L+ S++A 
Sbjct: 408 -SVHGYKARTSTPQTADYNDNIQNQQQQQFVLNSLSGQLTSASAQDLTQKMKLQMSDTAN 466

Query: 438 YRFN-GNNGGNSPIMNYSNNRFXXXXXXXXXXXXXXXXXPFRAGDWKCPTCTYHNFAKNL 496
            RFN  N G      +  +++                  PFRAGDWKC  CTYHNFAKN+
Sbjct: 467 RRFNYPNRGPQLQNQHQQSHQHIQNQAQQQGPMSNGSNVPFRAGDWKCANCTYHNFAKNV 526

Query: 497 VCLRCGAAKVSIXXXXXXXXXVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGNLVXXX 556
           VCLRCG  K +          V                                      
Sbjct: 527 VCLRCGGPKTANVSANSNNATVTNATSNAATSNKLVSHDDMSVTPSLQNSSIY------- 579

Query: 557 XXXXXXXXXHDLGSNKRGNGYFTKRVGNLNENELGITLNTRSSSEPKW 604
                    H++ S+    GY + +V +   + +G++LN RSSSEP W
Sbjct: 580 -HQNGRINVHNM-SDVNTTGYVSGQVPSF--SGVGLSLNGRSSSEPNW 623

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score =  459 bits (1182), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 239/434 (55%), Positives = 298/434 (68%), Gaps = 36/434 (8%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           M+YV+ E +  H+ + PKDH RV+K+ YQ I    +   YAD +   +     G    Q 
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEV-----GGGGVQM 55

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           +  + +  +      + FVLCSL+STWH+RVT+PRQA DEG +LP +L H +VFDLWKE 
Sbjct: 56  ATGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKEC 115

Query: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEITEKPVLGYTVDILLQLCER 180
           DRWCANH       ++C  G K   D  E+ +VL++  E++     +     +LLQL  +
Sbjct: 116 DRWCANH----VSERACNAGAK--GDVAELFRVLDLD-EQLVSHAYIQQATRVLLQLHNK 168

Query: 181 CTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVGF 240
           CTT ED S VL+ PYDS+ D+ +F+QE+S+VLY+NNLPPDTTQSELESWFTQFGARPVGF
Sbjct: 169 CTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGF 228

Query: 241 WTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNMAN 300
           WTVKN+VE+T+N+NN WS NNS YVEE DSISGFVVFQ+HE A+E L LNGRSILSNMAN
Sbjct: 229 WTVKNVVEDTSNVNNNWSSNNSRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMAN 288

Query: 301 TKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACF 360
           TKQPRVVEH+VE++PSS+RVLD AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRR ACF
Sbjct: 289 TKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACF 348

Query: 361 RCSFPAASAVQVNNKQYMNYNGNINSTNQGGNIYITKVGGSPTQSHYQINTQLPQTQAVR 420
           RCSFPA SAV V                       +K+     Q HYQ    +P  Q V+
Sbjct: 349 RCSFPATSAVTV-----------------------SKLYKPQQQRHYQNPHHVPSKQQVQ 385

Query: 421 TNANYNDQNSLKHS 434
            +   +DQ++ +HS
Sbjct: 386 -HPQIHDQDTQQHS 398

 Score = 63.5 bits (153), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%)

Query: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAKVS 507
           PFRAGDWKC  C+YHNFAKN+VCLRCG  K +
Sbjct: 502 PFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 478 RAGDWKCPTCTYHNFAKNLVCLRC 501
           R GDW CP+C + NF + + C RC
Sbjct: 327 RPGDWNCPSCGFSNFQRRIACFRC 350

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 334 SKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFP 365
           S N P R GDW C +C + NF +   C RC  P
Sbjct: 498 SSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNP 530

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score =  428 bits (1101), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 212/397 (53%), Positives = 282/397 (71%), Gaps = 34/397 (8%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYAD---DQIPLISLDQQGS-- 55
           M+Y+ +E E  H+IE PKDH ++  LSYQ I+ E  +    D   + + ++SL    +  
Sbjct: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60

