Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C019807.350ON38538519360.0
Kwal_56.246427.350ON38138016770.0
SAKL0F11374g7.350ON38338016740.0
NCAS0A141607.350ON45138216740.0
ZYRO0F11704g7.350ON38237816630.0
KLTH0H01254g7.350ON38138016500.0
TBLA0E00390singletonON38338016220.0
KLLA0D12342g7.350ON38438016200.0
Smik_4.707.350ON38638016130.0
YDL168W (SFA1)7.350ON38637816100.0
Skud_4.897.350ON38538215940.0
ACL148C7.350ON38137815900.0
Suva_4.787.350ON38538215870.0
CAGL0L01111g7.350ON38138015800.0
Kpol_530.317.350ON38038015740.0
Ecym_47237.350ON38137815610.0
TPHA0F029707.350ON38137515260.0
KAFR0B008807.350ON38137814960.0
KNAG0C037907.350ON38238014060.0
NDAI0A018907.350ON42238213910.0
SAKL0A00880gsingletonON38837710881e-147
CAGL0J01441g2.480ON3723562832e-27
TPHA0G032102.480ON3773732672e-25
NCAS0I023503.118ON3513752662e-25
KLTH0D05588g2.480ON3893732664e-25
SAKL0C10164g3.118ON3513752628e-25
KNAG0K020003.118ON3503682628e-25
ZYRO0G03388g2.480ON3703732639e-25
TBLA0I011402.480ON3773752593e-24
KAFR0A007902.480ON3773762593e-24
NDAI0A069303.118ON3513752565e-24
NCAS0I01720singletonON3513752566e-24
Ecym_53313.118ON3482972556e-24
KLLA0F21010g3.118ON3503732557e-24
KAFR0G014203.118ON3513762541e-23
SAKL0B00814g8.16ON3543842522e-23
SAKL0F06270gna 1ON3513752513e-23
Ecym_73912.480ON3753872523e-23
AER032W3.118ON3512922513e-23
SAKL0B08184gna 2ON3733742513e-23
KAFR0L02010singletonON3513782478e-23
YBR145W (ADH5)3.118ON3512942479e-23
Kwal_26.77992.480ON3873732462e-22
KLLA0B09064gna 2ON3743712452e-22
CAGL0I07843g3.118ON3523772443e-22
KLTH0G15686g3.118ON3513732433e-22
KLLA0F13530g2.480ON3753742434e-22
YOL086C (ADH1)3.118ON3483762408e-22
NDAI0H021602.480ON3813762401e-21
Skud_13.2402.480ON3753732382e-21
KLLA0D19929gsingletonON3863462392e-21
KLLA0F18260gsingletonON3482572372e-21
Suva_4.3943.118ON3512942363e-21
Smik_15.713.118ON3483762363e-21
Smik_2.2843.118ON3512942345e-21
Suva_15.813.118ON3483732346e-21
ZYRO0B05940g3.118ON3793922356e-21
YMR083W (ADH3)2.480ON3753732346e-21
TBLA0E034403.118ON3513782329e-21
KLTH0E05588gna 1ON3483782321e-20
Smik_13.2662.480ON3753732331e-20
Suva_13.2612.480ON3753742321e-20
TPHA0M007303.118ON3503732292e-20
ZYRO0G03410gsingletonON3733702302e-20
Skud_15.683.118ON3483762292e-20
Suva_13.494na 3ON3482922292e-20
Smik_13.520na 3ON3482922292e-20
TDEL0C003908.16ON3533842283e-20
KLLA0B00451gsingletonON3863722293e-20
Skud_2.2723.118ON3513752283e-20
AAR084WsingletonON3852852284e-20
Skud_13.477na 3ON3482922257e-20
KLTH0G18986g8.16ON3542842251e-19
TBLA0E03430singletonON3513782241e-19
TDEL0A025602.480ON3733732251e-19
Kwal_56.231983.118ON3513782241e-19
SAKL0E02838g2.480ON3773732241e-19
YMR303C (ADH2)na 3ON3482942222e-19
KAFR0L02000singletonON3613722213e-19
ZYRO0C12562gna 1ON3483782204e-19
NCAS0A077802.480ON3733732205e-19
TDEL0D050503.118ON3512952196e-19
Kpol_431.82.480ON3802842189e-19
Kwal_55.19574singletonON3563662171e-18
TDEL0F03190na 1ON3513722143e-18
ABL033C2.480ON3733632135e-18
KNAG0K01040singletonON3913722127e-18
ABR229C8.16ON3533752101e-17
Kpol_1036.193.118ON3533762072e-17
Kwal_55.20564singletonON2162232003e-17
YLR070C (XYL2)8.16ON3563802046e-17
Kwal_26.6684singletonON3563672036e-17
Smik_48.1singletonON3573722037e-17
YJR159W (SOR1)na 4ON3573752029e-17
Suva_10.1548.16ON3563842021e-16
Suva_12.260singletonON3573692011e-16
YDL246C (SOR2)singletonON3573752002e-16
TBLA0A042907.3ON3953051993e-16
KNAG0E025902.480ON3743731984e-16
CAGL0D00198g7.3ON3833171967e-16
Kpol_1058.118.16ON3533481959e-16
Skud_20.2singletonON3573681941e-15
Skud_4.2singletonON3573681941e-15
Kpol_1049.187.2ON3863071941e-15
KLTH0A00418gsingletonON3562461931e-15
NCAS0J003008.16ON3572931871e-14
YAL060W (BDH1)7.3ON3822921852e-14
NCAS0A076707.2ON4393061826e-14
Skud_1.37.3ON3822901808e-14
Smik_1.67.3ON3822921808e-14
ZYRO0F02552g8.16ON3512901781e-13
KLLA0F00506g7.3ON3852281791e-13
KLTH0D00616g7.3ON3823101781e-13
TDEL0H044607.3ON3822771772e-13
Suva_1.77.3ON3822801745e-13
Kwal_26.67397.3ON3822871727e-13
KAFR0I001607.2ON3853661728e-13
KAFR0C005803.253ON3343181663e-12
YBR046C (ZTA1)3.253ON3342581664e-12
YAL061W (BDH2)7.2ON4173551666e-12
NDAI0H020507.3ON3852961657e-12
SAKL0D14894g7.2ON3852801649e-12
SAKL0D14872g7.3ON3832861612e-11
KLLA0D05511g8.16ON3543861551e-10
Suva_1.67.2ON4173031551e-10
Kwal_47.17532na 5ON3733631523e-10
Skud_1.27.2ON4173031514e-10
Smik_2.1703.253ON3343401495e-10
Smik_1.57.2ON4173041506e-10
SAKL0D03872g3.253ON3483531471e-09
Kwal_56.229853.253ON3463421443e-09
KNAG0I00120singletonON3812751443e-09
KLLA0F00528g7.2ON3813191416e-09
KNAG0E042007.2ON3853151382e-08
TPHA0H03100singletonON3922931354e-08
TDEL0D037203.253ON3353471344e-08
KLTH0E07964gna 5ON3743511292e-07
KAFR0I001707.3ON3813051283e-07
NCAS0A076607.3ON3862811283e-07
KNAG0D00110singletonON3623401273e-07
NDAI0A063203.253ON3492671273e-07
NDAI0H020607.2ON3993171265e-07
NCAS0C03020singletonON3623501255e-07
SAKL0H22088gna 5ON3763081256e-07
KLLA0A10549g3.253ON3531901247e-07
Suva_4.2793.253ON3342861212e-06
NDAI0H02950singletonON3633481212e-06
NCAS0D01220na 6ON362961185e-06
KLTH0C07854g3.253ON3583471176e-06
Skud_2.1623.253ON3342701167e-06
ZYRO0A03366g3.253ON3493521167e-06
NCAS0I017303.253ON3493131141e-05
SAKL0D14938gsingletonON3783211132e-05
NDAI0A08470singletonON3633501113e-05
ABL090W3.253ON3343931104e-05
TPHA0J00170singletonON3613421087e-05
NDAI0G04880singletonON3613491061e-04
Ecym_1093singletonON3833791052e-04
KAFR0A08730singletonON3603091033e-04
CAGL0M14047gna 7ON3593851025e-04
CAGL0H09944g3.253ON333355960.002
KLLA0E19889gna 8ON366122960.002
NDAI0H02940na 6ON36195960.002
KLTH0B04972gna 8ON36096920.006
Smik_26.3singletonON12580870.007
Suva_13.513na 7ON36090910.010
Smik_3.203singletonON12084840.014
Skud_13.494na 7ON36090890.019
Smik_13.535na 7ON36090880.019
CAGL0H06853gsingletonON360345880.021
Kpol_257.4singletonON36096880.022
SAKL0C00264gsingletonON35987880.022
SAKL0H00374gsingletonON428365870.029
Skud_3.175singletonON36184870.029
KNAG0K02680singletonON35987870.031
YCR105W (ADH7)na 9ON36185860.035
ZYRO0G10318gna 5ON37692850.047
KLTH0B00506gna 10ON398269840.076
TDEL0F02300na 5ON37990820.11
YMR318C (ADH6)na 7ON36090820.11
Kpol_526.18singletonON36195820.12
KAFR0H03770singletonON36596810.14
KLLA0F00638gna 10ON382247810.14
Kwal_26.9050singletonON36481810.14
Kpol_1057.24na 9ON36080810.18
KNAG0B06990singletonON358348800.23
KAFR0C01550singletonON35991790.26
TPHA0A00140singletonON36283790.27
Smik_6.36singletonOFF8893730.30
Suva_6.13singletonON6859710.31
Skud_86.1singletonON8983720.35
Smik_14.1932.133ON376141741.2
TPHA0F02090singletonON36095741.2
Kwal_8.605singletonON37981713.0
TBLA0D05550singletonON37494703.6
Kwal_27.12835singletonON36481695.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C01980
         (385 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   750   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   650   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   649   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   649   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   645   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   640   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      629   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   628   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   625   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   624   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   618   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   617   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   615   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   613   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   610   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   605   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   592   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   580   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   546   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    540   0.0  
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   423   e-147
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...   113   2e-27
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...   107   2e-25
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118    107   2e-25
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...   107   4e-25
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...   105   8e-25
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....   105   8e-25
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...   105   9e-25
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...   104   3e-24
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...   104   3e-24
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...   103   5e-24
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}              103   6e-24
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...   102   6e-24
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...   102   7e-24
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...   102   1e-23
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...   101   2e-23
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...   101   3e-23
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...   101   3e-23
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...   101   3e-23
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...   101   3e-23
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}             100   8e-23
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...   100   9e-23
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    99   2e-22
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    99   2e-22
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    99   3e-22
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    98   3e-22
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    98   4e-22
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    97   8e-22
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     97   1e-21
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    96   2e-21
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...    97   2e-21
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    96   2e-21
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    96   3e-21
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    96   3e-21
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    95   5e-21
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    95   6e-21
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    95   6e-21
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    95   6e-21
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    94   9e-21
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    94   1e-20
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    94   1e-20
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    94   1e-20
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    93   2e-20
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    93   2e-20
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    93   2e-20
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    93   2e-20
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    93   2e-20
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    92   3e-20
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...    93   3e-20
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    92   3e-20
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    92   4e-20
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    91   7e-20
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    91   1e-19
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               91   1e-19
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    91   1e-19
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    91   1e-19
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    91   1e-19
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    90   2e-19
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              90   3e-19
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    89   4e-19
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    89   5e-19
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    89   6e-19
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    89   9e-19
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    88   1e-18
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    87   3e-18
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    87   5e-18
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    86   7e-18
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    86   1e-17
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    84   2e-17
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    82   3e-17
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    83   6e-17
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    83   6e-17
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    83   7e-17
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    82   9e-17
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    82   1e-16
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    82   1e-16
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    82   2e-16
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    81   3e-16
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    81   4e-16
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    80   7e-16
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    80   9e-16
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     79   1e-15
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    79   1e-15
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    79   1e-15
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    79   1e-15
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       77   1e-14
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    76   2e-14
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    75   6e-14
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     74   8e-14
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     74   8e-14
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    73   1e-13
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    74   1e-13
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    73   1e-13
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    73   2e-13
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     72   5e-13
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    71   7e-13
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    71   8e-13
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    69   3e-12
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    69   4e-12
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    69   6e-12
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    68   7e-12
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    68   9e-12
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    67   2e-11
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    64   1e-10
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     64   1e-10
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    63   3e-10
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      63   4e-10
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    62   5e-10
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     62   6e-10
SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly...    61   1e-09
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    60   3e-09
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  60   3e-09
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    59   6e-09
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    58   2e-08
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    57   4e-08
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    56   4e-08
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    54   2e-07
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    54   3e-07
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    54   3e-07
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   54   3e-07
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    54   3e-07
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    53   5e-07
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    53   5e-07
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    53   6e-07
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    52   7e-07
Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON...    51   2e-06
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    51   2e-06
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               50   5e-06
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    50   6e-06
Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON...    49   7e-06
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    49   7e-06
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     49   1e-05
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    48   2e-05
NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON}             47   3e-05
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    47   4e-05
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                46   7e-05
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    45   1e-04
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    45   2e-04
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    44   3e-04
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    44   5e-04
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    42   0.002
KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} simi...    42   0.002
NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {O...    42   0.002
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    40   0.006
Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)      38   0.007
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    40   0.010
Smik_3.203 Chr3 (301227..301247,301251..301589) [360 bp, 120 aa]...    37   0.014
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    39   0.019
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    39   0.019
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    39   0.021
Kpol_257.4 s257 complement(12348..13430) [1083 bp, 360 aa] {ON} ...    39   0.022
SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON...    39   0.022
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    38   0.029
Skud_3.175 Chr3 (288164..289249) [1086 bp, 361 aa] {ON} YCR105W ...    38   0.029
KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {...    38   0.031
YCR105W Chr3 (309070..310155) [1086 bp, 361 aa] {ON}  ADH7NADPH-...    38   0.035
ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} simila...    37   0.047
KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON...    37   0.076
TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {O...    36   0.11 
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    36   0.11 
Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON} (51360..5...    36   0.12 
KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {O...    36   0.14 
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    36   0.14 
Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR10...    36   0.14 
Kpol_1057.24 s1057 (53467..54549) [1083 bp, 360 aa] {ON} (53467....    36   0.18 
KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON}             35   0.23 
KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {O...    35   0.26 
TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON}                 35   0.27 
Smik_6.36 Chr6 (64079..64342) [264 bp, 88 aa] {OFF} YJR159W (HSP)      33   0.30 
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    32   0.31 
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    32   0.35 
Smik_14.193 Chr14 complement(352041..353171) [1131 bp, 376 aa] {...    33   1.2  
TPHA0F02090 Chr6 (465913..466995) [1083 bp, 360 aa] {ON}               33   1.2  
Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W - Hy...    32   3.0  
TBLA0D05550 Chr4 (1364888..1366012) [1125 bp, 374 aa] {ON} Anc_2...    32   3.6  
Kwal_27.12835 s27 complement(1395770..1396864) [1095 bp, 364 aa]...    31   5.0  

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/385 (96%), Positives = 370/385 (96%)

Query: 1   MSGAATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGV 60
           MSGAATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGV
Sbjct: 1   MSGAATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGV 60

Query: 61  DPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVR 120
           DPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVR
Sbjct: 61  DPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVR 120

Query: 121 ATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGC 180
           ATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYT               LESICLLGC
Sbjct: 121 ATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGC 180

Query: 181 GVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNE 240
           GVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNE
Sbjct: 181 GVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNE 240

Query: 241 FGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVI 300
           FGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVI
Sbjct: 241 FGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVI 300

Query: 301 IGVAAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERP 360
           IGVAAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERP
Sbjct: 301 IGVAAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERP 360

Query: 361 FTEINKAFEDLHAGDCLRTVLDLKK 385
           FTEINKAFEDLHAGDCLRTVLDLKK
Sbjct: 361 FTEINKAFEDLHAGDCLRTVLDLKK 385

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/380 (81%), Positives = 338/380 (88%)

Query: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65
           +EGK ITC+AAVAYEAGKPLT+EEI V+ P+AHEVR+KI YTAVCHTDAYTLSGVDPEGA
Sbjct: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61

Query: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
           FPSILGHEGAGIVES+GEGVTNVKPGDHVIALYTAEC++CKFCKSGKTNLC SVRATQGK
Sbjct: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTG 185
           GVMPDGT+RF N+KGE++ HFMGCSTFSQYT               L+  CLLGCGVTTG
Sbjct: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245
           YGAA KTANVQKGDTVAVFGAGTVGLSV+QGAKVRGASRII+VDINDQK+++ NEFGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241

Query: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           F+NP  DLKDG+TIV+ L+EMTDGGLDYTFDCTGNT VMR ALEACHKGWG S+IIGVAA
Sbjct: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301

Query: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365
           A +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY  G LKVDEFIT+ R FT+IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361

Query: 366 KAFEDLHAGDCLRTVLDLKK 385
            AFEDLH GDCLRTVLDL K
Sbjct: 362 SAFEDLHHGDCLRTVLDLLK 381

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/380 (81%), Positives = 337/380 (88%)

Query: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65
           T GK ITC+AAVAYEAGKPLTVEEI VE P+AHEVRI+I YTAVCHTDAYTLSGVDPEGA
Sbjct: 4   TVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA 63

Query: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
           FPSILGHEGAG+VESVG+GVTNVKPGDHV+ALYTAECQKCKFC SGKTNLC SVRATQGK
Sbjct: 64  FPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGK 123

Query: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTG 185
           GVMPDGTSRF+ + GE + HFMGCSTFSQYT               L+ ICLLGCGVTTG
Sbjct: 124 GVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGVTTG 183

Query: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245
           YGAA KTANVQKGDTVAVFGAGTVGLSV+QGAK RGASRII+VDINDQK+++ ++FGATD
Sbjct: 184 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATD 243

Query: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           F+NP  DLK+G+TIV KLIE+TDGGLD+TFDCTGNTKVMRDALEACHKGWG S+IIGVAA
Sbjct: 244 FVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365
           A +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKVDEFIT+ RPFTEIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEIN 363

Query: 366 KAFEDLHAGDCLRTVLDLKK 385
            AF+DLH GDCLRTVLDL K
Sbjct: 364 AAFDDLHHGDCLRTVLDLSK 383

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/382 (82%), Positives = 339/382 (88%)

Query: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63
           ++T+GK ITC AAVAY AGKPLTVE+I V+ P+AHEVRIKIEYTAVCHTDAYTLSG+DPE
Sbjct: 70  SSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPE 129

Query: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123
           GAFPSILGHEG+GIVESVGEGVTNVK GDHVIALYTAEC KCKFCKSGKTNLC SVRATQ
Sbjct: 130 GAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQ 189

Query: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVT 183
           GKGVMPDGTSRF NQKGE L HFMGCSTFSQYT               L+SI LLGCGVT
Sbjct: 190 GKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGVT 249

Query: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243
           TGYGAA KTANVQKGDTVAVFGAGTVGLSV+QGAK RGAS+II+VDIN+ K+++  +FGA
Sbjct: 250 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309