Query: 56  --ISFQESIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRV 113
             ++F++ I +F R+V   +G +E VLCSL STW +RVTIPRQ+ DEG +LPS+L+ P +
Sbjct: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120

Query: 114 FDLWKEYDRWCANH-PEVLTLRKSCRTGIKRVKDQTEILKVLEMS--------TEEITEK 164
           FDLWKEY RWC  H  E+ T++       K+ KD +E+ K+LE++         E++ ++
Sbjct: 121 FDLWKEYQRWCNLHFSEINTMK------TKKYKDSSELYKILEINQNSDAKTNNEKLNDR 174

Query: 165 PV-----LGY-------TVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVL 212
                   GY       TVD+ + + ++C+T ED   VL+ PY+S++D + F+QE SK++
Sbjct: 175 SGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKII 234

Query: 213 YLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSIS 272
           Y+NNLPPDTTQSELESWF QFG +P   WTV+NI+E T+  N+  + NNSPYVEE DSIS
Sbjct: 235 YMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILESTSYTNSNGNSNNSPYVEEHDSIS 294

Query: 273 GFVVFQTHEEATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFP 332
           GF VFQTH+EAT+ L+LNGRSILSNMANTKQPRVVEHIVE+QPSS  +L+R QEI S FP
Sbjct: 295 GFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFP 354

Query: 333 QSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAASA 369
           QSKNKPRPGDWNC SCGFSNFQRRT+CFRCSFPAA++
Sbjct: 355 QSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPAATS 391

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 64/133 (48%), Gaps = 20/133 (15%)

Query: 380 YNGNINSTN----QGGNIYITKVGGSPTQSHYQINTQLPQTQAVRTNANYNDQNSLKHSN 435
           Y GNI++ N    Q  N+ +  V      S+Y           +  N  Y+  N   H+N
Sbjct: 460 YGGNISAGNNILTQNSNMIMNNVNNHNLLSNYD---------NLTGNIGYSLNNG--HTN 508

Query: 436 SAYRFNGNN--GGNSPIMNYSNNRFXXXXXXXXXXXXXXXXXPFRAGDWKCPTCTYHNFA 493
           + YR+N NN  G  +   N +NNR+                 PFRAGDWKC  C+YHNFA
Sbjct: 509 NQYRYNHNNHLGFQNNAYNANNNRYSNQGNGLNNGGSNV---PFRAGDWKCSACSYHNFA 565

Query: 494 KNLVCLRCGAAKV 506
           KN+VCLRCG  K 
Sbjct: 566 KNIVCLRCGGPKT 578

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQYMNYNG 382
           R GDW C +C + NF +   C RC  P   A+  +  + M++N 
Sbjct: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKSMSHNS 593

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%)

Query: 478 RAGDWKCPTCTYHNFAKNLVCLRCG 502
           R GDW C +C + NF +   C RC 
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCS 385

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  416 bits (1068), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 209/376 (55%), Positives = 275/376 (73%), Gaps = 8/376 (2%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           M YV++E+++    ++ KD  ++ +L YQ IDA+S++    +    +  L  +GS + Q+
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDADSLEKRKINGN-EIRQLAVEGS-NLQD 58

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           ++  F++++ S++  +EFVLCS++STW +RV +PR+A DE   LP+ L++P V DLWKE+
Sbjct: 59  TVLLFEKEINSVINGEEFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIVLDLWKEF 118

Query: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEI-----TEKPVLGYTVDILL 175
           DRWC NHP+ L   K      K +    ++L V +   E +     T K V G T DILL
Sbjct: 119 DRWCTNHPDALQSVKGYNRKCKNLPMVHQVLGVEQRLNESVNANGYTRKEV-GITSDILL 177

Query: 176 QLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGA 235
           QL ++C++ +D + VL++PY+S LD   F +EQS VLYLNNLPPDTTQ ELE+WF QFG+
Sbjct: 178 QLHKKCSSDDDTNTVLTQPYNSKLDYETFTEEQSTVLYLNNLPPDTTQGELETWFGQFGS 237