Query: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
           TDF+NPK DLK+G+TIV+KLIEMTDGGL+YTFDCTGN KVMRDALEACHKGWG S+IIGV
Sbjct: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIGV 369

Query: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363
           A A EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDY+ G LKVDEFIT+ RPFTE
Sbjct: 370 AGAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTE 429

Query: 364 INKAFEDLHAGDCLRTVLDLKK 385
           IN AFEDLH GDCLRTVLDL K
Sbjct: 430 INDAFEDLHHGDCLRTVLDLAK 451

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/378 (82%), Positives = 339/378 (89%)

Query: 5   ATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEG 64
           +TEGK +T +AAVAYEAGKPL+VEEITV+ P+AHEVRI+++ TAVCHTDAYTLSG DPEG
Sbjct: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61

Query: 65  AFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQG 124
           AFPSILGHEGAGIVESVGEGVT+VKPGDHV+ALYTAEC KCKFCKSGKTNLC SVRATQG
Sbjct: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121

Query: 125 KGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTT 184
           KGVMPDGTSRFKN+KGE L HFMGCSTFS+YT               LES CLLGCGVTT
Sbjct: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTT 181

Query: 185 GYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGAT 244
           GYGAA KTANVQKGDTVA+FGAGTVGLSV QGAK RGAS+IILVDIND K+KY +EFGAT
Sbjct: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241

Query: 245 DFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVA 304
           DFINP +DL++GQTIVEKLIEMTDGGLD+TFDCTGN KVMRDALEACHKGWG SV+IGVA
Sbjct: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVA 301

Query: 305 AAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEI 364
           A+ +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+ G LKVDEFITN RPF +I
Sbjct: 302 ASGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361

Query: 365 NKAFEDLHAGDCLRTVLD 382
           N+AFEDLHAGD LRTVL+
Sbjct: 362 NEAFEDLHAGDSLRTVLN 379

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/380 (80%), Positives = 335/380 (88%)

Query: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65
           +EGK ITC AAVAYEAGKPLTVEEI V+ P+AHEVRIK+EYTAVCHTDAYTLSGVDPEGA
Sbjct: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61

Query: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
           FPSILGHEGAG+VESVGEGVTNVK GDHVIALYTAEC++CKFCKSGKTNLC SVRATQGK
Sbjct: 62  FPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTG 185
           GVMPDGTSRF N+KGE+L HFMGCSTFSQYT               L+  CLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245
           YGAA KTA+VQKGDTVA+FGAGTVGLSV+QGA VRGAS+II+VDINDQK+++  +FGATD
Sbjct: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241

Query: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           F+NP   LKDGQTIV+KL+EMTDGGLD+TFDCTGNT VMR ALEACHKGWG S+IIGVAA
Sbjct: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301

Query: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365
           A +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKVDEFIT+ R FT+IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361

Query: 366 KAFEDLHAGDCLRTVLDLKK 385
            AFEDLH GDCLRTVLDL K
Sbjct: 362 SAFEDLHHGDCLRTVLDLSK 381

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/380 (79%), Positives = 330/380 (86%)

Query: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65
           T+GK I C+AAVAY+A +PLTVEEI VE P AHEVRIKI +TAVCHTDAYTLSGVDPEGA
Sbjct: 4   TQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDPEGA 63

Query: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
           FP +LGHEG+GIVESVGEGV++VK GDHVIALYTAEC  CKFCKSGKTNLC SVR TQGK
Sbjct: 64  FPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRETQGK 123

Query: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTG 185
           GVMPDGTSRFKN KGE L HFMGCSTFSQYT               L+S+CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGVTTG 183

Query: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245
           YGAA KTANVQK DTVAVFGAGTVGLSV+QGA+ RGAS+II+VD+N +K  Y  +FGATD
Sbjct: 184 YGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFGATD 243

Query: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           FINP +DLK G+TIV KL+EMTDGGLD+TFDCTGN KVMRDALE CHKGWG S+IIGVAA
Sbjct: 244 FINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIGVAA 303

Query: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365
           A +EISTRPFQLVTGRVWKGSAFGG+KGRSEMGGLIE Y+KG LKVD+FITN+RPFTEIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFTEIN 363

Query: 366 KAFEDLHAGDCLRTVLDLKK 385
            AFEDLH GDCLRTVLDL+K
Sbjct: 364 AAFEDLHHGDCLRTVLDLEK 383

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/380 (78%), Positives = 333/380 (87%)

Query: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63
           +AT GK I CVAAVAYEAGKPLTVE+I V+AP+AHEVR+++ +TAVCHTDAYTLSGVDPE
Sbjct: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62

Query: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123
           GAFPSILGHEGAGIVESVG+GVTNVK GDHV+ LYTAEC KCKFCKS KTNLC SVRATQ
Sbjct: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122

Query: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVT 183
           GKGVMPDGT+RF N KGE L HFMGCSTFSQYT               L S+CLLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182

Query: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243
           TGYGAA KTANVQ+GDTVAVFGAGTVGLSV+QGAK RGAS+II+VD+NDQK+++  +FGA
Sbjct: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242

Query: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
           T F+NP  DLK+G+TIV KLI+MTDGGLD+TFDCTGN KVMRDALEACHKGWG S+IIGV
Sbjct: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGV 302

Query: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363
           AAA EEISTRPFQL+TGRVWKGSAFGGIKGRSEMG L+  Y+KG LKVD+FIT++RPFTE
Sbjct: 303 AAAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362

Query: 364 INKAFEDLHAGDCLRTVLDL 383
           IN AFEDLH GDCLRTVLDL
Sbjct: 363 INNAFEDLHHGDCLRTVLDL 382

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/380 (79%), Positives = 330/380 (86%)

Query: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63
           AAT GK I C+AAVAY+A KP +VEEITV+AP+AHEVRIKIEYTAVCHTDAYTLSG DPE
Sbjct: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123
           G FP ILGHEGAGIVESVG+GV  VKPGDHVIALYTAEC KCKFC SGKTNLCS+VRATQ
Sbjct: 63  GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122

Query: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVT 183
           GKGVMPDGT+RF N KG+++ HFMGCSTFS+YT               L++ CLLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVT 182

Query: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243
           TGYGAA KTANVQKGDTVAVFG GTVGLSVIQGAK+RGAS+II VDIN+ K+KY ++FGA
Sbjct: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGA 242

Query: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
           TDFINPK DL   QTIVEKL+EMTDGGLD+TFDCTGNTK+MRDALEACHKGWG S+IIGV
Sbjct: 243 TDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363
           AAA EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+ G LKV+EFIT+ RPF E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKE 362

Query: 364 INKAFEDLHAGDCLRTVLDL 383
           IN AFEDLH GDCLRTVL  
Sbjct: 363 INHAFEDLHNGDCLRTVLKF 382

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/378 (79%), Positives = 332/378 (87%)

Query: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63
           AAT GK I C+AAVAY+A KPL+VEEITV+AP+AHEVRIKIEYTAVCHTDAYTLSG DPE
Sbjct: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123
           G FP +LGHEGAGIVESVG+ V  VKPGDHVIALYTAEC KCKFC SGKTNLC +VRATQ
Sbjct: 63  GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQ 122

Query: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVT 183
           GKGVMPDGT+RF N KGE++ HFMGCSTFS+YT               L++ CLLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182

Query: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243
           TG+GAA KTANVQKGDTVAVFG GTVGLSVIQGAK+RGAS+II +DIN++K++Y ++FGA
Sbjct: 183 TGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQFGA 242

Query: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
           TDF+NPK DL   QTIVEKLIEMTDGGLD+TFDCTGNTK+MRDALEACHKGWG S+IIGV
Sbjct: 243 TDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363
           AAA EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+KG LKV+EFIT+ RPF E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKE 362

Query: 364 INKAFEDLHAGDCLRTVL 381
           IN+AFEDLH GDCLRTVL
Sbjct: 363 INQAFEDLHNGDCLRTVL 380

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/382 (78%), Positives = 329/382 (86%)

Query: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63
           AAT GK I CVAAVAY A K L+VEEITV+ P+AHEVRIKIE+TAVCHTDAYTLSG DPE
Sbjct: 3   AATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPE 62

Query: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123
           G FP ILGHEGAGIVESVG+ V  VKPGDHVIALYTAEC KCKFC SGKTNLCS+VRATQ
Sbjct: 63  GLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122

Query: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVT 183
           GKGVMPDGT+RF N KGE++ HFMGCSTFS+YT               L++ CLLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182

Query: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243
           TGYGAA KTANVQ+GDTVAVFG GTVGLSV+QGAK RGAS+II VDIN++KR+Y + FGA
Sbjct: 183 TGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGA 242

Query: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
           TDFINPK DL + QTIVEKLI+MTDGGLD+TFDCTGNT +MRDALEACHKGWG S+IIGV
Sbjct: 243 TDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIIIGV 302

Query: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363
           AAA EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+ G LKV+EFIT+ RPF E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKE 362

Query: 364 INKAFEDLHAGDCLRTVLDLKK 385
           IN+AFEDLH GDCLRTVL  ++
Sbjct: 363 INQAFEDLHNGDCLRTVLRFQE 384

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/378 (77%), Positives = 329/378 (87%)

Query: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65
           T+GK I C AAVAY AG+PL +E++TV+ P+AHEVRIKI  +A+CHTDAYTLSG DPEG 
Sbjct: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63

Query: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
           FP ILGHEG+GIVESVGEGVTNVKPGDHV+ LYTAECQ+CKFC SGKTNLC +VRATQGK
Sbjct: 64  FPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123

Query: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTG 185
           GVMPDGTSRF+N KGE L HFMGCSTFS+YT               LE++CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGVTTG 183

Query: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245
           YGAA KTA+VQ+GDTVAVFGAGTVGLSV+QGAK R ASRII+VDIND KR++ ++FGATD
Sbjct: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243

Query: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           FINPK+DLK+G+TIV +LIEMTDGGLD+TFDCTGNTKVMRDALEACHKGWG S+IIGVAA
Sbjct: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365
           A +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  GTLKV EF+T++RPF EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363

Query: 366 KAFEDLHAGDCLRTVLDL 383
             FEDLH GDCLRTVL L
Sbjct: 364 SGFEDLHHGDCLRTVLSL 381

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/382 (77%), Positives = 329/382 (86%)

Query: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63
           A+T GK I C+AA+AY+A KPL+VEEITV+ P+AHEVRIKIEYTAVCHTDAYTLSG DPE
Sbjct: 3   ASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123
           G FP ILGHEGAGIVESVG+ VT VKPGDHVIALYTAEC KCKFC SGKTNLCS+VRATQ
Sbjct: 63  GLFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122

Query: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVT 183
           G+G+MPD T+RF N KGE++ HFMGCSTFS+YT               L++  LLGCGVT
Sbjct: 123 GRGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCGVT 182

Query: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243
           TGYGAA KTANVQKGDTVAVFG GTVGLSVIQGAK RGAS+II +DIN++K++Y  +FGA
Sbjct: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDFGA 242

Query: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
           TDFINPK DL  GQTIVEKLIE TDGGLD+TFDCTGNTK+MRDALEACHKGWG S+IIGV
Sbjct: 243 TDFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363
           AAA EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+ G LKV+EFIT+ RPF E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPFKE 362

Query: 364 INKAFEDLHAGDCLRTVLDLKK 385
           IN+AFEDLH GDCLRTVL   K
Sbjct: 363 INQAFEDLHQGDCLRTVLKFDK 384

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/380 (78%), Positives = 320/380 (84%)

Query: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65
           TEGK I C+AAVAYEAGKP  VE+I V+ P+AHEVRIKI  TAVCHTDAYTLSG DPEG 
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
           FP +LGHEGAGIVESVG+GVTNVKPGDHVIALYTAECQKCKFC SGKTNLC +VRATQGK
Sbjct: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121

Query: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTG 185
           GVMPDGTSRF N+KGE L HFMGCSTFS+YT               LES+CLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181

Query: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245
           YGAA KTANVQKGDTVAVFG GTVGLSV+QGA  RGASRII +D NDQK+ +  +FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241

Query: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           FINP  DLK+ +TIV KLIEMTDGGLD+TFDCTGN  VMR ALEACHKGWG SVIIGVAA
Sbjct: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301

Query: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365
           A +EISTRPFQLVTGRVWKGSAFGG+KGRSEM GLIE YKKG LKVDEFIT+ R F EIN
Sbjct: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361

Query: 366 KAFEDLHAGDCLRTVLDLKK 385
           +AF+DLH G CLRTVL   K
Sbjct: 362 EAFDDLHNGLCLRTVLSFSK 381

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/380 (77%), Positives = 325/380 (85%), Gaps = 1/380 (0%)

Query: 5   ATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEG 64
           +T GK ITC AAVAYEA KPL VEEI V+ P+AHEVRIKI  TAVCHTDAYTLSGVDPEG
Sbjct: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61

Query: 65  AFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQG 124
            FP +LGHEG+GIVESVG+ VT VKPGDHV+ALYTAEC KCKFC SGKTNLC SVRATQG
Sbjct: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 125 KGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTT 184
           KGVMPDGT RF N+KGE L HFMGCSTFS+YT               L+S+CLLGCGVTT
Sbjct: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181

Query: 185 GYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGAT 244
           GYGAA KTANVQKGDTVAVFGAGTVGLSV+QGAK RGAS+II+VDIN+ K+++  EFGAT
Sbjct: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241

Query: 245 DFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVA 304
           DF+NP S+L +GQ IV KL+EMTDGGLD+TFDCTGN  VMRDALEACHKGWG S+IIGVA
Sbjct: 242 DFVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300

Query: 305 AAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEI 364
           AA +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+ G+LKVDEFITN RPF EI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360

Query: 365 NKAFEDLHAGDCLRTVLDLK 384
           N AFE+LH G+CLRTVL  K
Sbjct: 361 NDAFEELHHGNCLRTVLSFK 380

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/378 (76%), Positives = 321/378 (84%)

Query: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65
           T GK+I C AA+AY AG PL +E ITV+ P+AHEVRIKI +TA+CHTDAYTLSGVDPEG 
Sbjct: 4   TAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI 63

Query: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
           FPSILGHEG+GIVESVG GVTNVK GDHVI LYTAECQ+CKFC SGKTNLC SVRATQGK
Sbjct: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGK 123

Query: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTG 185
           G+MPDGTSRFKN KGE + HFMGCSTFS+YT               L+ +CLLGCGVTTG
Sbjct: 124 GLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTG 183

Query: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245
           YGAA KTA+VQKGDTVAVFGAGTVGLSV+QGA+ RGAS+II+VDIND K+K+  +FGATD
Sbjct: 184 YGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATD 243

Query: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           FINP  DL DG+TIV KLI+MTDGGLD+TFDCTGNTKVMRDALEACHKGWG S+IIGVAA
Sbjct: 244 FINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365
           A +EISTRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  G LKVDEF+T+ RPF+EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEIN 363

Query: 366 KAFEDLHAGDCLRTVLDL 383
               DLH GDCLRTVL+ 
Sbjct: 364 DGLTDLHHGDCLRTVLNF 381

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/375 (76%), Positives = 316/375 (84%), Gaps = 1/375 (0%)

Query: 8   GKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFP 67
           GK ITC AA+AYEA KPLTV EI V+ P+AHEVRIKI  TAVCHTDAY+LSGVDPEG FP
Sbjct: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64

Query: 68  SILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGV 127
            +LGHEG+GIVES+G  VTNVK GDHVIALYTAEC KCKFC SGKTNLC SVRATQGKGV
Sbjct: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124

Query: 128 MPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYG 187
           MPDGT+RF ++ G+ + HFMGCSTFSQYT                E   LLGCGVTTGYG
Sbjct: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184

Query: 188 AATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFI 247
           AA KTAN+QKGDTVAVFGAGTVGLSV+QGAK RGAS+II+VD+N+ K+ +  EFGATDF+
Sbjct: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244

Query: 248 NPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAE 307
           NPK +LKD + IV KLIEMTDGGLD+TFDCTGN  VMR+ALEACHKGWG S+IIGVAAA 
Sbjct: 245 NPK-ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303

Query: 308 EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKA 367
           +EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLI+DY+ GTLKVDEFIT  RPFTEIN A
Sbjct: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363

Query: 368 FEDLHAGDCLRTVLD 382
           FEDLH G CLRTVLD
Sbjct: 364 FEDLHNGSCLRTVLD 378

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/378 (72%), Positives = 319/378 (84%)

Query: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63
           ++T+GK+I C AAVAYEA KPL V+++ V+AP+AHEVRIKI  TA+CHTDAYTLSGVDPE
Sbjct: 2   SSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPE 61

Query: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123
           G FP ILGHEG+GIVES+GEGVT+VK GDHVI LYTAECQKCKFCKSGKTNLC +VR TQ
Sbjct: 62  GLFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQ 121

Query: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVT 183
           GKGVMPDGTSRF   +G+++ HFMGCSTFS+YT               LE   LLGCGVT
Sbjct: 122 GKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVT 181

Query: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243
           TG+GAA K ANVQKGDTVAVFGAGTVGLSV+QGA++RG S++I+VDIND+K+++  +FGA
Sbjct: 182 TGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGA 241

Query: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
           TDF+NP +DLKDG+TIV KLI MTDGGLDYTFDCTGN  VMR+ALEACHKGWG S IIGV
Sbjct: 242 TDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGV 301

Query: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363
           AAA +EISTRPFQLVTGRVW+G+AFG IKGR++M  L++DY+KG LK+DEFIT+ R F E
Sbjct: 302 AAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDE 361

Query: 364 INKAFEDLHAGDCLRTVL 381
           IN  FEDLH G CLRTVL
Sbjct: 362 INDGFEDLHMGTCLRTVL 379

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/380 (71%), Positives = 308/380 (81%), Gaps = 1/380 (0%)

Query: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPR-AHEVRIKIEYTAVCHTDAYTLSGVDP 62
           A TEG++ITC AAVAY AGKPLTVE+ITVEAP  A       ++  + H   +++     
Sbjct: 2   ANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSE 61

Query: 63  EGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRAT 122
                   G  GAG+VESVG  VT+VK GDHVIALYTAEC++CK CKSGKTNLCS+VRAT
Sbjct: 62  VRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRAT 121

Query: 123 QGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGV 182
           QGKGVMPDGTSRF+N KGE L HFMGCSTF++YT               LE +CLLGCGV
Sbjct: 122 QGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGV 181

Query: 183 TTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFG 242
           TTGYGAA KTANVQKGDTVAVFGAGT+GLSV+QGAK R AS+II+VDIND K+K+  +FG
Sbjct: 182 TTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFG 241

Query: 243 ATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIG 302
           ATDF+NPK+DLKDGQTIVEKL+EMTDGGLD+TFD TGN +VMRDALEACHKGWG S+IIG
Sbjct: 242 ATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSIIIG 301

Query: 303 VAAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFT 362
           VAAA +EISTRPFQLVTGRVWKGSAFGG+KGRSEMG LIEDY KG LK+DEFITN+RPF 
Sbjct: 302 VAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFK 361

Query: 363 EINKAFEDLHAGDCLRTVLD 382
           EIN+ FEDLH GDCLRTVL+
Sbjct: 362 EINEGFEDLHHGDCLRTVLN 381

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/382 (71%), Positives = 301/382 (78%), Gaps = 46/382 (12%)

Query: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63
           + T+GK ITC AAVAYEAGKPLTVE+I V+ P+AHEVRIKI+YTAVCHTDAYTLSGVDPE
Sbjct: 87  STTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPE 146

Query: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123
           GAFPSILGHEG+GIVESVGEGVTNVK GDHVIALYTAEC        G+   C S     
Sbjct: 147 GAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAEC--------GECKFCKSGXXXX 198

Query: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVT 183
               +       KN                                  ++SICLLGCGVT
Sbjct: 199 XXXAVD------KNAP--------------------------------MDSICLLGCGVT 220

Query: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243
           TGYGAA KTANVQKGDTVAVFGAGTVGLSV+QGAK RGAS+II+VD+NDQK+++  +FGA
Sbjct: 221 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGA 280

Query: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
           TDFINPK+DLK+G+TIV KLIEMTDGGL+YTFDCTGNTKVMRDALEACHKGWG S+IIGV
Sbjct: 281 TDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIIIGV 340

Query: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363
           AAA EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+ G LKVDEFIT+ RPFTE
Sbjct: 341 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTE 400

Query: 364 INKAFEDLHAGDCLRTVLDLKK 385
           IN AFEDLH GDCLRTVLDL K
Sbjct: 401 INNAFEDLHHGDCLRTVLDLSK 422

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  423 bits (1088), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 206/377 (54%), Positives = 266/377 (70%), Gaps = 3/377 (0%)

Query: 7   EGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAF 66
           EG+ I C AAVAY   KPL +E+I V+ P+ HEVR+K+  TA+C TD +TL G++PEG F
Sbjct: 5   EGEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNPEGKF 64

Query: 67  PSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKG 126
           P +LGHEG+GIVES G  V  VK GDHV+ LY  EC  C  CKS K+NLCS ++ATQ +G
Sbjct: 65  PCVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKATQAQG 124

Query: 127 VMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGY 186
           VMP G+SR  N + + L HFMGCS+FSQY                L+ ICLLGCGVTTG+
Sbjct: 125 VMPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGVTTGF 184

Query: 187 GAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDF 246
           GA      V+ GD VAVFG+GTVGLSV+Q        ++I+VD+ D KR++   FGATDF
Sbjct: 185 GAPI-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFGATDF 243

Query: 247 INPKSDLKDGQTIVEKLIEMTDG-GLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           INP+   K+ +++++ LI+ + G G D+TFDCTG+T VMR ALE+C KGWGTSVIIG+A 
Sbjct: 244 INPQKIPKN-KSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVIIGLAG 302

Query: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365
           A EEIST P+ L+ GR W+G AFGG+KGRSE+  L+E Y    +K+DE+ITN+RP  EIN
Sbjct: 303 AGEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPLKEIN 362

Query: 366 KAFEDLHAGDCLRTVLD 382
           +A ++L  G  L+TVLD
Sbjct: 363 EALKELEDGLVLKTVLD 379

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score =  113 bits (283), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 95/356 (26%), Positives = 155/356 (43%), Gaps = 35/356 (9%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE G  L  +++ V  P+ +E+ I + Y+ VCHTD +   G  P GA  P + GHEGA
Sbjct: 35  IFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLGAKLPLVGGHEGA 94

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V + G  VTN + GD+  I      C  C+FC+ G  + C+                 
Sbjct: 95  GVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKA--------------- 139

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  +  + C   T Y  A K ++
Sbjct: 140 -------DLSGYTHDGSFQQYATADAIQAAQIPKGTDLAQVAPILCAGVTVY-KALKDSD 191

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           V+ G  VA+ G AG +G   +Q AK  G  R++ +D  D+KRK     G   F+    D 
Sbjct: 192 VKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFESLGGNHFV----DF 246

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + +V ++ E+T+GG     + + + K +  ++E   +  GT V++G+ A     S  
Sbjct: 247 TKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVEYV-RPCGTVVLVGLPAGATVKSDV 305

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFE 369
              ++     KGS  G    R++    I+ + KG +K    +       E+ K  E
Sbjct: 306 FNHVIKSINIKGSYVG---NRADTREAIDFFAKGQVKSPIKVVGLSELPEVYKLME 358

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score =  107 bits (267), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 101/373 (27%), Positives = 162/373 (43%), Gaps = 39/373 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE   PL  ++I V  P+++E+ I +EY+ VCHTD +   G  P     P + GHEGA
Sbjct: 40  IFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 99

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V  +G+ V N K GD   I      C  C+ C++G    C                  
Sbjct: 100 GVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHA--------------- 144

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L ++  + C   T Y  A KTA+
Sbjct: 145 -------DLSGYTHDGSFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY-KALKTAD 196

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ GD VA+ G AG +G   +Q A   G  R+I +D  + K+K   + G   FI    D 
Sbjct: 197 LKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVFI----DF 251

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + IV+ + E T GG     + + + K +  +++      GT V++G+ A     S  
Sbjct: 252 TKSKDIVKDIQEATHGGPHGVINVSVSDKAISQSVQYIRPT-GTVVVVGMPANAVVKSDV 310

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
             Q+V     KGS  G    R++    ++ + +G +K    +      +E+ K +E +  
Sbjct: 311 FNQVVKSIQIKGSYVG---NRADTREALDFFTRGLVKSPIKVVG---LSELPKVYELMET 364

Query: 374 GDCL-RTVLDLKK 385
           G  L R V+D  K
Sbjct: 365 GKILGRYVVDTSK 377

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score =  107 bits (266), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 98/375 (26%), Positives = 167/375 (44%), Gaps = 40/375 (10%)

Query: 16  AVAYEA-GKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           AV +E  G  L  ++I V  P+++E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFETNGGKLEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V ++G+ V   K GD+  I      C  C++C+ G  + C                
Sbjct: 72  GAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHA------------- 118

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                    +L  +    +F QY                L  +  + C   T Y  A K+
Sbjct: 119 ---------DLSGYTHDGSFQQYATADAVQAARIAPGSDLAEVAPVLCAGITVY-KALKS 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN++ G+ VA+ GA G +G   IQ AK  G  R++ +D  D+K K   + G   FI    
Sbjct: 169 ANLRAGEWVAISGACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKDLGGEVFI---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEIS 311
           D    + IV  +I+ T+GG     + + + + +  +++ C    GT+V++G+    +  S
Sbjct: 224 DFTKTKDIVGDIIKATNGGAHGVINVSVSEQAIDASVKYCRAN-GTAVLVGMPGGAQVKS 282

Query: 312 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDL 371
               Q+V      GS  G    R++    ++ + +G +K    I      +++ + FE +
Sbjct: 283 DVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIHIAK---LSDVPEIFEKM 336

Query: 372 HAGDCL-RTVLDLKK 385
             G  + R V+D  K
Sbjct: 337 EKGQIVGRYVVDCSK 351

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score =  107 bits (266), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 100/373 (26%), Positives = 163/373 (43%), Gaps = 39/373 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE G  L  +++ V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 52  IFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGA 111

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V + GE VTN + GD+  I      C  C+ C+ G    C                  
Sbjct: 112 GVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHA--------------- 156

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  I  + C   T Y  A KTA+
Sbjct: 157 -------DLSGYTHDGSFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY-KALKTAD 208

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           V+ G  VA+ G AG +G   +Q AK  G  R++ +D  + K+K  ++ G   FI    D 
Sbjct: 209 VRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETFI----DF 263

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
           +  + +V  + E T GG     + + +   +  + E   +  G+ V++G+ A     S  
Sbjct: 264 RTTKDMVGAIQEATQGGPHAVINVSVSEAAISMSTEYV-RPTGSVVLVGLPANAYVKSEV 322

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
              +V     KGS  G    R++    I+ + +G +K    I      +E+ +A++ + A
Sbjct: 323 FSHVVKSISIKGSYVG---NRADTREAIDFFARGLVKAPIKIIG---LSELPEAYKLMEA 376

Query: 374 GDCL-RTVLDLKK 385
           G  L R V+D +K
Sbjct: 377 GKILGRYVVDTEK 389

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score =  105 bits (262), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 99/375 (26%), Positives = 162/375 (43%), Gaps = 39/375 (10%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A + YE G  L  ++I V  P+++E+ I I+Y+ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAGIV  +GE V   K GD+  I      C  C++C+    + C            PD  
Sbjct: 72  GAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC------------PDA- 118

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                    +L  +    +F QY                L  +  + C   T Y  A K+
Sbjct: 119 ---------DLSGYTHDGSFQQYATADAVQAARIAPGTDLAEVAPVLCAGITVY-KALKS 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN++ G+ VA+ GA G +G   IQ AK  G  R++ +D  D+K     E G   FI    
Sbjct: 169 ANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFKELGGEVFI---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEIS 311
           D    + +V+ +++ T+GG     + + +   +  +   C    GT V++G+    +  S
Sbjct: 224 DFTKTKDVVKAVVDATNGGAHGVINVSVSEAAIEASTVYCRAN-GTVVLVGLPGGAKCKS 282

Query: 312 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDL 371
               Q+V      GS  G    R++    ++ + +G +K    +      +E+   +E +
Sbjct: 283 DVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIMVVG---LSELPSIYEKM 336

Query: 372 HAGDCL-RTVLDLKK 385
             G  + R V+D  K
Sbjct: 337 EKGAIVGRYVVDTSK 351

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score =  105 bits (262), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 98/368 (26%), Positives = 161/368 (43%), Gaps = 39/368 (10%)

Query: 22  GKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGAGIVES 80
           G PL  +EI V  P+A+E+ I ++Y+ VCHTD +   G  P     P + GHEGAGIV +
Sbjct: 18  GGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGIVVA 77

Query: 81  VGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQK 139
           +G+ V N   GD+  I      C  C+ C+    + C     +   G   DG        
Sbjct: 78  MGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQADLS---GYTHDG-------- 126

Query: 140 GEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGD 199
                      +F QY                L  +  + C   T Y  A K+AN++ GD
Sbjct: 127 -----------SFQQYATADAVQAAKIPHGTDLAEVAPILCAGVTVY-KALKSANLKAGD 174

Query: 200 TVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQT 258
            VA+ GA G +G   IQ A   G  R++ +D  ++K +   + G   FI    D    + 
Sbjct: 175 WVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKLGGEYFI----DFTKCKD 229

Query: 259 IVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLV 318
           ++ +++E+TDGG     + + +   +  +   C    GT V++G+ A     S    Q+V
Sbjct: 230 VIAEILEVTDGGAHGVINVSVSEAAIEASTRYCRAN-GTVVLVGLPANAYCKSEVFSQVV 288

Query: 319 TGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHAGDCL- 377
                 GS  G    R++    ++ + +G +K    I    P +++ + F+ +  G  + 
Sbjct: 289 KSISIVGSYVG---NRADTRQALDFFARGLVKSPIHIA---PLSDLPEIFDKMAKGQIVG 342

Query: 378 RTVLDLKK 385
           R V+D  K
Sbjct: 343 RYVVDTSK 350

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score =  105 bits (263), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 101/373 (27%), Positives = 161/373 (43%), Gaps = 39/373 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE+G  L  +++ V  PR +E+ + ++Y+ VCHTD +   G  P +   P + GHEGA
Sbjct: 33  IFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGA 92

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V + GE V N + GD   I      CQ C+ C+ G  + C+    +   G   DG   
Sbjct: 93  GVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHADLS---GYTHDG--- 146

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           TF QY                L  +  + C   T Y  A +++ 
Sbjct: 147 ----------------TFQQYATADAIQAAHIPKGTDLAGVAPILCAGVTVY-KALRSSG 189

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
            + G+ VA+ G AG +G    Q A+  G  R++ +D  + K K     G   FI    D 
Sbjct: 190 ARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFKSLGGEIFI----DF 244

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + I   ++E T GG     + + + K M  ++E   +  GT V++G+ A     S  
Sbjct: 245 TKEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVEYV-RPQGTVVLVGLPANAVIKSNV 303

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
              +V     KGS  G    R++    +E + +G +K    I      +E+ K +E + A
Sbjct: 304 FNHVVKSFSIKGSYVG---NRADSREAVEFFSRGLVKSPIKIVG---LSELPKIYELMEA 357

Query: 374 GDCL-RTVLDLKK 385
           G  L R V+D  K
Sbjct: 358 GKILGRYVVDTSK 370

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score =  104 bits (259), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 102/375 (27%), Positives = 159/375 (42%), Gaps = 39/375 (10%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHE 73
           A V YE G PL    I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 38  AVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHE 97

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V + G  V N + GD+  I      C  C+ C+ G  + C     +   G   DG 
Sbjct: 98  GAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNCEQADLS---GYTHDG- 153

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                             +F QY                L  +  + C   T Y  A KT
Sbjct: 154 ------------------SFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY-KALKT 194

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           A+V+ G  VA+ GA G +G   +Q AK  G  R++ +D  D+K+K  +  G   F+    
Sbjct: 195 ADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIFV---- 249

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEIS 311
           D     +IV+ + ++T+GG     + + +      + E      GT V++G+ A     S
Sbjct: 250 DFTKTHSIVKDIQDVTNGGPHGVINVSVSELATSMSTEYVRPA-GTVVLVGLPANSYVKS 308

Query: 312 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDL 371
                +V     KGS  G    R++    ++ +++G +K    I      +E+   +E +
Sbjct: 309 EVFSHVVKSINIKGSYVG---NRADTREALDFFQRGLVKSPIKIVG---LSELPMVYELM 362

Query: 372 HAGDCL-RTVLDLKK 385
                L R VLD  K
Sbjct: 363 AQNKILGRYVLDTSK 377

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score =  104 bits (259), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 104/376 (27%), Positives = 159/376 (42%), Gaps = 42/376 (11%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE G PLT +++ V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 37  IFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 96

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           GIV + G  V N + GD   I      C  C+ C+ G  + C                  
Sbjct: 97  GIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHA--------------- 141

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  +  + C   T Y  A KTA 
Sbjct: 142 -------DLSGYTHDGSFQQYATADATQAAQIPRGTDLAEVAPILCAGVTVY-KALKTAA 193

Query: 195 VQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           +Q G+ VA+ GA G +G   IQ AK  G  R++ +D  + K K   E G   FI+  +  
Sbjct: 194 LQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFKELGGETFID-FTKY 251

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEEEI 310
           K+ + +++ + E T GG         N  V   A+ A     +  GT VI+G+ A     
Sbjct: 252 KNNEAMIKDIQEATKGGPQGVI----NVSVSEAAISASTQYVRPTGTVVIVGMPAGAYVK 307

Query: 311 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFED 370
           S     +V     KGS  G    R++    I+ + +G +K    +      +E+ K +E 
Sbjct: 308 SDVFSHVVKSISIKGSYVG---NRADTREAIDFFSRGLVKSPITVVG---LSELPKIYEL 361

Query: 371 LHAGDCL-RTVLDLKK 385
           +     L R V+D  K
Sbjct: 362 MEKNKILGRYVVDTSK 377

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score =  103 bits (256), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 102/375 (27%), Positives = 162/375 (43%), Gaps = 40/375 (10%)

Query: 16  AVAYEA-GKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHE 73
           AV +E  G  L  ++I V  P++ E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFETNGGKLEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAGIV  VGE V   K GD   I      C  C++C+ G  + C +              
Sbjct: 72  GAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNCPNA------------- 118

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                    +L  +    +F QY                L  +  + C   T Y  A K+
Sbjct: 119 ---------DLSGYTHDGSFQQYATADAVQAARIPQGTDLAEVAPVLCAGITVY-KALKS 168

Query: 193 ANVQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN++ G+ VA+ G AG +G   +Q AK  G  RI+ +D  ++K K   E G   FI    
Sbjct: 169 ANLRAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRELGGEIFI---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEIS 311
           D    + IV  +I+ T+GG     + + +   +  + E C    GT V++G+    +  S
Sbjct: 224 DFTKTKDIVGDIIKATNGGAHGVINVSVSEAAIGASTEYCRAN-GTVVLVGLPRDAKCKS 282

Query: 312 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDL 371
               Q+V      GS  G    R++    ++ + +G +K    I    P +++ + F  +
Sbjct: 283 DVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIHIA---PLSDLPEIFGKM 336

Query: 372 HAGDCL-RTVLDLKK 385
             G  + R V+D  K
Sbjct: 337 EKGQIVGRYVVDTSK 351

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score =  103 bits (256), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 92/375 (24%), Positives = 165/375 (44%), Gaps = 40/375 (10%)

Query: 16  AVAYEA-GKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A+ +E+ G PL  ++I V  P+++E+ + I+Y+ VCHTD +   G  P +   P + GHE
Sbjct: 12  AIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPLVGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAGIV ++G+ V   K GD+  +      C  C++C+ G  + C +              
Sbjct: 72  GAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNCPNA------------- 118

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                    +L  +    +F QY                L  +  + C   T Y  A K+
Sbjct: 119 ---------DLSGYTHDGSFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY-KALKS 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN++ G+ VA+ GA G +G   IQ A   G  R++ +D  D K K   +     FI    
Sbjct: 169 ANLRAGEWVAISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVFI---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEIS 311
           D    + ++ ++ ++T+GG     + + +   +  + + C    GT V++G+    +  S
Sbjct: 224 DFTKTKDVISEVNKVTNGGAHGVINVSVSEAAIEASTKYCRAN-GTVVLVGLPGGAKCKS 282

Query: 312 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDL 371
               Q+V      GS  G    R++    ++ + +G +K    +    P + +   FE +
Sbjct: 283 DVFNQVVKSMTIVGSYVG---NRADTREALDFFTRGLVKAPIHVA---PLSTLPTIFEKM 336

Query: 372 HAGDCL-RTVLDLKK 385
             G  + R V+D  +
Sbjct: 337 EKGQIVGRYVVDTSR 351

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score =  102 bits (255), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 133/297 (44%), Gaps = 32/297 (10%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A + YE G  L   +I V  P+  E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 9   AVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V ++GE V   K GD   I      C  C++C+    + C            PD  
Sbjct: 69  GAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC------------PDA- 115

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                    +L  +    +F QY                L  +  + C   T Y  A K+
Sbjct: 116 ---------DLSGYTHDGSFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY-KALKS 165

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           A +Q G+ VA+ GA G +G   +Q AK  G  RI+ +D  ++K+K   E G   FI    
Sbjct: 166 ARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYFI---- 220

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEE 308
           D  + + +V ++I++T+GG     + + +   +  + E C    GT V++G+ A  +
Sbjct: 221 DFAESKDVVAEVIKVTNGGAHGVINVSVSEAAIAASAEYCRSN-GTVVLVGLPAGAQ 276

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score =  102 bits (255), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 97/373 (26%), Positives = 158/373 (42%), Gaps = 39/373 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE G  L  ++I V  P+A+E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 13  IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 72