Query: 236 RPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSIL 295
           RPV FWT KNIVE+T+NINN W++NNS YVEEQDS+SGF  FQT EEA   L L+GRSIL
Sbjct: 238 RPVSFWTFKNIVEDTSNINNNWNLNNSYYVEEQDSVSGFATFQTFEEAFNALKLSGRSIL 297

Query: 296 SNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQR 355
           SN+ANTKQPR+VEH+VEI PSS R+L  ++EILS FPQSKNKPRPGDWNCPSCGFSNFQR
Sbjct: 298 SNVANTKQPRIVEHVVEIHPSSARILHSSEEILSAFPQSKNKPRPGDWNCPSCGFSNFQR 357

Query: 356 RTACFRCSFPAASAVQ 371
           RTACFRCSFP  SAVQ
Sbjct: 358 RTACFRCSFPVPSAVQ 373

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  406 bits (1043), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 221/512 (43%), Positives = 313/512 (61%), Gaps = 39/512 (7%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           MHYVVLEVE+ H     KD  R+  LSYQ ++ +        + +  I++    S +FQ+
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAI-SNDSENFQD 59

Query: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120
           ++ + D D+ + +G++EFV+C+L S  ++RVT+ RQA D G  LP YL++P++FDLW E+
Sbjct: 60  ALVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEF 119

Query: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEITEKPVLGYTVDILLQLCER 180
            ++CANHPE L L +   T  K V   T+IL +   +TE  T    +  + D+LL L ++
Sbjct: 120 KKFCANHPE-LDLNEEMVTS-KDVAILTDILGLQSNNTENYT----IDISTDVLLSLYKK 173

Query: 181 CTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVGF 240
           C++ EDI  VL++PYD  +DI+ F +E+++V++++NLPPD TQ+ELE+WF    ++P+ +
Sbjct: 174 CSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICY 233

Query: 241 WTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNMAN 300
           WT K   E + N       +N+ YV  Q SI GF++FQTHEEA + L+LNG+SI S+  +
Sbjct: 234 WTSKTPDEYSRN------FHNNTYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLH 287

Query: 301 TKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACF 360
            KQ   VEHI+E+ PSST+VLD  Q+IL PFPQSKNKPR GDWNCPSCGFSNFQRRTACF
Sbjct: 288 MKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACF 347

Query: 361 RCSFPAASAVQVNNKQYMNYNGNINSTNQGGNI-----YITKVGGSPTQSHYQINTQLPQ 415
           RCSFPA +    NN      N N  +T +  N          V  SP Q++ ++N     
Sbjct: 348 RCSFPAPNNSNTNNTNNGESNNNTQTTGEHTNTSPHSSLQQAVHHSPYQTYNKLN----- 402

Query: 416 TQAVRTNANYNDQNSLKHSNSAYRFNGNNGGNSPIMNYSNNRFXXXXXXXXXXXXXXXXX 475
             +V  + N        ++NS  + +     N P  +Y+ N                   
Sbjct: 403 -DSVTGSLNQQTYRYSNNNNSNIKIHNTANFNMPFTSYTGN---------------GSSV 446

Query: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAKVS 507
           PFRAGDWKCP+CTYHNFAKN+ CLRCG  K+S
Sbjct: 447 PFRAGDWKCPSCTYHNFAKNIACLRCGDPKLS 478

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQ 371
           R GDW CPSC + NF +  AC RC  P  S + 
Sbjct: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGIH 481

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  311 bits (798), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 208/600 (34%), Positives = 294/600 (49%), Gaps = 131/600 (21%)

Query: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60
           MHYVVL+V+       P     + +L YQ ID  S++A    ++  ++ +D +   S +E
Sbjct: 1   MHYVVLDVQIDSSAVKP----VLLRLGYQVIDPVSLEAR---NEPYVVDVDGE---SIKE 50

Query: 61  SIAKFDRDVMSIVG-----------------EDEFVLCSLYSTWHIRVTIPRQARDEGFL 103
            IAK D D+ S                    E EFV C+L  +W ++V +   A D G  
Sbjct: 51  FIAKLDEDLKSHATVANHQESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVSSANDLGVE 110