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++GE V   K GD   I      C  C++C+    + C                  
Sbjct: 73  GVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNCPEA--------------- 117

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  +  + C   T Y  A K+AN
Sbjct: 118 -------DLSGYTHDGSFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY-KALKSAN 169

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ GD VA+ G AG +G   +Q AK  G  R++ +D  ++K K   + G   FI    D 
Sbjct: 170 LKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEYFI----DF 224

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + I E++IE T GG     + + +   +  +        GT V++G+    +  S  
Sbjct: 225 TKSKNIPEEVIEATKGGAHGVINVSVSEFAIEQSTNYVRSN-GTVVLVGLPRDAKCKSDV 283

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
             Q+V      GS  G    R++    I+ + +G +K    +      +E+   +E +  
Sbjct: 284 FNQVVKSISIVGSYVG---NRADTREAIDFFSRGLVKAPIHVVG---LSELPSIYEKMEK 337

Query: 374 GDCL-RTVLDLKK 385
           G  + R V+D  K
Sbjct: 338 GAIVGRYVVDTSK 350

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score =  102 bits (254), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 104/376 (27%), Positives = 159/376 (42%), Gaps = 45/376 (11%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE G  L  ++I V  P+A+E+ I ++Y+ VCHTD +   G  P +   P + GHEGA
Sbjct: 14  IFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPLDVKLPLVGGHEGA 73

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++GE V   K GD+  I      C  C++C+    + C     +   G   DG   
Sbjct: 74  GVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNCPEADLS---GYTHDG--- 127

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                L  +  + C   T Y  A K+AN
Sbjct: 128 ----------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSAN 170

Query: 195 VQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           +  G+ VA+ GA G +G   IQ AK  G  RI+ +D  D+K     E G   FI    D 
Sbjct: 171 LSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFKELGGEVFI----DF 225

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEEEI 310
              + I   +IE T+GG         N  V   A+E+     +  GT V++G+       
Sbjct: 226 TKTKDIEAAVIEATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTCVLVGLPGGAYCK 281

Query: 311 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFED 370
           S     +V      GS  G    R++    I+ + +G +K    I    P + + + FE 
Sbjct: 282 SEVFSHVVKSISIVGSYVG---NRADTREAIDFFTRGLVKAPIHIA---PLSAVPEIFEK 335

Query: 371 LHAGDCL-RTVLDLKK 385
           +  G  + R V+D  +
Sbjct: 336 MEKGQIVGRYVVDCNQ 351

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score =  101 bits (252), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 170/384 (44%), Gaps = 56/384 (14%)

Query: 16  AVAYEAGKPLTVEEITV-EAPRAHEVRIKIEYTAVCHTDA-YTLSGVDPEGAF----PSI 69
           AV  +    +T E+I V +    H V++ I+ T +C +D  Y  +G    G F    P +
Sbjct: 7   AVVLQKQGLITFEDIPVPQIEDPHYVKLAIKKTGICGSDVHYYKTGAI--GNFVVKDPMV 64

Query: 70  LGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMP 129
           LGHE +G+V  VG  VT+VK GD V        +  K  KSG  NLC S+       +  
Sbjct: 65  LGHESSGVVVEVGSKVTSVKVGDRVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPPI-- 122

Query: 130 DGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICL--LGCGVTTGYG 187
           DGT          LK+++    F                    E  C+  L  GV     
Sbjct: 123 DGTL---------LKYYLSPEDF---------LVKLPDSVSFEEGACVEPLSVGVH---- 160

Query: 188 AATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFI 247
            A K A+V+ G  V VFGAG VGL     ++  GA+ ++ VD+ D K +  NEFGAT  +
Sbjct: 161 -ANKLADVRFGSKVVVFGAGPVGLLAGAVSRAFGATDVVFVDVFDHKLERTNEFGATQTV 219

Query: 248 NPKSDLKDGQTIVEKLIEMTDG-GLDYTFDCTGNTKVMRDALEACHKGWGTSVIIG---- 302
           N  S  K    +V+++  +  G   +  F+C+G    +R  ++AC  G G  V +G    
Sbjct: 220 N-SSKFKSEDDLVKEIQRVLSGEQPEVVFECSGAEVCIRAGIKACKAG-GRYVQVGMGKD 277

Query: 303 -VAAAEEEISTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERP 360
            V     E+ ++  Q++ T R   G     +K  SE          G + V   IT+   
Sbjct: 278 NVNFPISEVVSKELQVLGTFRYCFGDYNDSVKLISE----------GKVNVKPLITHRFK 327

Query: 361 FTEINKAFE--DLHAGDCLRTVLD 382
           F +  KA+E    H  D ++T++D
Sbjct: 328 FQDAIKAYEFNIEHGEDVVKTIID 351

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 94/375 (25%), Positives = 161/375 (42%), Gaps = 39/375 (10%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A + YE G  L  ++I V  P+++E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V ++GE V   K GD+  I      C  C++C+    + C                
Sbjct: 72  GAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNCPEA------------- 118

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                    +L  +    +F QY                L  +  + C   T Y  A K+
Sbjct: 119 ---------DLSGYTHDGSFQQYATADAVQAARIPAGTDLAEVAPVLCAGITVY-KALKS 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN++ G+ VA+ GA G +G   IQ AK  G  R++ +D  ++K     E G   FI    
Sbjct: 169 ANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFKELGGEVFI---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEIS 311
           D    + +V+ +++ T+GG     + + +   +  +   C    GT V++G+    +  S
Sbjct: 224 DFTKTKDVVKAVVDATNGGAHGVINVSVSEAAIEASTVYCRAN-GTVVLVGLPGGAKCKS 282

Query: 312 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDL 371
               Q+V      GS  G    R++    ++ + +G +K    +      +E+   +E +
Sbjct: 283 DVFNQVVKSTTIVGSYVG---NRADTREALDFFARGLVKSPIKVVG---LSELPSIYEKM 336

Query: 372 HAGDCL-RTVLDLKK 385
             G  + R V+D  K
Sbjct: 337 EKGAIVGRYVVDTSK 351

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score =  101 bits (252), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 102/387 (26%), Positives = 170/387 (43%), Gaps = 41/387 (10%)

Query: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63
           + + G  +T  A + YE G  L  ++I V  P+ +E+ + ++Y+ VCHTD +   G  P 
Sbjct: 25  STSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPL 84

Query: 64  GA-FPSILGHEGAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRA 121
               P + GHEGAGIV + G  VTN + GD+  +      C  C++C++G  + C+    
Sbjct: 85  ATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEADL 144

Query: 122 TQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCG 181
           +   G   DG                   +F QY                L  +  + C 
Sbjct: 145 S---GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCA 182

Query: 182 VTTGYGAATKTANVQKGDTVAV-FGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNE 240
             T Y  A KTAN+  G  VA+    G +G   +Q AK  G  R++ +D    K     +
Sbjct: 183 GVTVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALFKK 240

Query: 241 FGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVI 300
            G   FI    D    + IV  + E T+GG     + + +   +  +++   +  GT V+
Sbjct: 241 LGGEVFI----DFTKSKDIVADIQEATNGGPHGAVNVSVSEAAIVQSVKYI-RPTGTVVL 295

Query: 301 IGVAAAEEEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNER 359
           +G+  A   +++  F  V   +  KGS  G    R++M   I+ + +G +K    I    
Sbjct: 296 VGL-PANSYVNSEIFSHVIKSISIKGSYVG---NRADMREAIDFFTRGLVKAPIKIIG-- 349

Query: 360 PFTEINKAFEDLHAGDCL-RTVLDLKK 385
             +E+  A+ +L AG+ + R V+D  K
Sbjct: 350 -LSELPTAYHELEAGNMVGRFVVDTSK 375

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 127/292 (43%), Gaps = 32/292 (10%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A + YE G PL   +I V  P+A E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V ++GE V   K GD   I      C  C++C+    + C                
Sbjct: 72  GAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNCPEA------------- 118

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                    +L  +    +F QY                L  +  + C   T Y  A K+
Sbjct: 119 ---------DLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKS 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN++ GD VA+ GA G +G   IQ A   G  R++ +D  ++K +   + G   FI    
Sbjct: 169 ANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQLGGEVFI---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
           D +  + IV  +++ T+GG     + + +   +  + E      GT V++G+
Sbjct: 224 DFRKSKDIVADVVKATNGGAHGVINVSVSEAAIESSTEYVRSN-GTVVLVGL 274

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 100/374 (26%), Positives = 160/374 (42%), Gaps = 41/374 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE G  L  E+I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 36  IFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 95

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++GE V   K GD   I      C  C++C+    + C                  
Sbjct: 96  GVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNCPHA--------------- 140

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  +  + C   T Y  A K+AN
Sbjct: 141 -------DLSGYTHDGSFQQYATADYVQAARIPEGTDLAEVSPILCAGVTVY-KALKSAN 192

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ GD VA+ G AG +G   +Q AK  G  R++ +D   +K +   + G   FI    D 
Sbjct: 193 LKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELVKKLGGEVFI----DF 247

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + +VE + E T+GG     + + +   M  + +      GT V++G+ A    I + 
Sbjct: 248 TKHKNLVEAVQEATNGGPHGVINVSVSEAAMTASTQFVRPT-GTVVLVGLPAG-AVIKSE 305

Query: 314 PFQLVTGRV-WKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLH 372
            F  V   +  KGS  G    R++    I+ + +G +K    +      +E+ K +E + 
Sbjct: 306 VFSHVVKSINIKGSYVG---NRADTREAIDFFARGMVKSPIHVVG---LSELPKVYELME 359

Query: 373 AGDCL-RTVLDLKK 385
            G  L R V+D  K
Sbjct: 360 KGKILGRYVVDTAK 373

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 99.8 bits (247), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 101/378 (26%), Positives = 163/378 (43%), Gaps = 45/378 (11%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSG-VDPEGAFPSILGHE 73
           A +  E G  L  ++I V  P+++E+ I + Y+ VCH+D +   G +      P + GHE
Sbjct: 12  AIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPLPLKLPLVGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V  +G  V   K GD+  I      C  C+FC+      C     T   G + DG 
Sbjct: 72  GAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFT---GTVHDG- 127

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                             +F QY                L +I  L C   T Y  A K+
Sbjct: 128 ------------------SFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTAY-KALKS 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN++ G  VA+ GA G +G   IQ A   G  R++ +D  ++K KY    G   FI    
Sbjct: 169 ANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKTLGGEVFI---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV---AAAEE 308
           D K  + +V  +I+ TDGG     +   + + +  + +      GTSV++ +   A  E 
Sbjct: 224 DYKKSKDVVADVIKATDGGAHGVLNIAVDPRAISMSTKYVRSN-GTSVLVSLPKDAVCES 282

Query: 309 EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAF 368
           E+ T   Q+V      GS  G    R++    I+ + +G +K+     +  P + + + +
Sbjct: 283 EVFT---QVVKSTSIVGSCVG---NRADTREAIDFFTRGLIKIP---IHMAPLSSLPQIY 333

Query: 369 EDLHAGDCL-RTVLDLKK 385
           + L   + + R V+D  K
Sbjct: 334 DKLMQNEVVGRFVVDTSK 351

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 99.8 bits (247), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 85/294 (28%), Positives = 127/294 (43%), Gaps = 32/294 (10%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A V YE    L  +++TV  P+ +E+ + ++Y+ VCH+D +   G  P +  FP I GHE
Sbjct: 12  AIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V  +G  V   K GD   I      C  C++C+ G  + C  +    G G   DG 
Sbjct: 72  GAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL---DGTGFTHDG- 127

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                             TF +Y                L  +  + C   T Y  A K 
Sbjct: 128 ------------------TFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVY-KALKR 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           ANV  G  V + GA G +G   IQ A   G  R+I +D  + KRK   + G   FI    
Sbjct: 169 ANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIFI---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           D  + + IV  +I+ T+GG     + + +   +  +   C    GT V++G+ A
Sbjct: 224 DFTEEKDIVGAIIKATNGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVGMPA 276

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 99.4 bits (246), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 97/373 (26%), Positives = 161/373 (43%), Gaps = 39/373 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE G  L  +++ V  P+ +E+ I ++Y+ VCHTD +   G  P +   P + GHEGA
Sbjct: 50  IFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLDVKLPLVGGHEGA 109

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V + GE VTN + GD   I      C  C+ C+ G    C                  
Sbjct: 110 GVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHA--------------- 154

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  +  + C   T Y  A KTA+
Sbjct: 155 -------DLSGYTHDGSFQQYATADAVQAAQLPKGINLAEVAPILCAGVTVY-KALKTAD 206

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           +  G  VA+ G AG +G   +Q AK  G  R++ +D  D+K++  ++ G   FI    D 
Sbjct: 207 LIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIFI----DY 261

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + +V  + E T GG     + + +   +  + +   +  G+ V++G+ A     S  
Sbjct: 262 TTTKDMVGAIQEATQGGPQGVINVSVSEAAISLSTQYV-RPTGSVVLVGLPANAYVKSEV 320

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
              +V     KGS  G    R++    I+ + +G +K    I      +E+ +A++ + A
Sbjct: 321 FSHVVKSISIKGSYVG---NRADTREAIDFFNRGLIKAPIKIIG---LSELPQAYKMMEA 374

Query: 374 GDCL-RTVLDLKK 385
           G  L R V+D  K
Sbjct: 375 GKILGRYVVDTSK 387

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 97/371 (26%), Positives = 159/371 (42%), Gaps = 41/371 (11%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE G  L  ++I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 37  IFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 96

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++GE V     GD   I      C  C++C+    + C            PD    
Sbjct: 97  GVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC------------PDA--- 141

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  +  + C   T Y  A K+AN
Sbjct: 142 -------DLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSAN 193

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ GD VA+ G AG +G   +Q AK  G  R++ +D  ++K K   + G   F+    D 
Sbjct: 194 LKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGEAFV----DF 248

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + +V ++ E+T+GG     + + +   M  + +      GT V++G+ A    I + 
Sbjct: 249 TKTKDMVAEIQEITNGGPHGVINVSVSEAAMNASTQFVRPT-GTVVLVGLPAG-AVIKSE 306

Query: 314 PFQLVTGRV-WKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLH 372
            F  V   +  KGS  G    R++    I  +  G +     +      +E+ K +E + 
Sbjct: 307 VFSHVVKSINIKGSYVG---NRADTREAINFFANGHVHSPIKVVG---LSELPKVYELME 360

Query: 373 AGDCL-RTVLD 382
            G  L R V+D
Sbjct: 361 QGKILGRYVVD 371

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 98.6 bits (244), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 99/377 (26%), Positives = 162/377 (42%), Gaps = 47/377 (12%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE    L  ++I V  P+A+E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 15  IFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 74

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V  +GE V   K GD+  I      C  C++C+    + C     +   G   DG   
Sbjct: 75  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNCPEADLS---GYTHDG--- 128

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                L  +  + C   T Y  A K+AN
Sbjct: 129 ----------------SFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY-KALKSAN 171

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           +  G+ VA+ G AG +G   +Q AK  G  RI+ +D  D+K+   +E G   F+    D 
Sbjct: 172 LNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIFV----DF 226

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEEEI 310
              + + + ++  T+GG         N  V   A+E+     +  GT V++G+  A  + 
Sbjct: 227 TKSKNVEQDILVATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTVVLVGL-PANAKC 281

Query: 311 STRPFQLVTGRVWKGSAFGGIKG-RSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFE 369
           S+  F  V   +   S  G   G R++    ++ + +G +K    I      +E+ + +E
Sbjct: 282 SSDVFNHVVKSI---SIVGSYVGNRADTREALDFFSRGLVKSPIKIAG---LSELPEIYE 335

Query: 370 DLHAGDCL-RTVLDLKK 385
            +  G  + R V+D  K
Sbjct: 336 KMEKGQIVGRYVVDTSK 352

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 98.2 bits (243), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 100/373 (26%), Positives = 160/373 (42%), Gaps = 45/373 (12%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE G  L  ++I V  P+A+E+ + ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 14  IFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPLPVKLPLVGGHEGA 73

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++GE V   K GD   I      C  C+ C+ G  + C                  
Sbjct: 74  GVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNCPEA--------------- 118

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  I  + C   T Y  A K+AN
Sbjct: 119 -------DLSGYTHDGSFQQYATADAVQAAKIPAGADLAEIAPILCAGITVY-KALKSAN 170

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           +Q GD VA+ G AG +G   +Q AK  G  R++ +D  ++K +   + G   FI    D 
Sbjct: 171 LQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQLGGEVFI----DF 225

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEEEI 310
           +  + I  ++I+ T+GG         N  V   A+E+     +  GT V++G+ A  +  
Sbjct: 226 RTCKDIEGEIIKATNGGAHGVI----NVSVSEAAIESSTNYVRANGTVVLVGLPAGAKCK 281

Query: 311 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFED 370
           S    Q+V      GS  G    R++    ++ + +G ++    +       EI   FE 
Sbjct: 282 SDVFNQVVKSISIVGSYVG---NRADTREALDFFVRGLVRSPIKVVGLSTLPEI---FEK 335

Query: 371 LHAGDCL-RTVLD 382
           +  G  + R V+D
Sbjct: 336 MEKGQIVGRYVVD 348

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 98.2 bits (243), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 101/374 (27%), Positives = 162/374 (43%), Gaps = 41/374 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE G  L  +++ V  P+A+E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 38  IFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 97

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           GIV + GE V N + GD+  I      C  C+ C+ G  + C     +   G   DG   
Sbjct: 98  GIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNCLQADLS---GYTHDG--- 151

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                L  I  + C   T Y  A KTA+
Sbjct: 152 ----------------SFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVY-KALKTAD 194

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ G  VA+ G AG +G   +Q AK  G  R++ +D  D K +   + G   FI    D 
Sbjct: 195 LKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQCGGEVFI----DF 249

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
           +  + +V  + E T+GG     + + +   +  + E      G  V++G+  A+  + + 
Sbjct: 250 RKSKDMVADIQEATNGGPHGVINVSVSEAAISMSTEYVRPT-GVVVLVGL-PADAYVKSE 307

Query: 314 PFQLVTGRV-WKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLH 372
            F  V   +  KGS  G    R++     + + +G +K    I      +E+ +A+E + 
Sbjct: 308 VFSHVVKSISIKGSYVG---NRADTREATDFFTRGLVKSPIKIIG---LSELPEAYELME 361

Query: 373 AGDCL-RTVLDLKK 385
            G  L R V+D  K
Sbjct: 362 QGKILGRFVVDTYK 375

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 97.1 bits (240), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 102/376 (27%), Positives = 159/376 (42%), Gaps = 45/376 (11%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE+   L  ++I V  P+A+E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V  +GE V   K GD+  I      C  C++C+ G  + C     +   G   DG   
Sbjct: 71  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                L  +  + C   T Y  A K+AN
Sbjct: 125 ----------------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           +  G  VA+ G AG +G   +Q AK  G  R++ +D  + K +     G   FI    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEEEI 310
              + IV  +++ TDGG         N  V   A+EA     +  GT+V++G+ A  +  
Sbjct: 223 TKEKDIVGAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCC 278

Query: 311 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFED 370
           S    Q+V      GS  G    R++    ++ + +G +K    +       EI   +E 
Sbjct: 279 SDVFNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSTLPEI---YEK 332

Query: 371 LHAGDCL-RTVLDLKK 385
           +  G  + R V+D  K
Sbjct: 333 MEKGQIVGRYVVDTSK 348

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 100/376 (26%), Positives = 158/376 (42%), Gaps = 41/376 (10%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A V YE G PL  ++I V  P+A+E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 42  AVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 101

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           G+G+V  VGE V   K GD   I      C  C+ C++G  + C     +   G   DG 
Sbjct: 102 GSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEHADLS---GYTHDG- 157

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                             +F QY                L  +  + C   T Y  A K 
Sbjct: 158 ------------------SFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY-KALKE 198

Query: 193 ANVQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           A+++ G  V + G AG +G   +Q AK  G  R+I +D    K +     G   FI    
Sbjct: 199 ADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVFI---- 253

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEIS 311
           D    + +V+ + E T GG     + + +   +  + +      GT V++G+  A   + 
Sbjct: 254 DFTKSKDMVKDIQEATKGGPQGVINVSVSEAAISLSTQYVRPT-GTVVLVGL-PAHAYVK 311

Query: 312 TRPFQLVTGRV-WKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFED 370
           +  F  V   +  KGS  G    R++    ++ + +G +K    I      +E+ K ++ 
Sbjct: 312 SEVFSHVVKSINIKGSYVG---NRADTREALDFFARGLIKSPIKIVG---LSELPKVYDL 365

Query: 371 LHAGDCL-RTVLDLKK 385
           +  G  L R V+D  K
Sbjct: 366 MEKGQILGRYVVDTSK 381

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 98/373 (26%), Positives = 155/373 (41%), Gaps = 39/373 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE    L  ++I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 38  IFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWPLAVKLPLVGGHEGA 97

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V  +G  V   K GD   I      C  C+FC+SG  + C     +   G   DG   
Sbjct: 98  GVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNCPEADLS---GYTHDG--- 151

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F Q+                L  +  + C   T Y  A K AN
Sbjct: 152 ----------------SFQQFATADAIQAAKIQPGTDLAEVAPILCAGVTVY-KALKEAN 194

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ GD VA+ G AG +G   +Q A   G  R++ +D  ++K K   + G   FI    D 
Sbjct: 195 LKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKQLGGEVFI----DF 249

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + +V  + E T GG     + + +   +  + E      GT V++G+ A     S  
Sbjct: 250 TKTKDMVSDIQEATKGGPHGVINVSVSEAAISLSTEYVRPT-GTVVLVGLPANSYVKSEV 308

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
              +V     KGS  G    R++    ++ + +G +K    I      +E+ K ++ +  
Sbjct: 309 FSHVVKSINIKGSYVG---NRADTREALDFFTRGLIKSPIKIVG---LSELPKVYDLMEQ 362

Query: 374 GDCL-RTVLDLKK 385
           G  L R V+D  K
Sbjct: 363 GKILGRYVVDTNK 375

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 93/346 (26%), Positives = 149/346 (43%), Gaps = 54/346 (15%)

Query: 42  IKIEYTAVCHTDAYTLSGVDPE---------GAFP-SILGHEGAGIVESVGEGVTNVKPG 91
           IK+ +T++C TD     G +PE         G+F   ILGHEG GI++ VG+ V N K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 92  DHVIALYTAECQKCKFCKSGKTNLCSSVRATQG----KGVMPDGTSRFKNQKGEELK-HF 146
           D VI    + C  C+ C     + C     T G     G M DGT      + E ++  F
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGGWILGYMIDGT------QAEYVRTPF 168

Query: 147 MGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGA 206
              S +S                   E+  +L   + T +    +  NV+ GDTVA+ GA
Sbjct: 169 ADTSLYS------------VPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGA 216

Query: 207 GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEM 266
           G VG+  +  +++   S +I+VDI+D +     E G+T  IN        +  V K++E 
Sbjct: 217 GPVGMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAK-----EDAVSKILEY 271

Query: 267 TDG-GLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVW-- 323
           T+G G+D   +  G  +   D  +   K  G    +GV         +P      ++W  
Sbjct: 272 TNGRGVDCVMEAVG-AQATWDICQRVIKEGGHLANVGVHG-------KPVNFEIDKLWIK 323

Query: 324 KGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFE 369
             +   G+   +  G L++    G LK +  +T+   F E++  + 
Sbjct: 324 NLTITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMSGNYN 369

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 116/257 (45%), Gaps = 31/257 (12%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE G  L  ++I V  P+A+E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 70

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++GE V     GD   I      C  C++C+    + C            PD    
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC------------PDA--- 115

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  +  + C   T Y  A K+A+
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSAD 167

Query: 195 VQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ GD VA+ GA G +G   IQ AK  G  R++ +D   +K K   E G   F+    D 
Sbjct: 168 LKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEYFV----DY 222

Query: 254 KDGQTIVEKLIEMTDGG 270
              + +++++++ T+GG
Sbjct: 223 AVSKDLIKEIVDATNGG 239

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 95.5 bits (236), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 84/294 (28%), Positives = 125/294 (42%), Gaps = 32/294 (10%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A V YE    L  ++I V  P+A+E+ + ++Y+ VCH+D +   G  P +  FP I GHE
Sbjct: 12  AIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPFQLKFPLIGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V  +G  V   K GD   I      C  C++C+ G  + C  +    G G   DG 
Sbjct: 72  GAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---DGTGFTHDG- 127

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                             TF +Y                L  +  + C   T Y  A K 
Sbjct: 128 ------------------TFQEYATADAVQAAHLPENVDLAEVAPILCAGVTVY-KALKR 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN+  G  V + GA G +G   IQ A   G  R+I +D  + K++     G   FI    
Sbjct: 169 ANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEGLGGEVFI---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           D    + IV  +I+ TDGG     + + +   +  +   C    GT V++G+ A
Sbjct: 224 DFTKEKDIVGAVIKATDGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVGMPA 276

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 95.5 bits (236), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 101/376 (26%), Positives = 159/376 (42%), Gaps = 45/376 (11%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE+   L  ++I V  P+A+E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++GE V     GD+  I      C  C++C+ G  + C     +   G   DG   
Sbjct: 71  GVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                L  +  + C   T Y  A K+AN
Sbjct: 125 ----------------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY-KALKSAN 167

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           +  G  VA+ G AG +G   +Q AK  G  R++ +D  + K +     G   FI    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEEEI 310
              + IV  +++ TDGG         N  V   A+EA     +  GT+V++G+ A  +  
Sbjct: 223 TKEKDIVNAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPANAKCS 278

Query: 311 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFED 370
           S    Q+V      GS  G    R++    ++ + +G +K    +       EI   +E 
Sbjct: 279 SDVFNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSTLPEI---YEK 332

Query: 371 LHAGDCL-RTVLDLKK 385
           +  G  + R V+D  K
Sbjct: 333 MEKGQIVGRYVVDTAK 348

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 94.7 bits (234), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 125/294 (42%), Gaps = 32/294 (10%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A V YE    L  +++TV  P+ +E+ + ++Y+ VCH+D +   G  P +  FP I GHE
Sbjct: 12  AIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V  +G  V   K GD   I      C  C++C+ G  + C  +    G G   DG 
Sbjct: 72  GAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---DGTGFTHDG- 127

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                             TF +Y                L  +  + C   T Y  A K 
Sbjct: 128 ------------------TFQEYATADAVQAAHIPQNVNLAEVAPILCAGITVY-KALKR 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN+  G  V + GA G +G   IQ A   G  R+I +D  + KRK   + G   FI    
Sbjct: 169 ANLMPGQWVTISGACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLFEKLGGEIFI---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           D    + +   +I+ T+GG     + + +   +  +   C    GT V++G+ A
Sbjct: 224 DFTKERDVAGAVIKATNGGSHGIINVSVSEAAIEASTRYCRPN-GTVVLVGMPA 276

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 94.7 bits (234), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 98/373 (26%), Positives = 156/373 (41%), Gaps = 39/373 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE+   L  ++I V  P+A+E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++GE V     GD   I      C  C++C+ G  + C     +   G   DG   
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                L     + C   T Y  A K+AN
Sbjct: 125 ----------------SFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY-KALKSAN 167

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           +  G  VA+ G AG +G   +Q AK  G  R++ +D  + K +     G   FI    D 
Sbjct: 168 LSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + IV  +I+ TDGG     + + +   +  +   C    GT+V++G+ A  +  S  
Sbjct: 223 TTEKDIVGAVIKATDGGAHGIINVSVSEAAIEASTRYCRAN-GTTVLVGMPAGAKCCSDV 281

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
             Q+V      GS  G    R++    ++ + +G +K    +       EI   +E +  
Sbjct: 282 FNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSTLPEI---YEKMEK 335

Query: 374 GDCL-RTVLDLKK 385
           G  + R V+D  K
Sbjct: 336 GQIVGRYVVDTSK 348

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 95.1 bits (235), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 106/392 (27%), Positives = 157/392 (40%), Gaps = 45/392 (11%)

Query: 1   MSGAATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGV 60
           MS A       T    V  E+  PL  +EI V  P+ +E+ I + Y+ VCHTD +   G 
Sbjct: 26  MSAAPAPVIPKTQKGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGD 85

Query: 61  DP-EGAFPSILGHEGAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSS 118
            P     P + GHEGAG V ++G  V N K GD   I      C  C+ C+    + C  
Sbjct: 86  WPLPTKLPLVGGHEGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC-- 143

Query: 119 VRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLL 178
                     PD           +L  +    +F QY                L  +  +
Sbjct: 144 ----------PDA----------DLSGYTHDGSFQQYATADAVQAAHIPPGTDLAEVAPV 183

Query: 179 GCGVTTGYGAATKTANVQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKY 237
            C   T Y  A K+AN++ G  VA+ G AG +G   +Q AK  G  R++ +D    K + 
Sbjct: 184 LCAGITVY-KALKSANLKAGQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEEL 241

Query: 238 GNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHK---G 294
               G   FI    D +    IV  ++  T+GG         N  V   A+ A  K    
Sbjct: 242 FKTLGGEVFI----DFQKESDIVGAVVNATNGGAHGVV----NVSVSEGAISASTKYVRA 293

Query: 295 WGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEF 354
            GTSV++G+ A     S    Q+V      GS  G    R++    ++ + +G +     
Sbjct: 294 CGTSVLVGMPAGAVCKSEVFDQVVRSTKIVGSYVG---NRADTREALDFFARGLVHAP-- 348

Query: 355 ITNERPFTEINKAFEDLHAGDCL-RTVLDLKK 385
             N  P + + + FE +  G  + R V+D  K
Sbjct: 349 -INVVPLSTLPEIFEKMEKGQIIGRYVVDTSK 379

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 94.7 bits (234), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 97/373 (26%), Positives = 157/373 (42%), Gaps = 39/373 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE    L  ++I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 38  IFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 97

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V  +G  V   K GD   I      C  C+FC+SG  + C            PD    
Sbjct: 98  GVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------------PDA--- 142

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F Q+                L  +  + C   T Y  A K A+
Sbjct: 143 -------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALKEAD 194

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ GD VA+ G AG +G   +Q A   G  R++ +D  ++K K   + G   FI    D 
Sbjct: 195 LKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVFI----DF 249

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + +V  + E T GG     + + +   +  + E   +  GT V++G+ A     S  
Sbjct: 250 TKTKNMVSDIQEATKGGPHGVINVSVSEAAISLSTEYV-RPCGTVVLVGLPANAYVKSEV 308

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
              +V     KGS  G    R++    ++ + +G +K    I      +E+ K ++ +  
Sbjct: 309 FSHVVKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIVG---LSELPKVYDLMEK 362

Query: 374 GDCL-RTVLDLKK 385
           G  L R V+D  K
Sbjct: 363 GKILGRYVVDTSK 375

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 94.0 bits (232), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 100/378 (26%), Positives = 160/378 (42%), Gaps = 45/378 (11%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A + Y+ G PL  +++ V  P+ +E+ I I+Y+ VCHTD +   G  P +   P I GHE
Sbjct: 12  AVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V  +G  V   K GD+  +      C  C+ C+    + C     +   G   DG 
Sbjct: 72  GAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEADLS---GYTHDG- 127

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                             +F +Y                L  +  L C   T Y  A K+
Sbjct: 128 ------------------SFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY-KALKS 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           A++  G  VA+ GA G +G   IQ AK  G  R++ +D  ++K+K  +E G   F+    
Sbjct: 169 ADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHELGGEVFL---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEE 308
           D +  + +   +I+ T+GG         N  V   A+E+     +  GT V++G+ A   
Sbjct: 224 DFRLEKDMEAAIIKATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTVVLVGLPANAY 279

Query: 309 EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAF 368
             S    Q+V      GS  G    R++    ++ + +G +K    I       EI   +
Sbjct: 280 CKSEVFAQVVKSYKIVGSYVG---NRADTREALDFFSRGLVKSPIHIVGLSTLPEI---Y 333

Query: 369 EDLHAGDCL-RTVLDLKK 385
           E +  G  + R V+D  K
Sbjct: 334 EKMEKGQIVGRYVVDTTK 351

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 101/378 (26%), Positives = 159/378 (42%), Gaps = 46/378 (12%)

Query: 16  AVAYEA-GKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHE 73
           AV +E  G  L  ++I V  P A+E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 9   AVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHE 68

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V  +GE V   K GD   I      C  C+ C+    + C     +   G   DG 
Sbjct: 69  GAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNCPHADLS---GYTHDG- 124

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                             +F QY                L  +  + C   T Y  A K+
Sbjct: 125 ------------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKS 165

Query: 193 ANVQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN++ G+ VA+ G AG +G   +Q AK  G  R+I +D  D+K +   + G   F+    
Sbjct: 166 ANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYFV---- 220

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEE 308
           D +  + +V +++E+T GG         N  V   A+E+     +  GT V++G+    +
Sbjct: 221 DFRKSKDVVAEILEVTGGGAHGVV----NVSVSEAAIESSTHYVRANGTVVLVGLPGGAK 276

Query: 309 EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAF 368
             S     +V      GS  G    R++    ++ + +G +K    I      +E+   F
Sbjct: 277 CCSDVFNHVVKSISIVGSYVG---SRADTRQALDFFARGLVKSPIKIVG---LSELPDVF 330

Query: 369 EDLHAGDCL-RTVLDLKK 385
           E +  G    R V+D  K
Sbjct: 331 EKMEKGQIAGRYVVDTAK 348

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 97/373 (26%), Positives = 156/373 (41%), Gaps = 39/373 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE    L  ++I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 38  IFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 97

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V  +G  V   K GD   I      C  C+FC+SG  + C            PD    
Sbjct: 98  GVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC------------PDA--- 142

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F Q+                L  +  + C   T Y  A K A+
Sbjct: 143 -------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALKEAD 194

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ GD VA+ G AG +G   +Q A   G  R++ +D  ++K K   + G   FI    D 
Sbjct: 195 LKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVFI----DF 249

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + +V  + E T GG     + + +   +  + E      GT V++G+ A     S  
Sbjct: 250 TKTKDMVSDIQEATKGGPHGVINVSVSEAAISLSTEYVRPT-GTVVLVGLPANAYVKSEV 308

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
              +V     KGS  G    R++    ++ + +G +K    I      +E+ K ++ +  
Sbjct: 309 FSHVVKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIVG---LSELPKVYDLMEK 362

Query: 374 GDCL-RTVLDLKK 385
           G  L R V+D  K
Sbjct: 363 GKILGRYVVDTSK 375

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 97/374 (25%), Positives = 156/374 (41%), Gaps = 41/374 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE    L  ++I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 38  IFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 97

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V  +G  V   K GD   I      C  C+FC+SG  + C            PD    
Sbjct: 98  GVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------------PDA--- 142

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F Q+                L  +  + C   T Y  A K AN
Sbjct: 143 -------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALKEAN 194

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ GD VA+ G AG +G   +Q A   G  R++ +D   +K K   + G   FI    D 
Sbjct: 195 LKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFKQLGGEVFI----DF 249

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + +V  + E T GG     + + +   +  + E      GT V++G+  A   + + 
Sbjct: 250 TKTKDMVSDIQEATKGGPQGVINVSVSEAAISLSTEYVRPT-GTVVLVGL-PANAYVKSE 307

Query: 314 PFQLVTGRV-WKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLH 372
            F  V   +  KGS  G    R++    ++ + +G +K    I      +E+   ++ + 
Sbjct: 308 VFSHVIKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIVG---LSELPMVYDLME 361

Query: 373 AGDCL-RTVLDLKK 385
            G  L R V+D  K
Sbjct: 362 KGKILGRYVVDTSK 375

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 100/373 (26%), Positives = 157/373 (42%), Gaps = 45/373 (12%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE   PL  ++I V  P  +E+ I + Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 13  IFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 72

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V  +G  V   K GD+  I      C  C+ C+    + C     +   G   DG   
Sbjct: 73  GVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNCPEADLS---GYTHDG--- 126

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                L++I  + C   T Y  A K+AN
Sbjct: 127 ----------------SFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY-KAIKSAN 169

Query: 195 VQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ GD +A+ GA G +G   IQ  K  G  RI+ +D   +K +   + G   FI    D 
Sbjct: 170 LKAGDWLAISGACGGLGSLAIQYGKAMGF-RILGIDGGAEKEELFKKLGGEYFI----DF 224

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEEEI 310
              + I+ ++ + T+GG         N  V   A+EA     +  GT V++G+ A     
Sbjct: 225 TQCKDIIAEVKKATNGGAHGVI----NVSVSEAAIEASTNYVRSNGTVVLVGLPAGAVCK 280

Query: 311 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFED 370
           S    Q+V      GS  G    R++    I+ + +G +K    +      +++   F+D
Sbjct: 281 SNVFNQVVKSTKIVGSYVG---NRADTREAIDFFVRGLVKSPIKVVG---LSQLASVFDD 334

Query: 371 LHAGDCL-RTVLD 382
           + AG  + R V+D
Sbjct: 335 MQAGKIVGRVVVD 347

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 100/370 (27%), Positives = 157/370 (42%), Gaps = 41/370 (11%)

Query: 22  GKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGAGIVES 80
           G  L  E++ V  P ++EV I ++Y+ VCHTD +T  G  P +   P + GHEGAG+V +
Sbjct: 39  GPLLYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVA 98

Query: 81  VGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQK 139
            G+ V   + GD   +    + C  C+ C+ G    C     +   G   DG        
Sbjct: 99  KGKDVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGCEQAEMS---GSSHDG-------- 147

Query: 140 GEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGD 199
                      TF QY                L ++  + C   + Y  A K  N+Q   
Sbjct: 148 -----------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQ 195

Query: 200 TVAVFGA-GTVGLSVIQGAKVRGASRIILVD-INDQKRKYGNEFGATDFINPKSDLKDGQ 257
            VA+FGA G +G   +Q AK  G  R++ +D   +++++  +  G   F+    D     
Sbjct: 196 WVAIFGATGGLGSIAVQYAKAMG-YRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVD 250