Query: 104 LPSYLQHPRVFDLWKEYDRWCANH------PEVLTLRKSCRTGIKRVKDQTEILKVLEMS 157
           LP YL++P  FD+WKEY  W  NH      P+     +S  +   +++   E+++ L++S
Sbjct: 111 LPEYLRYPVFFDIWKEYSIWKKNHSDSSESPQTQANGESIDSFAGKIE---ELVRTLDVS 167

Query: 158 TE--EITEK---PVLGYTVD--ILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSK 210
           TE  E+ +K   P     +   +L  L ++C T  D + VL+ PYD  +D +NF++EQSK
Sbjct: 168 TEYDELKQKNDDPTFDVRLATLVLTALHKKCVTPVDDTTVLTVPYDLGMDYKNFIEEQSK 227

Query: 211 VLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDS 270
           +LY++N+P +  Q++LE WF Q G   VGFWT+KNI ++    + +   N+   +   DS
Sbjct: 228 ILYISNIPSELNQTDLEGWFQQKGVASVGFWTLKNISDDATLASQR---NHGKMLSIPDS 284

Query: 271 ISGFVVFQTHEEATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSP 330
           + GF +FQ+H +A   L L+G   +  +   K  + +E +++IQPSS R+L++ Q+ L  
Sbjct: 285 MFGFAIFQSHNDAEYALNLHG--TVMKIVAPKGNKHIEQLLDIQPSSMRLLEKVQDNLIL 342

Query: 331 FPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQ-------------Y 377
            PQ+KNKPRPGDWNCPSCGFSNFQRRTACFRC+FP  + V  N  +             Y
Sbjct: 343 LPQNKNKPRPGDWNCPSCGFSNFQRRTACFRCAFPVPNGVSGNAGKLPMTSVTNNMVSGY 402

Query: 378 MNYN-------------------------------GNINSTNQGGNIYITKVGGSPTQSH 406
            NYN                                         N      G SP QS 
Sbjct: 403 TNYNTRNLNNKSNWNNIGQDGYQYNQQQQLRQLQQMQQTYQMYAANRASNNGGKSPIQSS 462

Query: 407 YQINTQLPQTQAVRTNA---NYNDQN---------SLKHSNSA--YRFNGNNGG------ 446
           Y+ N    Q+     N    NYN  N         +L HS S+  Y   GNN G      
Sbjct: 463 YRSNYNGGQSGNSSYNMPLHNYNRFNQGTSAHLPYNLTHSTSSNGYISEGNNHGHGGMST 522

Query: 447 NSPIMNYSNNRFXXXXXXXXXXXXXXXXXPFRAGDWKCPTCTYHNFAKNLVCLRCGAAKV 506
           NS ++  SN                    PFRAGDWKCP C YHNFAKN+VCLRCG  K 
Sbjct: 523 NSGMIGGSN-------------------VPFRAGDWKCPGCFYHNFAKNIVCLRCGGPKT 563

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 25/30 (83%)

Query: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAK 505
           PFRAGDWKC TC YHNFAKN+VCLRC   K
Sbjct: 478 PFRAGDWKCLTCGYHNFAKNIVCLRCSGPK 507

>KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 305

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 211 VLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNI 246
           VL + NLP D TQ ELE  F   G + V   +V+N+
Sbjct: 234 VLLVQNLPKDVTQQELEKLFVSDGFKEVRLVSVRNL 269

>Kpol_1039.50 s1039 complement(146455..147322,147425..147447) [891
           bp, 296 aa] {ON}
           complement(146455..147322,147425..147447) [891 nt, 297
           aa]
          Length = 296

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 61/137 (44%), Gaps = 26/137 (18%)

Query: 133 LRKSCRTGIKRVKDQTEILKVLEMSTEE-------ITEKPVLGYTVDILLQLCERCTTKE 185
           LR+  +   K+  ++ EI K++E   EE       +  KP     +D      E   TK+
Sbjct: 159 LRRLRQILRKKGLEEAEISKIVENVKEEQIKLKGEVESKPASTAELDF-----ETKITKK 213

Query: 186 DISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKN 245
           ++ D+   P ++             +L + NLP  TT+ +L+  F Q G + V   +V+N
Sbjct: 214 ELIDLSVNPANN-------------ILLVQNLPNGTTEVQLKELFAQTGLKEVRLVSVRN 260

Query: 246 IV-EETANINNKWSMNN 261
           +   E +NI N   + N
Sbjct: 261 LAFIEYSNIQNATEIKN 277

>Kwal_27.10364 s27 (303432..304763) [1332 bp, 443 aa] {ON} YMR268C
           (PRP24) - U4/U6 snRNP protein [contig 36] FULL
          Length = 443

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 185 EDISDVLSRPYDSH--LDIRNFLQEQSK--VLYLNNLPPDTTQSELESWFTQFGA 235
           ED +DVLS    SH  L  +  + EQS+   L++ N PP   + EL+  F+QFG 
Sbjct: 88  EDFNDVLSALTKSHKRLGDQEIIVEQSQNSTLWVTNYPPLFGELELQKLFSQFGG 142

>NDAI0G04020 Chr7 (957452..958633) [1182 bp, 393 aa] {ON} Anc_3.57
          Length = 393

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 107 YLQHPR-VFDLWKEYDRWCANHPEVLTLRKSCRTGIKR---VKDQTEILKVLEMSTEEIT 162
           +L+ P  V DLWKEY      HP +  +    +T  +R   V  +    KVL  + E   
Sbjct: 287 FLKSPNSVLDLWKEYTEGIHGHPSIKYMDAIYQTNWRRDAAVNRRYSRRKVLWKAIESGL 346

Query: 163 EKPVLGYTVDILLQLCERC 181
           EK   GY+++ ++ + E C
Sbjct: 347 EK---GYSLERVVDILENC 362

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 48/122 (39%), Gaps = 26/122 (21%)

Query: 212 LYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSI 271
           +Y+ N+ P+T Q E E  F+Q+GA       + + V ET N                   
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGA-------ITSAVLETDNEGKLRGF------------ 263

Query: 272 SGFVVFQTHEEATEVLV------LNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQ 325
            GFV F+ H  A + +        NG+ +    A  K  R+ E   + + S    L + Q
Sbjct: 264 -GFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQ 322

Query: 326 EI 327
            +
Sbjct: 323 GV 324

>Kpol_1076.9 s1076 complement(18964..20514) [1551 bp, 516 aa] {ON}
           complement(18964..20514) [1551 nt, 517 aa]
          Length = 516

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 107 YLQHPR-VFDLWKEYDRWCANHPEVLTLRKSCRTGIKR---VKDQTEILKVLEMSTEEIT 162
           +L+ P  V DLWKEY       P +  L    +TG +R   V  +    KVL  + E   
Sbjct: 414 FLKSPHSVMDLWKEYTEGINGQPSIRELESIYQTGWRRDPAVNKRFSRRKVLYKAIETGL 473

Query: 163 EKPVLGYTVDILLQLCE 179
            +   GY++D ++++ E
Sbjct: 474 NR---GYSLDYIIKILE 487

>KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.167
           YNL110C
          Length = 220

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 19/78 (24%)

Query: 207 EQSKVLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVE 266
           E S ++Y++ LP    + EL  +F+QFG            ++E     NK S N+  Y  
Sbjct: 88  EYSSIIYVSRLPNGFHEKELSKYFSQFGD-----------LKEARLARNKKSGNSRHY-- 134

Query: 267 EQDSISGFVVFQTHEEAT 284
                 GFV F   E+A 
Sbjct: 135 ------GFVEFANKEDAK 146

>SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar to
           uniprot|P53927 Saccharomyces cerevisiae YNL110C NOP15
           Constituent of 66S pre-ribosomal particles involved in
           60S ribosomal subunit biogenesis localizes to both
           nucleolus and cytoplasm
          Length = 221

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 206 QEQSKVLYLNNLPPDTTQSELESWFTQFG 234
           +EQS ++Y++ LP    + EL  +F+QFG
Sbjct: 88  KEQSSIIYVSRLPQGFHERELSKYFSQFG 116