Query: 258 TIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQL 317
            I   + + T GG     + T +       ++ C +  GT V +GV      + T  F +
Sbjct: 251 NIPAAVKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTI 309

Query: 318 VT-GRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHAGDC 376
           V  G   KGSA G    R++    ++ + +G +K    I      +E+ KAFE L +G  
Sbjct: 310 VQHGFSIKGSASG---SRADTREAVDFFTRGLIKSPIKILG---LSELPKAFELLESGQT 363

Query: 377 L-RTVLDLKK 385
             R VLD  K
Sbjct: 364 TGRLVLDTSK 373

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 100/376 (26%), Positives = 158/376 (42%), Gaps = 45/376 (11%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE+   L  ++I V  P+A+E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++GE V     GD   I      C  C++C+ G  + C     +   G   DG   
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                L  +  + C   T Y  A K+AN
Sbjct: 125 ----------------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY-KALKSAN 167

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           +  G  VA+ G AG +G   +Q AK  G  R+I +D  + K +     G   F+    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVFV----DF 222

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEEEI 310
              + IV  +++ T+GG         N  V   A+EA     +  GT+V++G+ A  +  
Sbjct: 223 TKEKDIVGAVLKATNGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPANAKCC 278

Query: 311 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFED 370
           S    Q+V      GS  G    R++    ++ + +G +K    +       EI   +E 
Sbjct: 279 SDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIKVVGLSTLPEI---YEK 332

Query: 371 LHAGDCL-RTVLDLKK 385
           +  G  + R V+D  K
Sbjct: 333 MEKGQIVGRYVVDTSK 348

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 126/292 (43%), Gaps = 32/292 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE+   L  ++I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 70

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++GE V   K GD   I    + C  C++C+ G  + C     +   G   DG   
Sbjct: 71  GVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                L  +  + C   T Y  A K+AN
Sbjct: 125 ----------------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY-KALKSAN 167

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ G  VA+ G AG +G   +Q AK  G  R++ +D    K +     G   FI    D 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVFI----DF 222

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
              + IV  +I+ TDGG     + + +   +  +   C    GT V++G+ A
Sbjct: 223 TKEKDIVGAVIKATDGGAHGIVNVSVSEAAIEASTRYCRAN-GTVVLVGLPA 273

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 127/292 (43%), Gaps = 32/292 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE+   L  ++I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++G+ V   K GD   I    + C  C++C+ G  + C     +   G   DG   
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                L  +  + C   T Y  A K+AN
Sbjct: 125 ----------------SFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ G  VA+ G AG +G   +Q AK  G  R++ +D  + K +     G   FI    D 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVFI----DF 222

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
              + IV  +++ TDGG     + + +   +  +   C    GT V++G+ A
Sbjct: 223 TKEKDIVSAVVKATDGGAHGIVNVSVSEAAIEASTRYCRAN-GTVVLVGLPA 273

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 92.4 bits (228), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 107/384 (27%), Positives = 163/384 (42%), Gaps = 58/384 (15%)

Query: 16  AVAYEAGKPLTVEEITV-EAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAF-------P 67
           AV  E  + + +E   + E    H+V+I+I+ T +C +D +  +    +G+        P
Sbjct: 6   AVVLEKKELIQIESRPIPEIKNPHDVKIQIKATGICGSDVHYFT----QGSIGDFVVKSP 61

Query: 68  SILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGV 127
            +LGHE AG+V  VG+ V++VK GD V        +  K   SG  NLC  +        
Sbjct: 62  LVLGHESAGVVVEVGDAVSSVKVGDRVAVEPGVPSRYSKETMSGHYNLCPHMAFAATPPY 121

Query: 128 MPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYG 187
             DGT          +K+++    F  Y                L S+ +          
Sbjct: 122 --DGTL---------VKYYLSPEDFV-YKLADHISFEEGAVVEPL-SVAV---------- 158

Query: 188 AATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD-- 245
            A + AN   G  V V GAG VGL     AK  GA+ ++ VDI + K +   +FGAT   
Sbjct: 159 HANRLANTAFGQAVLVLGAGPVGLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGATRTV 218

Query: 246 FINPKSDLKDGQTIVEKLIEMTDGGL--DYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
              P SD  D  ++V K +    GGL  D  F+C+G  K +R A+++  +G GT V +G+
Sbjct: 219 LFKPDSDENDLVSLVTKSL----GGLHPDVVFECSGAEKCIRAAVKSVKRG-GTFVQVGM 273

Query: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKK----GTLKVDEFITNER 359
                      F        K + F G     E  G  +D  K    G + V   IT   
Sbjct: 274 GKDNINFPINEFS------QKEATFKGCFRYYE--GDFDDAVKLLSTGKVNVKPLITKVF 325

Query: 360 PFTEINKAFED--LHAGDCLRTVL 381
           PF +  +A++    HA D  +T++
Sbjct: 326 PFEQAVEAYKHNVEHAKDVTKTII 349

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 94/372 (25%), Positives = 156/372 (41%), Gaps = 53/372 (14%)

Query: 16  AVAYEAGKPLTVEEITVEAPRAHEVR---IKIEYTAVCHTDAYTLSGVDPE--------- 63
           A+ Y     L  E+  +  P+  + R   IK+  T++C TD     G  PE         
Sbjct: 33  AMVYYGANDLRFEDRAI--PKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVKNE 90

Query: 64  GAFP-SILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRAT 122
           G+F   +LGHEG GIV  VG+ V N+K GD VI      C  C+ C  G    C      
Sbjct: 91  GSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC------ 144

Query: 123 QGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXL--ESICLLGC 180
                M DG        G  L + +   T ++Y                L  E+  LL  
Sbjct: 145 -----MNDG--------GWALGYSID-GTQAEYVRTPFADTSLYALPEGLSDENAVLLSD 190

Query: 181 GVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNE 240
            + T +    +  NV+ GD+VA+ GAG VG+  +  +++   S +I+VD++D + +   E
Sbjct: 191 ALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMAKE 250

Query: 241 FGATDFINPKSDLKDGQTIVEKLIEMTDG-GLDYTFDCTGNTKVMRDALEACHKGWGTSV 299
            GAT  IN        +  V K++E+T+G G+D   +  G  +   D  +   K  G   
Sbjct: 251 MGATHTINSGK-----EDAVAKILEITNGRGVDCAMEAVG-AQPTWDICQQIIKEGGHLA 304

Query: 300 IIGVAAAEEEISTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITN 357
            +GV         +P      ++W    +   G+   +    L+++   G L+ D+ +++
Sbjct: 305 NVGVHG-------KPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVSH 357

Query: 358 ERPFTEINKAFE 369
              F ++   + 
Sbjct: 358 HCNFKDMANNYN 369

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 92.4 bits (228), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 96/375 (25%), Positives = 155/375 (41%), Gaps = 39/375 (10%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A V YE    L  +++ V  P+ +E+ + ++Y+ VCH+D +   G  P +  FP I GHE
Sbjct: 12  AIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V  +G  V   K GD   I      C  C++C+ G  + C  +    G G   DG 
Sbjct: 72  GAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL---DGTGFTHDG- 127

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                             TF +Y                L  +  + C   T Y  A K 
Sbjct: 128 ------------------TFQEYATADAVQAAHIPQNVDLAEVAPILCAGITVY-KALKR 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN+  G  V + GA G +G   +Q A   G  R+I +D  + K+K   E     FI    
Sbjct: 169 ANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEELHGEIFI---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEIS 311
           D    + +V  +I+ TDGG     + + +   +  +   C    GT V++G+ A     S
Sbjct: 224 DFTKEKDVVGAVIKATDGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVGMPAHAYCKS 282

Query: 312 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDL 371
               Q+V      GS  G    R++    ++ + +G +K    +      +++ + F  +
Sbjct: 283 DVFNQVVKSISIVGSCVG---NRADTREALDFFARGLIKSPIHLAG---LSDVPEIFGKM 336

Query: 372 HAGDCL-RTVLDLKK 385
             G  + R V+D  K
Sbjct: 337 ERGQIVGRYVVDTSK 351

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 92.4 bits (228), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 121/285 (42%), Gaps = 32/285 (11%)

Query: 22  GKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGAGIVES 80
           G PL   EI V  P+  E+ I ++Y+ VCHTD +   G  P     P + GHEGAG+V +
Sbjct: 53  GGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVA 112

Query: 81  VGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQK 139
           +GE V   + GD   I      C  C+ C+ G  + C                       
Sbjct: 113 MGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNCPEA-------------------- 152

Query: 140 GEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGD 199
             +L  +    +F QY                L  +  + C   T Y  A K+AN++ G+
Sbjct: 153 --DLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKSANLRAGN 209

Query: 200 TVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQT 258
            VA+ GA G +G   IQ A+  G  R++ +D  D+K     + G   F+    D +  + 
Sbjct: 210 WVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRKLGGEVFV----DFRKSKD 264

Query: 259 IVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
           +V  +++ T GG     + + +   +  + E      GT V++G+
Sbjct: 265 VVADVVKATGGGAHGVINVSVSEAAIESSTEYVRSN-GTVVLVGL 308

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 91.3 bits (225), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 127/292 (43%), Gaps = 32/292 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE+   L  + I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++G+ V   K GD   +    + C  C++C+ G  + C                  
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHA--------------- 115

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  +  + C   T Y  A K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKSAN 167

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ G+ VA+ G AG +G   +Q AK  G  R++ +D    K++     G   FI    D 
Sbjct: 168 LRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVFI----DF 222

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
              + I+  +++ TDGG     + + +   +  + + C    GT V++G+ A
Sbjct: 223 TKEKDIIGAVVKATDGGAHGIINVSVSEAAIEASTKYCRAN-GTVVLVGLPA 273

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 130/284 (45%), Gaps = 39/284 (13%)

Query: 27  VEEITVEAPRAHEVRIKIEYTAVCHTDA-YTLSGVDPEGAF----PSILGHEGAGIVESV 81
           V EIT      H V+++I+ T +C +D  Y ++G    G F    P ILGHE +G+V  V
Sbjct: 23  VPEIT----DPHYVKLQIKKTGICGSDVHYYVAGAI--GDFVVKKPMILGHESSGLVVEV 76

Query: 82  GEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGE 141
           G  V+ V+ GD V        +     K+G+ NLC  ++      +  DGT         
Sbjct: 77  GSEVSRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI--DGTL-------- 126

Query: 142 ELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTV 201
            +K+++    F                   +E    L  GV      A K A V     V
Sbjct: 127 -VKYYLAPEDF----LVKLPDHVSYEEGALVEP---LSVGVH-----ANKLAGVAFNQRV 173

Query: 202 AVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVE 261
           AVFGAG VGL     A+  GAS ++ +D+ + K    + FG T F+N  +++KD   +V 
Sbjct: 174 AVFGAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVN-SANIKDEDDLV- 231

Query: 262 KLIEMTDGGL--DYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
           K IE   GG   D  FDCTG    +R  ++ C+ G GT V +G+
Sbjct: 232 KEIERVLGGARPDVVFDCTGAEICIRTGIKVCNSG-GTYVQVGM 274

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 99/378 (26%), Positives = 161/378 (42%), Gaps = 45/378 (11%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A + YE+G  L  +++ V  P+ +E+ I I+Y+ VCHTD +   G  P +   P I GHE
Sbjct: 12  AVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V  +G  V   K GD+  +      C  C+ C+    + C     +   G   DG 
Sbjct: 72  GAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEADLS---GYTHDG- 127

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                             +F +Y                L  +  + C   T Y  A K+
Sbjct: 128 ------------------SFQEYCTADAVQAARIPQGADLAEVAPILCAGVTVY-KALKS 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           A++  G+ VA+ GA G +G   +Q AK  G  R++ +D  ++K+K  +E G   F+    
Sbjct: 169 ADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHEMGGEVFL---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEE 308
           D +  + +   +I+ T+GG         N  V   A+EA     +  GT V++G+ A   
Sbjct: 224 DFRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEASTRYVRSNGTVVLVGLPANAY 279

Query: 309 EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAF 368
             S    Q+V      GS  G    R++    ++ + +G +K    I       EI   +
Sbjct: 280 CKSEVFSQVVKSYKIVGSYVG---NRADTREALDFFVRGLVKSPIHIVGLSTLPEI---Y 333

Query: 369 EDLHAGDCL-RTVLDLKK 385
           E +  G  + R V+D  K
Sbjct: 334 EKMEKGQIVGRYVVDTTK 351

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 93/373 (24%), Positives = 157/373 (42%), Gaps = 39/373 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE G  L  ++I V  P+ +E+ I I+Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 36  IFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 95

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V + G+ VTN + GD   +    + C  C++C+ G  + C+                 
Sbjct: 96  GVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKA--------------- 140

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  +  + C   T Y  A KT+ 
Sbjct: 141 -------DLSGYTHDGSFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY-KALKTSG 192

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
            + G  VA+ G AG +G   +Q A   G  R++ +D  + K +     G   F+    D 
Sbjct: 193 AKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVFV----DF 247

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + +V  + E T+GG     + + +   ++ + E   +  GT V++G+ A     S  
Sbjct: 248 TKTKDMVSAIQEATNGGPHAVVNVSVSEAAIQQSTEYV-RPTGTVVLVGLPAHAYVKSEI 306

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
              +V     KGS  G    R++    I+ + +  +K    I      +E+ K +E +  
Sbjct: 307 FSHVVKSISIKGSYVG---NRADTREAIDFFSRNLVKSPIKIIG---LSELPKVYELMEE 360

Query: 374 GDCL-RTVLDLKK 385
           G  L R V+D  +
Sbjct: 361 GKILGRYVVDTSR 373

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 98/378 (25%), Positives = 155/378 (41%), Gaps = 45/378 (11%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A + YE G PL  ++I V  P A E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V ++GE V   K GD+  I      C  C+ C+    + C                
Sbjct: 72  GAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNCPEA------------- 118

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                    +L  +    +F QY                L  +  + C   T Y  A K+
Sbjct: 119 ---------DLSGYTHDGSFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITVY-KALKS 168

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN+  GD VA+ GA G +G   IQ A   G  R++ +D   +K +   + G   FI    
Sbjct: 169 ANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFKQLGGEVFI---- 223

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEE 308
           D    + +  ++I+ T+GG         N  V   A+E+     +  GT V++G+    +
Sbjct: 224 DFTTCKDVEGEIIKATNGGAHGVI----NVSVSEAAIESSTRYVRANGTVVLVGLPGGAK 279

Query: 309 EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAF 368
             S     +V      GS  G    R++    ++ + +G +K    +       E+   F
Sbjct: 280 CRSDVFSHVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIKVVGLSTLPEV---F 333

Query: 369 EDLHAGDCL-RTVLDLKK 385
           E +  G  + R V+D  K
Sbjct: 334 EKMEKGQIVGRYVVDTSK 351

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 96/373 (25%), Positives = 154/373 (41%), Gaps = 39/373 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE+G  L  ++I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 40  IFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 99

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V + GE V N + GD   I      C  C+ C+ G  + C                  
Sbjct: 100 GVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNCLHA--------------- 144

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  +  + C   T Y  A KTA+
Sbjct: 145 -------DLSGYTHDGSFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY-KALKTAD 196

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ G  VA+ G AG +G   +Q AK  G  RI+ +D    K +     G   FI    D 
Sbjct: 197 LKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVFI----DF 251

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + IV  + E T GG     + + +   +  + +   +  GT V++G+ A     S  
Sbjct: 252 TKTKDIVSAIQEATKGGPHGVINVSVSEAAISTSTQYV-RPTGTVVLVGLPANAYVKSEV 310

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
              +V     KGS  G    R++    ++ + +G +K    I      +E+ + +  +  
Sbjct: 311 FSHVVKSINIKGSYVG---NRADTREALDFFSRGLVKSPIKIVG---LSELPEVYGLMEK 364

Query: 374 GDCL-RTVLDLKK 385
           G  L R V+D  K
Sbjct: 365 GKILGRYVVDTAK 377

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 125/294 (42%), Gaps = 32/294 (10%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A + YE+   L  ++I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 9   AIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHE 68

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V  +GE V   K GD+  I      C  C++C+ G  + C     +   G   DG 
Sbjct: 69  GAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG- 124

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                             +F +Y                L  +  + C   T Y  A K+
Sbjct: 125 ------------------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY-KALKS 165

Query: 193 ANVQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN++ G   A+ G AG +G   +Q AK  G  R++ +D    K +     G   FI    
Sbjct: 166 ANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVFI---- 220

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           D    + IV  +++ T+GG     + + +   +  +   C    GT V++G+ A
Sbjct: 221 DFTKEKDIVSAVVKATNGGAHGIINVSVSEAAIEASTRYCRAN-GTVVLVGLPA 273

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 92/372 (24%), Positives = 148/372 (39%), Gaps = 39/372 (10%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHE 73
           A V  E G  L   +I V   +A+E+ I ++Y+ VCH+D Y      P  +  P + GHE
Sbjct: 22  AMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPLVGGHE 81

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG+V  +G  V N K GD   +    + C  C+ C+ G    C                
Sbjct: 82  GAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSCLK-------------- 127

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                    E   F    +F QY                L  +    C   T Y  A K+
Sbjct: 128 --------SEYNGFTRNGSFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY-KAIKS 178

Query: 193 ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN++ G  +A+ GA G +G   IQ  K  G  R++ +D  + K     E G   FI    
Sbjct: 179 ANIRAGQWMAITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKELGGEVFI---- 233

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEIS 311
           D    + +V  ++  T+GG             +  +++      GT VI+ V       S
Sbjct: 234 DFTKSKDLVADVVSATNGGAHGVLSIAATEDAINTSVKYVRSN-GTCVIVSVPDGAYCKS 292

Query: 312 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDL 371
               Q+V      G+    +  R+E    I+ + +G +K    I    P +++ + ++ +
Sbjct: 293 DVFNQVVKSISIVGTY---VANRAETREAIDFFARGLVKAPIEIV---PLSQLLQVYKKI 346

Query: 372 HAGDCL-RTVLD 382
            +G+ + R VLD
Sbjct: 347 ESGEVIGRYVLD 358

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 104/378 (27%), Positives = 152/378 (40%), Gaps = 45/378 (11%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHE 73
           A +  E   PL  ++I V  P+ +E+ I + Y+ VCHTD +   G  P     P + GHE
Sbjct: 9   AVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 74  GAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
           GAG V ++G  V N K GD   I      C  C+ C+    + C            PD  
Sbjct: 69  GAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC------------PDA- 115

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                    +L  +    +F QY                L  +  + C   T Y  A K+
Sbjct: 116 ---------DLSGYTHDGSFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY-KALKS 165

Query: 193 ANVQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           AN++ G  VA+ G AG +G   +Q A+  G  R++ +D    K +     G   FI    
Sbjct: 166 ANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECFI---- 220

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHK---GWGTSVIIGVAAAEE 308
           D      I E +I+ T+GG         N  V   A+ A  K     GTSV++G+ A   
Sbjct: 221 DFTKEHDIAEAVIKATNGGAHGVI----NVSVSEGAISASTKYVRSCGTSVLVGMPAGAI 276

Query: 309 EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAF 368
             S    Q+V      GS  G    R++    ++ + +G +K    I       EI +  
Sbjct: 277 CKSEVFDQVVRSTKIVGSYVG---NRADTREALDFFARGLVKAPIKIVGLSTLPEIFEKM 333

Query: 369 ED-LHAGDCLRTVLDLKK 385
           E  L AG   R V+D  K
Sbjct: 334 EKGLIAG---RYVVDTSK 348

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 96/373 (25%), Positives = 154/373 (41%), Gaps = 39/373 (10%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE G PL  ++I V  P+A+E+ I ++Y+ VCHTD +   G  P     P + GHEG+
Sbjct: 36  IFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGS 95

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G V ++GE V   K GD   I      C  C+ C+SG  + C     +   G   DG   
Sbjct: 96  GEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS---GYTHDG--- 149

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                +  +  + C   T Y  A K A+
Sbjct: 150 ----------------SFQQYATADAVQAARIPKGTNMAEVAPILCAGITVY-KALKEAD 192

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ G  V + G AG +G   +Q AK  G  R+I +D    K +     G   F+    D 
Sbjct: 193 MRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEELFKSLGGEIFV----DF 247

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
              + IV ++ E T GG     + + +   +  + +      GT V++G+ A     S  
Sbjct: 248 TKTKDIVAEIQEATRGGPQGVINVSVSEAAISLSTKYVRPT-GTVVLVGLPAHSYVKSEV 306

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
              +V     KGS  G    R++    ++ + +G +K    I      +E+   ++ +  
Sbjct: 307 FSHVVKSINIKGSYVG---NRADTREALDFFARGLIKSPIKIIG---LSELPNVYKLMEE 360

Query: 374 GDCL-RTVLDLKK 385
           G  L R V+D  K
Sbjct: 361 GKILGRYVVDTSK 373

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 125/295 (42%), Gaps = 38/295 (12%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE    L  ++I V  P  +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 14  IFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 73

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V ++G  V N K GD+  I      C  C+ C+ G  + C                  
Sbjct: 74  GVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQA--------------- 118

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                  +L  +    +F QY                L  +  + C   T Y  A K+A 
Sbjct: 119 -------DLSGYTHDGSFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTVY-KALKSAE 170

Query: 195 VQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ G  VA+ GA G +G   +Q AK  G  R++ +D  D+K K   E G   FI    D 
Sbjct: 171 LEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKELGGEYFI----DF 225

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEAC---HKGWGTSVIIGVAA 305
              + I+ ++++ T+GG         N  V   A+ A     +  GT V++G+ A
Sbjct: 226 TKCKDIIGEVVKATNGGAHGVI----NVSVSEAAISASTRYARANGTVVLVGLPA 276

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 88.6 bits (218), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 117/284 (41%), Gaps = 32/284 (11%)

Query: 25  LTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGAGIVESVGE 83
           L   +I V  P+++E+ I ++Y+ VCHTD +   G  P     P + GHEGAG+V  +GE
Sbjct: 51  LKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGE 110

Query: 84  GVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEE 142
            V   K GD   I      C  C+ C++G    C                         +
Sbjct: 111 NVKGWKLGDLAGIKWLNGSCMSCELCETGHEANCEHA----------------------D 148

Query: 143 LKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVA 202
           L  +    +F QY                L  I  + C   T Y  A KTAN++ G+ VA
Sbjct: 149 LSGYTHDGSFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKPGEWVA 207

Query: 203 VFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVE 261
           + G AG +G   +Q AK  G  R++ +D  ++K K     G   F+    D    + IV 
Sbjct: 208 ISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVFV----DFTKSKDIVA 262

Query: 262 KLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
            +   T GG     + + +   +  +        GT V++G+ A
Sbjct: 263 DIQNATKGGPQGVINVSVSEAAITQSTHYVRPT-GTVVLVGLPA 305

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 101/366 (27%), Positives = 156/366 (42%), Gaps = 55/366 (15%)

Query: 33  EAPRAHEVRIKIEYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGEGVT 86
           E    +  ++ ++ T +C +D   Y   G+   G +    P +LGHE +G+V  VG  V 
Sbjct: 25  EITNPYYAKVAVKATGICGSDVHYYRSGGI---GKYILNSPMVLGHESSGVVVEVGPKVE 81

Query: 87  NVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHF 146
            +K GD V        +     K+GK NLC  +       +  DGT          +K++
Sbjct: 82  KIKVGDRVAIEPGVPDRYSDETKAGKYNLCPHMAFAATPPI--DGTL---------VKYY 130

Query: 147 MGCSTFSQYTXXXXXXXXXXXXXXXLESICL--LGCGVTTGYGAATKTANVQKGDTVAVF 204
           +  + F                    E  C+  L  GV +      K A V+ G TV VF
Sbjct: 131 LSPADF---------LVKLPDHVSFEEGACIEPLSVGVHS-----NKLAKVRFGQTVVVF 176

Query: 205 GAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINP-KSDLKDGQTIVEKL 263
           GAG VGL     AK  GAS ++ VD+ DQK +    FGAT  IN  K    D Q + +++
Sbjct: 177 GAGPVGLLTGAVAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKNDPQALADEV 236

Query: 264 IEMTDGGL-DYTFDCTGNTKVMRDALEACHKGWGTSVIIG-----VAAAEEEISTRPFQL 317
            ++  G L D  F+C+G    +   ++A   G GT V IG     V     E+S +   L
Sbjct: 237 EKLLGGALADVVFECSGAESCIDAGVKATKNG-GTMVQIGMGKNYVNFPIAEVSGKEMTL 295

Query: 318 VTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKA--FEDLHAGD 375
           V    +   ++G  K    +         G + V + IT+   F +  KA  F   H G+
Sbjct: 296 VGCFRY---SYGDYKDAVNL------VSTGRVDVKKLITHRFSFEDAAKAYDFNIAHGGE 346

Query: 376 CLRTVL 381
            ++T++
Sbjct: 347 VVKTII 352

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 97/372 (26%), Positives = 153/372 (41%), Gaps = 46/372 (12%)

Query: 22  GKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGAGIVES 80
           G  L  ++I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGAGIV +
Sbjct: 18  GGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGIVVA 77

Query: 81  VGEGV-TNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQ 138
            G  V    + GD   I      C  C++C+    + C                      
Sbjct: 78  KGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQA------------------- 118

Query: 139 KGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKG 198
              +L  +    +F QY                L  +  + C   T Y  A K+AN++ G
Sbjct: 119 ---DLSGYTHDGSFQQYATADAVQAARVPKGTDLAEVAPILCAGITVY-KALKSANLRAG 174

Query: 199 DTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQ 257
           + VA+ GA G +G   +Q AK  G  R++ +D  D+K K   + G   FI    D    +
Sbjct: 175 EWVAISGASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLGGEYFI----DFTKSK 229

Query: 258 TIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEAC---HKGWGTSVIIGVAAAEEEISTRP 314
            ++ ++I+ TDGG         N  V   A+ A     +  GT V++G+ A     S   
Sbjct: 230 DVIAEVIKATDGGAHGVI----NVSVSEGAISASTRYARANGTVVLVGLPANAYCKSEVF 285

Query: 315 FQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHAG 374
            Q+V      GS  G    R++    ++ + +G +K    I       EI   +E +  G
Sbjct: 286 NQVVKSVAIVGSYVG---NRADTREALDFFARGLVKSPIKIVGLSTLPEI---YEKMEKG 339

Query: 375 DCL-RTVLDLKK 385
             + R V+D  K
Sbjct: 340 QIVGRYVVDTSK 351

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 86.7 bits (213), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 95/363 (26%), Positives = 151/363 (41%), Gaps = 43/363 (11%)

Query: 15  AAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSG---VDPEGAFPSILG 71
           A V YE G  L   +I V  P+ +E+ + I+Y+ VCHTD +   G   + P+   P + G
Sbjct: 34  AVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIKPK--LPLVGG 91

Query: 72  HEGAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPD 130
           HEGAG+V + G  VTN + GD+  +      C +C+FC+ G    C +   +   G   D
Sbjct: 92  HEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNCETPTLS---GYTHD 148

Query: 131 GTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAAT 190
           G                   TF QY                L  +  + C   T Y  A 
Sbjct: 149 G-------------------TFQQYATADAIHAAHIPPGTDLAKVAPILCAGITVY-KAL 188

Query: 191 KTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPK 250
           KTA +  G  VA+ GAG    S+     V    R++ +D  ++K       G   F+   
Sbjct: 189 KTAALIPGQWVAISGAGGGLGSLAVQYAVAMGYRVVGIDGGNEKEALFRSLGGETFV--- 245

Query: 251 SDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV---AAAE 307
            D    + IV  + E T GG     + + +T  +  ++E   +  GT V++G+   A  +
Sbjct: 246 -DFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVEYV-RPTGTVVLVGLPPDATVK 303

Query: 308 EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKA 367
            ++ T   + +     KGS  G    R++    IE + +G ++    I       E  KA
Sbjct: 304 SDVLTHVLKSIN---IKGSYVG---NRADTKEAIEFFTRGLVQSPIKIIGLSQLEEAYKA 357

Query: 368 FED 370
            E+
Sbjct: 358 MEE 360

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 86.3 bits (212), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 92/372 (24%), Positives = 145/372 (38%), Gaps = 64/372 (17%)

Query: 32  VEAPRA---HEVRIKIEYTAVCHTDAYTLS---------GVDPE---GAFPSILGHEGAG 76
           +E PR     E+ I I +  +C TD +  +         G   E      P  +GHE AG
Sbjct: 18  LEEPRITTDDELLIDIIFCGICGTDLHEYTDGPIFFPSDGHKHEISNNELPQAMGHEMAG 77

Query: 77  IVESVGEGVTNVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVRAT 122
           IV  VG GVT  K GDHV    T  C              +KC  CK G  N+CS +   
Sbjct: 78  IVREVGSGVTQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRGMYNVCSHL-GL 136

Query: 123 QGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGV 182
            G GV   G                    F++                 +E + L+    
Sbjct: 137 IGNGVQSGG--------------------FAERVVINESHCYKLPNHIPMEVVALVQPIA 176

Query: 183 TTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFG 242
            + +  A + +  + G +V + G G +GLS I      G + I++ +    +R    + G
Sbjct: 177 VSWH--AVRVSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPAKIRRDLAEKMG 234

Query: 243 ATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIG 302
           A  +   +   ++    +  L    D G DY FDC+G    +R ++E C    GT+V + 
Sbjct: 235 AVVYDPMQHSYEENIKYLRALAPDKD-GFDYCFDCSGTPATLRSSIE-CLTFRGTAVNVA 292

Query: 303 VAAAEEEISTRPFQLVTG-RVWKGSAFGGIKGRSEMGGLIEDYKKGTL---KVDEFITNE 358
           + A  + I   P  +    + + GS         +  G+I+  +KGT+   K    IT +
Sbjct: 293 MWATGKPIDFFPMDITQQEKSYTGSM---CYTHHDFEGVIDALEKGTIDPEKAQHMITAK 349

Query: 359 RPFTEINKAFED 370
            P   + + FED
Sbjct: 350 VP---LERGFED 358

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 101/375 (26%), Positives = 150/375 (40%), Gaps = 45/375 (12%)

Query: 1   MSGAATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDA-YTLSG 59
           MS +  +   +    A+ YE  +P+ V    +E P  H V++KIE T +C +D  Y L G
Sbjct: 1   MSSSMQQAVVLREKGAIVYE-HRPVPV----IEDP--HYVKVKIEKTGICGSDVHYYLHG 53

Query: 60  VDPEGAF----PSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNL 115
               G F    P +LGHE +G V  VG  VT V+ GD V        +  +  KSG  NL
Sbjct: 54  SI--GPFVVRSPMVLGHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNL 111

Query: 116 CSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESI 175
           C  +R         DGT          +K+++    F                   LE  
Sbjct: 112 CREMRFAATPPY--DGTL---------VKYYISPEDF----------LVKLPDSVSLEEG 150

Query: 176 CLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKR 235
            L  C        A + A  Q    V VFGAG VGL     AK  GA+ + +VDI+  K 
Sbjct: 151 AL--CEPLAVAVHANRLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKL 208

Query: 236 KYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGW 295
                 G T  ++  SD    + +  KL       +D  FDC+G    +  A+  C  G 
Sbjct: 209 CVAPALGVTHPVD-SSDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPG- 266

Query: 296 GTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAFGGIK-GRSEMGGLIEDYKKGTLKVDEF 354
           GT V +G  ++ + +S   F L    V +    G  +    +    +E      +     
Sbjct: 267 GTHVQVG--SSRDYVS---FPLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAARL 321

Query: 355 ITNERPFTEINKAFE 369
           +T+  PF    +A++
Sbjct: 322 VTHRFPFDRAVEAYK 336

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 99/376 (26%), Positives = 153/376 (40%), Gaps = 45/376 (11%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 75
           + YE    L  +++ V  P+  E+ I + Y+ VCHTD +   G  P +   P + GHEGA
Sbjct: 16  IFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGA 75

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V  +G  V   K GD   I      C  C+ C+    + C     +   G   DG   
Sbjct: 76  GVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNCPEADLS---GYTHDG--- 129

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                +  +  + C   T Y  A K+A 
Sbjct: 130 ----------------SFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY-KALKSAE 172

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           ++ GD VA+ G AG +G   +Q AK  G  R++ +D  D+K K+    G   F+    D 
Sbjct: 173 LKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEVFV----DF 227

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAAAEEEI 310
              + IV  + E T+GG      C  N  V   A+EA     +  GT V++G+ A     
Sbjct: 228 MTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEASTQYVRTNGTVVLVGLPAGAYCK 283

Query: 311 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFED 370
           S    Q+V      GS  G    R++    ++ + +G +K    +       EI   +E 
Sbjct: 284 SEVFDQVVKSYKIVGSYVG---NRADTREALDFFVRGLVKPTIKVVGLSTLPEI---YEK 337

Query: 371 LHAGDCL-RTVLDLKK 385
           +  G  + R V+D  K
Sbjct: 338 MEKGQIVGRYVVDTSK 353

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 81.6 bits (200), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 95/223 (42%), Gaps = 27/223 (12%)

Query: 22  GKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGAGIVES 80
           G  L  ++I V  P + E+ I ++Y+ VCHTD +   G  P     P + GHEGAG+V +
Sbjct: 16  GGELEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVA 75

Query: 81  VGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQK 139
           +GE V   K GD   I      C  C++C+ G  + C                       
Sbjct: 76  LGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNCPHA-------------------- 115

Query: 140 GEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGD 199
             +L  +    +F QY                L  +  + C   T Y  A K+A+++ G 
Sbjct: 116 --DLSGYTHDGSFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSADLKAGQ 172

Query: 200 TVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEF 241
            VA+ GA G +G   +Q A+  G  R++ +D  D KRK   E 
Sbjct: 173 WVAISGACGGLGSLAVQYARAMG-YRVLGIDGGDDKRKLFKEL 214

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 83.2 bits (204), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 97/380 (25%), Positives = 162/380 (42%), Gaps = 38/380 (10%)

Query: 11  ITCVAAVAYEAGKPLTVEEITV-EAPRAHEVRIKIEYTAVCHTDAYTLSG---VDPEGAF 66
           +T   A+  E    +T+  +++ +    +EV I+I+ T +C +D +  +     +     
Sbjct: 4   LTTQEAIVLERPGKITLTNVSIPKISDPNEVIIQIKATGICGSDIHYYTHGRIANYVVES 63

Query: 67  PSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKG 126
           P +LGHE +GIV  +GE V  +K GD V        +     K G+ NL  +++      
Sbjct: 64  PMVLGHESSGIVALIGENVKTLKVGDRVALEPGIPDRFSPEMKEGRYNLDPNLKFA---- 119

Query: 127 VMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGY 186
                T  F               T ++Y                 E   L+       +
Sbjct: 120 ----ATPPFDG-------------TLTKYYKTMKDFVYKLPDDVSFEEGALIEPLSVAIH 162

Query: 187 GAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDF 246
             A K A ++ G    VFGAG +GL   + A V GA+ ++ VD+ + K +   +FGAT  
Sbjct: 163 --ANKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHI 220

Query: 247 INPKSDLKDGQTIVEKLIEMTDG--GLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVA 304
           +N   DL  G T V+ +I+   G  G D  F+C+G    +R  +E C  G GT  I+ V 
Sbjct: 221 VN-SGDLPHGVT-VDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAG-GT--IVQVG 275

Query: 305 AAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEI 364
             +EEI      + T  +     F   +G  +    IE      L +  FIT+   F + 
Sbjct: 276 MGQEEIQFPISIIPTKELTFQGCFRYCQG--DYSDSIELVSSRKLSLKPFITHRYSFKDA 333

Query: 365 NKAFEDL--HAGDCLRTVLD 382
            +AFE+   H  + ++T+++
Sbjct: 334 VEAFEETSHHPLNNIKTIIE 353

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 104/367 (28%), Positives = 154/367 (41%), Gaps = 57/367 (15%)

Query: 33  EAPRAHEVRIKIEYTAVCHTDA-YTLSGVDPEGAF----PSILGHEGAGIVESVGEGVTN 87
           E P  H V++ I+ T +C +D  Y  SG    G +    P +LGHE +G V  VG  V +
Sbjct: 25  ELPNEHYVKVAIKATGICGSDIHYYKSG--SIGKYVVNQPMVLGHESSGEVVEVGSAVRS 82

Query: 88  VKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFM 147
           +K GD V        +     K G+ NLC  +       +  DGT          +K+++
Sbjct: 83  IKVGDRVAIEPGVPDRYSDETKQGRYNLCPDMAFAATPPI--DGTL---------VKYYV 131

Query: 148 GCSTFSQYTXXXXXXXXXXXXXXXLESICL--LGCGVTTGYGAATKTANVQKGDTVAVFG 205
             + F                    E  C+  L  GV      A K A V  G  V VFG
Sbjct: 132 SPADF---------LVKLPDHVSFEEGACIEPLSVGVH-----ANKLAKVHFGSVVVVFG 177

Query: 206 AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLK-DGQTIVEKLI 264
           AG VGL     AK  GAS +I VD+ D K +    FGAT  IN KS  + +G  +   + 
Sbjct: 178 AGPVGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTINSKSLPRGEGDAVSAAVS 237

Query: 265 EMTDGGL-DYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVW 323
               G L D  F+C+G    +   + +   G GT V IG+    +     P   V+G+  
Sbjct: 238 NYLGGALADVVFECSGAEPCINSGVLSTKNG-GTMVQIGMG---KNYINFPLAEVSGK-- 291

Query: 324 KGSAFGGIKGRSEMGGLIEDYKK-------GTLKVDEFITNERPFTEINKAFED--LHAG 374
           + S  G    R   G    DY+        G ++V + ITN   F +   A++    + G
Sbjct: 292 EMSVIGCF--RYSFG----DYRDAVRLVATGQVEVKKMITNRFKFEDAAAAYDYNIANGG 345