>TPHA0P01290 Chr16 complement(260217..261320) [1104 bp, 367 aa] {ON}
           Anc_3.57 YOL116W
          Length = 367

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 7/77 (9%)

Query: 107 YLQHPR-VFDLWKEYDRWCANHPEVLTLRKSCRTGIKR---VKDQTEILKVLEMSTEEIT 162
           +++ P  + DLWKEY       P +  L    +TG +R   V  +    KVL  + E   
Sbjct: 265 FIKSPHSILDLWKEYTEGINGQPSIRELESIYQTGWRRDPAVNKRFSRRKVLYKAIENGL 324

Query: 163 EKPVLGYTVDILLQLCE 179
            +   GYT++ ++ L E
Sbjct: 325 NR---GYTLEYIIDLLE 338

>TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {ON}
           Anc_2.52 YNL197C
          Length = 682

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 211 VLYLNNLPPDTTQSELESWFT-QFGARPVGF 240
            LY+ NLPPDTT+ EL   F+ Q G R + F
Sbjct: 554 TLYVGNLPPDTTEQELRHLFSGQQGFRRLSF 584

>CAGL0G05511g Chr7 complement(522026..524050) [2025 bp, 674 aa] {ON}
           similar to uniprot|P34761 Saccharomyces cerevisiae
           YNL197c WHI3 involved in regulation of cell size
          Length = 674

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 42/94 (44%), Gaps = 19/94 (20%)

Query: 211 VLYLNNLPPDTTQSELESWFT-QFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQD 269
            LY+ NLPPDT++ EL   F+ Q G R + F   KN        NN  +  + P      
Sbjct: 559 TLYVGNLPPDTSEQELRQLFSPQPGFRRLSFKN-KN--------NNGHTHGHGPMC---- 605

Query: 270 SISGFVVFQTHEEATEVLV-LNGRSILSNMANTK 302
               FV F+    AT  L  L GR +    AN+K
Sbjct: 606 ----FVEFEDVSFATRALAELYGRQLPRTGANSK 635

>NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON}
           Anc_2.167
          Length = 224

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 205 LQEQSKVLYLNNLPPDTTQSELESWFTQFG 234
           L E S +LY++ LP    + EL  +F+QFG
Sbjct: 89  LAEYSSILYVSRLPQGFHERELSKYFSQFG 118

>CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly
           similar to uniprot|P43607 Saccharomyces cerevisiae
           YFR032c
          Length = 443

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 23/35 (65%)

Query: 212 LYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNI 246
           +Y   LP +TT ++L ++FT +G+R +  +  KN+
Sbjct: 185 VYCAFLPKETTDNDLRNYFTDYGSREIWIFRTKNV 219

>NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167
          Length = 226

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 19/82 (23%)

Query: 202 RNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNN 261
           +N L + S ++Y++ LP    + EL  +F+QFG            ++E     NK + N+
Sbjct: 89  KNALADYSSIIYVSRLPHGFHEKELSKYFSQFGN-----------LKEVRLARNKKTGNS 137

Query: 262 SPYVEEQDSISGFVVFQTHEEA 283
             Y        GF+ F + ++A
Sbjct: 138 RHY--------GFIEFTSKDDA 151

>Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON}
           (14170..15519) [1350 nt, 450 aa]
          Length = 449

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 25/97 (25%)

Query: 212 LYLNNLPPD-TTQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDS 270
           +Y+ NL  D  T+ +L  WF++FG            +E    + N+    N+ Y      
Sbjct: 204 IYITNLDSDQITEQKLSEWFSKFGD-----------IERIKLVKNENEPGNTSY------ 246

Query: 271 ISGFVVFQTHEEATEVL-----VLNGRSILSNMANTK 302
              F+ F + + AT+ L      L G +I   +AN K
Sbjct: 247 --AFISFTSSDSATKALELHKETLEGNTITVTLANKK 281

>TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {ON}
           Anc_2.52 YNL197C
          Length = 734

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 211 VLYLNNLPPDTTQSELESWF-TQFGARPVGF 240
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 609 TLYVGNLPPDATEQELRQLFSTQDGFRRLSF 639

>TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.382
           YHR086W
          Length = 494

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 50/111 (45%), Gaps = 21/111 (18%)

Query: 192 SRPYDSHLDIRNFLQEQSK---VLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVE 248
           S+PY+++    N+ Q Q K   VLY+  L     ++ ++  + + G             E
Sbjct: 22  SKPYNNYKPRYNYKQTQGKGNNVLYMGGLDYSWNEAVIKDIWNKVG-------------E 68

Query: 249 ETANINNKWSM----NNSPYVEEQDSISG-FVVFQTHEEATEVLVLNGRSI 294
              N+   W+M    NN+   E + ++   FV F THE A+  ++ NG  I
Sbjct: 69  PATNVRMMWNMQFQHNNAGPTEGKSNLGYCFVEFSTHETASNAIMKNGTMI 119

>Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {ON}
           YNL197C (WHI3) - Putative RNA binding protein [contig 5]
           FULL
          Length = 664

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 211 VLYLNNLPPDTTQSELESWF-TQFGARPVGF 240
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 546 TLYVGNLPPDATEHELRQLFSTQKGFRRLSF 576

>KNAG0C00650 Chr3 (110325..112571) [2247 bp, 748 aa] {ON} Anc_1.60
           YLR182W
          Length = 748

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 234 GARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNG-R 292
           G RPV F         T+ +  K   NN+    + ++  G + F T +E   V ++N  +
Sbjct: 454 GLRPVDFGA------GTSKLPTKVDENNNEREHDPENDDGLLKFDTMKEPDTVSLINDMK 507

Query: 293 SILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILS 329
           ++LS+++      +  H  ++ PS    LDR +E L+
Sbjct: 508 TLLSSVSKDYDTELSSHKDKVGPSYILELDRQREELA 544

>KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and to uniprot|P34761 Saccharomyces cerevisiae YNL197C
           WHI3
          Length = 639

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 211 VLYLNNLPPDTTQSELESWF-TQFGARPVGF 240
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 522 TLYVGNLPPDATEHELRQLFSTQKGFRRLSF 552

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 189 DVLSRPYDSHLDIRNFLQEQSKV---LYLNNLPPDTTQSELESWFTQFG 234
           +V   P+ S  D ++ L+E       +Y+ N+  +TTQ E E+ FTQFG
Sbjct: 197 EVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFG 245

>KLTH0D01826g Chr4 complement(175846..179820) [3975 bp, 1324 aa]
           {ON} similar to uniprot|P22023 Saccharomyces cerevisiae
           YOR336W KRE5 Protein required for beta-1 6 glucan
           biosynthesis mutations result in aberrant morphology and
           severe growth defects
          Length = 1324

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 284 TEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKP 338
           T  L +NGR I  +    + P + E+ + +Q  +TRVLD    +   FP S  +P
Sbjct: 742 TSYLAVNGRFI--HFEQGELPTIYEYEMIVQREATRVLDAVASLQEVFPDSLKEP 794

>NCAS0A02730 Chr1 (522320..523381) [1062 bp, 353 aa] {ON} Anc_4.298
           YKL193C
          Length = 353

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 14/99 (14%)

Query: 127 HPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEITEKPVLG-YTVDILLQLCERCTTKE 185
           HP+ LT      T +    D TE++ ++ +   +IT    L  Y    L  LC R    E
Sbjct: 41  HPDFLTADADLTTDLP---DDTEVIDLIHL---KITSLEALNLYRFKKLTALCLRQNLIE 94

Query: 186 DISDVLSRPYDSHLD-------IRNFLQEQSKVLYLNNL 217
            I++V   PYD+ +D       I++     +K+++L NL
Sbjct: 95  SITEVEVLPYDTFIDLDLYDNRIKHISSNVNKLVHLKNL 133

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,184,163
Number of extensions: 2686456
Number of successful extensions: 14477
Number of sequences better than 10.0: 215
Number of HSP's gapped: 14173
Number of HSP's successfully gapped: 363
Length of query: 606
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 491
Effective length of database: 40,294,809
Effective search space: 19784751219
Effective search space used: 19784751219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)