Query: 375 DCLRTVL 381
           + ++T++
Sbjct: 346 EVVKTII 352

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 104/372 (27%), Positives = 156/372 (41%), Gaps = 65/372 (17%)

Query: 31  TVEAPRAHEVRIKIEYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGEG 84
           T+E P  H V++ I+ T +C +D   Y   G+   G +    P +LGHE +G V  VG  
Sbjct: 26  TIEDP--HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGEVVEVGNA 80

Query: 85  VTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELK 144
           VT VK GD V        +     K G+ NLC  +       +  DGT          +K
Sbjct: 81  VTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTL---------VK 129

Query: 145 HFMGCSTFSQYTXXXXXXXXXXXXXXXLESICL--LGCGVTTGYGAATKTANVQKGDTVA 202
           +++    F                    E  C+  L  GV +      K A V+    V 
Sbjct: 130 YYLSPEDF---------LVKLPEGVSYEEGACVEPLSVGVHS-----NKLAGVRFSTRVV 175

Query: 203 VFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFIN----PKSDLKDGQT 258
           VFGAG VGL     A+  GAS ++ VD+ D K +   +FGAT+  N    P    ++  +
Sbjct: 176 VFGAGPVGLLTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSSKIPTDKAQELAS 235

Query: 259 IVEKLIEMTDGG--LDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQ 316
            VEKL+    GG   D  F+C+G   V  DA     K  GT V +G+    +  +  P  
Sbjct: 236 EVEKLL----GGNHADVVFECSG-ADVCIDAGVKVTKVGGTMVQVGMG---KNYTNFPIA 287

Query: 317 LVTGRVWK-----GSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFED- 370
            V+G+  K       +FG  +    +         G + V   IT+   F +  KA++  
Sbjct: 288 EVSGKEMKLIGCFRYSFGDYRDAVNL------VATGKVNVKPLITHRFKFEDAAKAYDYN 341

Query: 371 -LHAGDCLRTVL 381
             H GD ++T++
Sbjct: 342 ISHGGDVVKTII 353

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 159/375 (42%), Gaps = 71/375 (18%)

Query: 31  TVEAPRAHEVRIKIEYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGEG 84
           T++ P  H V++ I+ T +C +D   Y   G+   G +    P +LGHE +G V  VG+ 
Sbjct: 26  TIKDP--HYVKLAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDA 80

Query: 85  VTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELK 144
           VT VK GD V        +     K G+ NLC  +       +  DGT          +K
Sbjct: 81  VTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTL---------VK 129

Query: 145 HFMGCSTFSQYTXXXXXXXXXXXXXXXLESICL--LGCGVTTGYGAATKTANVQKGDTVA 202
           +++    F                    E  C+  L  GV +      K A V+ G  V 
Sbjct: 130 YYLSPEDF---------LVKLPEGVSYEEGACVEPLSVGVHS-----NKLAGVRFGTKVV 175

Query: 203 VFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPK-------SDLKD 255
           VFGAG VGL     A+  GA+ +I VD+ D K +   +FGAT+  N          DL D
Sbjct: 176 VFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLAD 235

Query: 256 GQTIVEKLIEMTDGG--LDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
           G   V+KL+    GG   D  F+C+G   V  DA     K  GT V +G+    +  +  
Sbjct: 236 G---VQKLL----GGNHADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGMG---KNYTNF 284

Query: 314 PFQLVTGRVWK-----GSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAF 368
           P   V+G+  K       +FG  +    +         G + V   IT++  F +  KA+
Sbjct: 285 PIAEVSGKEMKLIGCFRYSFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAY 338

Query: 369 ED--LHAGDCLRTVL 381
           +    H G+ ++T++
Sbjct: 339 DYNIAHGGEVVKTII 353

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 101/384 (26%), Positives = 164/384 (42%), Gaps = 43/384 (11%)

Query: 9   KSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDA-YTLSGVDPEGAF- 66
           +S T  A V  + GK +       +   A++V ++I+ T +C +D  Y   G        
Sbjct: 3   ESTTQEAVVLEQPGKIVLTNVNIPKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVK 62

Query: 67  -PSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
            P +LGHE +G+V  +G+ V  +K GD V        +     K G+ NL          
Sbjct: 63  SPMVLGHESSGVVVLIGDNVKTLKVGDRVALEPGFPNRFSSELKEGRYNL---------- 112

Query: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTG 185
               D   +F      +        T ++Y                 E   L+       
Sbjct: 113 ----DPDLKFAATPPYD-------GTLTKYYRAPKDFVYKIPDHVSFEEGALMEPLSVAV 161

Query: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245
           +  A + A ++ G    VFGAG VGL   + A V GA+ ++ VD+++ K +   +FGAT 
Sbjct: 162 H--ANRLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATH 219

Query: 246 FINPKSDLKDG---QTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIG 302
            +N   DL  G   +T++ K I     G D  F+C+G    +R  +E C  G GT V +G
Sbjct: 220 MVN-SGDLPQGVSAETVIRKAI--GKKGADVVFECSGAQPCIRTGIEVCKAG-GTYVQVG 275

Query: 303 VAAAEEE--ISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERP 360
           +   E +  IS  P + +T   ++GS F   +G  +    IE    G L +   IT    
Sbjct: 276 MGQEEIQFPISKIPAKEIT---FQGS-FRYCQG--DYSDSIELVSSGKLSLKPLITRRYQ 329

Query: 361 FTEINKAFEDL--HAGDCLRTVLD 382
           F E  +AF++   H  D ++T+++
Sbjct: 330 FKEAIEAFDENRDHPLDNVKTIIE 353

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 103/369 (27%), Positives = 152/369 (41%), Gaps = 61/369 (16%)

Query: 32  VEAPRAHEVRIKIEYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGEGV 85
           +E P  H V+I I+ T +C +D   Y   G+   G +    P +LGHE +G V  VG  V
Sbjct: 27  IEDP--HYVKIAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGSAV 81

Query: 86  TNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKH 145
           T VK GD V        +     K G+ NLC  +       +  DGT          +K+
Sbjct: 82  TRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTL---------VKY 130

Query: 146 FMGCSTFSQYTXXXXXXXXXXXXXXXLESICL--LGCGVTTGYGAATKTANVQKGDTVAV 203
           ++    F                    E  C+  L  GV +      K A V+ G  V V
Sbjct: 131 YLSPEDF---------LVKLPEGVSYEEGACVEPLSVGVHS-----NKLAGVRFGSRVVV 176

Query: 204 FGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFIN----PKSDLKDGQTI 259
           FGAG VGL     A+  GAS ++ +D+ D K     EFGAT   N    P    ++    
Sbjct: 177 FGAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPADKTQELADE 236

Query: 260 VEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVT 319
           VEKL  ++    D  F+C+G    + DA     K  GT V IG+    +  +  P   V+
Sbjct: 237 VEKL--LSGHHADIVFECSGADACI-DAGVKITKVGGTMVQIGMG---KNYTNFPIAEVS 290

Query: 320 GRVWK-----GSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKA--FEDLH 372
           G+  K       +FG  +   ++         G + V   IT+   F +  KA  F   H
Sbjct: 291 GKEMKLIGCFRYSFGDYRDAVKL------VASGKVNVKAMITHRFKFEDAAKAYDFNIAH 344

Query: 373 AGDCLRTVL 381
            G+ ++T++
Sbjct: 345 GGEVVKTII 353

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 158/375 (42%), Gaps = 71/375 (18%)

Query: 31  TVEAPRAHEVRIKIEYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGEG 84
           T++ P  H V++ I+ T +C +D   Y   G+   G +    P +LGHE +G V  VG+ 
Sbjct: 26  TIKDP--HYVKLAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDA 80

Query: 85  VTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELK 144
           VT VK GD V        +     K G  NLC  +       +  DGT          +K
Sbjct: 81  VTRVKVGDRVAIEPGVPSRYSDETKEGSYNLCPHMAFAATPPI--DGTL---------VK 129

Query: 145 HFMGCSTFSQYTXXXXXXXXXXXXXXXLESICL--LGCGVTTGYGAATKTANVQKGDTVA 202
           +++    F                    E  C+  L  GV +      K A V+ G  V 
Sbjct: 130 YYLSPEDF---------LVKLPEGVSYEEGACVEPLSVGVHS-----NKLAGVRFGTKVV 175

Query: 203 VFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPK-------SDLKD 255
           VFGAG VGL     A+  GA+ +I VD+ D K +   +FGAT+  N          DL D
Sbjct: 176 VFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLAD 235

Query: 256 GQTIVEKLIEMTDGG--LDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
           G   V+KL+    GG   D  F+C+G   V  DA     K  GT V +G+    +  +  
Sbjct: 236 G---VQKLL----GGNHADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGMG---KNYTNF 284

Query: 314 PFQLVTGRVWK-----GSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAF 368
           P   V+G+  K       +FG  +    +         G + V   IT++  F +  KA+
Sbjct: 285 PIAEVSGKEMKLIGCFRYSFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAY 338

Query: 369 ED--LHAGDCLRTVL 381
           +    H G+ ++T++
Sbjct: 339 DYNIAHGGEVVKTII 353

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 83/305 (27%), Positives = 124/305 (40%), Gaps = 56/305 (18%)

Query: 27  VEEITVEAPRAHEVRIKIEYTAVCHTDA--YTLSGV----DPE------GAFPSILGHEG 74
           ++E T+EA    E+ I I +  +C TD   YT   +    D E         P  +GHE 
Sbjct: 18  LKEPTIEA--DDELMIDISWCGICGTDLKEYTEGAIFFPNDGECHQISGEPLPQAMGHEM 75

Query: 75  AGIVESVGEGVTNVKPGDHVIALYTAECQK--------------CKFCKSGKTNLCSSVR 120
           AG+V  VG GV   K GDHV+   T  C+               C  CK G  N+CS + 
Sbjct: 76  AGVVSRVGPGVKKFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKGYYNICSKL- 134

Query: 121 ATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGC 180
              G GV   G                    F++                 L+   L+  
Sbjct: 135 GLCGAGVQSGG--------------------FAERVVMNESHCHKVPDDLPLDIAALIQP 174

Query: 181 GVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNE 240
                +  A +  N +KG +  V G+G +GL +I      G + I++ +    +R +  E
Sbjct: 175 IAVCWH--ALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPAKIRRDFAKE 232

Query: 241 FGATDFINPKSDLKDGQTIVEKLIEMTDG--GLDYTFDCTGNTKVMRDALEACHKGWGTS 298
            GAT F +P S L   +  ++ L  +  G  G DYTFDC+GN      ++E C    GT+
Sbjct: 233 LGATVF-DPSS-LPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE-CLTFNGTA 289

Query: 299 VIIGV 303
           V + +
Sbjct: 290 VNVAM 294

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 92/373 (24%), Positives = 152/373 (40%), Gaps = 36/373 (9%)

Query: 17  VAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 75
           + YE G  L  ++I V  P+ +E+ + ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 34  IFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLSVKLPLVGGHEGA 93

Query: 76  GIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSR 134
           G+V + G  V N + GD   I      C  C+ C+SG  + C     +   G   DG   
Sbjct: 94  GVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS---GYTHDG--- 147

Query: 135 FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN 194
                           +F QY                L  +  + C   T Y  A K A+
Sbjct: 148 ----------------SFQQYATADAVQAAKIPEGTNLAEVAPVLCAGITVY-KALKEAS 190

Query: 195 VQKGDTVAVFG-AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           +  G  V + G AG +G   +Q  K  G  R+I +D    K +     G   FI+     
Sbjct: 191 LSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFKSLGGEVFIDFTKQK 249

Query: 254 KDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTR 313
            D   +V  + + T+GG     + + +   +  + +   +  GT V++G+ A     S  
Sbjct: 250 TDSD-MVAAIQKATNGGPHGVINVSVSDAAISLSTKYV-RTCGTVVLVGLPAHSVVKSDV 307

Query: 314 PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
              +V     KGS  G    R++    ++ + +G +K    +      +E+   ++ + A
Sbjct: 308 FSHVVKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKVVG---LSELPAVYKLMEA 361

Query: 374 GDCL-RTVLDLKK 385
           G  L R V+D  K
Sbjct: 362 GKILGRYVVDTAK 374

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 80.1 bits (196), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 80/317 (25%), Positives = 129/317 (40%), Gaps = 66/317 (20%)

Query: 38  HEVRIKIEYTAVCHTD----------------AYTLSGVDPEGAFPSILGHEGAGIVESV 81
           HE+ I + +  +C TD                 + LSG+D     P  +GHE +GIV+ V
Sbjct: 27  HELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGHEMSGIVKEV 82

Query: 82  GEGVTNVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVRATQGKGV 127
           G+GVT  KPGD V+   T  C              + C  C+ G  N C+   + QG G 
Sbjct: 83  GKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCCTH-GSFQGLGS 141

Query: 128 MPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYG 187
           +  G                    F++                 L+   L+   ++  + 
Sbjct: 142 VGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALVE-PLSVAWH 180

Query: 188 AATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFI 247
           AA + A  ++G    V G+G +GL++I   K   A +I++ +    +R+   +     F 
Sbjct: 181 AA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELAEKLNVVVF- 238

Query: 248 NPKSDLKDGQTIVEKLIEMT--DGGLDYTFDCTGNTKVMRDALE-ACHKGWGTSVIIGVA 304
           NP       Q  +EKL E++  D G DYTFDC+G       A++ AC +G   +V I   
Sbjct: 239 NPTH--TRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKAACIQGHIVNVAI--- 293

Query: 305 AAEEEISTRPFQLVTGR 321
              + ++  P  +  G 
Sbjct: 294 WGPKPVAFHPMDMTYGE 310

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 79.7 bits (195), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 98/348 (28%), Positives = 144/348 (41%), Gaps = 58/348 (16%)

Query: 38  HEVRIKIEYTAVCHTDAY--TLSGVDPEGAF----PSILGHEGAGIVESVGEGVTNVKPG 91
           H V+++I+ T +C +D +  T   +   G+F    P +LGHE +GIV  VG  VT V  G
Sbjct: 31  HFVKVQIKATGICGSDVHFCTHGAI---GSFIVKEPMVLGHESSGIVVEVGSEVTKVAVG 87

Query: 92  DHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCST 151
           D V        +  +   SG  NLC  ++      V  DGT          LK+F     
Sbjct: 88  DRVAIEPGYPSRYSEETVSGHYNLCPGMKFAATPPV--DGTL---------LKYFQVPED 136

Query: 152 FSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGA----------ATKTANVQKGDTV 201
           F                      +  L   VT   GA          A K A V+ GD V
Sbjct: 137 F----------------------VYKLPDDVTFEEGALVEPLAVAVHAVKLAGVKFGDKV 174

Query: 202 AVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVE 261
            VFGAG VGL V    K  GA+ ++ +D+ D+K     E G+T  IN K D+ +    +E
Sbjct: 175 VVFGAGPVGLLVGSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAINSK-DMAEEALALE 233

Query: 262 KLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGR 321
              ++     +   DCTG    +R ++ AC  G GT V +G+      +      ++   
Sbjct: 234 IQNDLNGQHPNKVIDCTGAEPCLRSSILACKPG-GTVVQVGMGTTNASLPVSDI-VIKEL 291

Query: 322 VWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFE 369
            +KGS      G  +    +  YKK  + V   IT+   F +  KA +
Sbjct: 292 TFKGS-MRYCHGDYQDAIQLLKYKK--VDVKAIITHRFSFDDAIKALQ 336

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 97/368 (26%), Positives = 157/368 (42%), Gaps = 57/368 (15%)

Query: 31  TVEAPRAHEVRIKIEYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGEG 84
           T++ P  H V++ I+ T +C +D   Y   G+   G +    P +LGHE +G V  VG+ 
Sbjct: 26  TIDDP--HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDA 80

Query: 85  VTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELK 144
           VT VK GD V        +     K G+ NLC  +       +  DGT          ++
Sbjct: 81  VTRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTL---------VR 129

Query: 145 HFMGCSTFSQYTXXXXXXXXXXXXXXXLESICL--LGCGVTTGYGAATKTANVQKGDTVA 202
           +++    F                    E  C+  L  GV +      K A V+ G  V 
Sbjct: 130 YYLSPEDF---------LVKLPDGVSYEEGACVEPLSVGVHS-----NKLAGVRFGTRVV 175

Query: 203 VFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGAT-DFINPKSDLKDGQTIVE 261
           VFGAG VGL     A   GAS +I VD+ D + +   +FGA+  F + K  + + Q + +
Sbjct: 176 VFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLAD 235

Query: 262 KLIEMTDG-GLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTG 320
           ++ ++  G   D  F+C+G   V  DA     K  GT V +G+    +  +  P   V+G
Sbjct: 236 EVEKLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGMG---KNYTNFPIAEVSG 291

Query: 321 RVWK-----GSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFED--LHA 373
           +  +       +FG  +    +         G + V   IT+   F +  KA++    H 
Sbjct: 292 KEMRLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHG 345

Query: 374 GDCLRTVL 381
           GD ++T++
Sbjct: 346 GDVVKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 97/368 (26%), Positives = 157/368 (42%), Gaps = 57/368 (15%)

Query: 31  TVEAPRAHEVRIKIEYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGEG 84
           T++ P  H V++ I+ T +C +D   Y   G+   G +    P +LGHE +G V  VG+ 
Sbjct: 26  TIDDP--HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDA 80

Query: 85  VTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELK 144
           VT VK GD V        +     K G+ NLC  +       +  DGT          ++
Sbjct: 81  VTRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTL---------VR 129

Query: 145 HFMGCSTFSQYTXXXXXXXXXXXXXXXLESICL--LGCGVTTGYGAATKTANVQKGDTVA 202
           +++    F                    E  C+  L  GV +      K A V+ G  V 
Sbjct: 130 YYLSPEDF---------LVKLPDGVSYEEGACVEPLSVGVHS-----NKLAGVRFGTRVV 175

Query: 203 VFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGAT-DFINPKSDLKDGQTIVE 261
           VFGAG VGL     A   GAS +I VD+ D + +   +FGA+  F + K  + + Q + +
Sbjct: 176 VFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLAD 235

Query: 262 KLIEMTDG-GLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTG 320
           ++ ++  G   D  F+C+G   V  DA     K  GT V +G+    +  +  P   V+G
Sbjct: 236 EVEKLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGMG---KNYTNFPIAEVSG 291

Query: 321 RVWK-----GSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFED--LHA 373
           +  +       +FG  +    +         G + V   IT+   F +  KA++    H 
Sbjct: 292 KEMRLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHG 345

Query: 374 GDCLRTVL 381
           GD ++T++
Sbjct: 346 GDVVKTII 353

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 83/307 (27%), Positives = 125/307 (40%), Gaps = 64/307 (20%)

Query: 31  TVEAPRAH---EVRIKIEYTAVCHTDA--YTLSGVD-PE---------GAFPSILGHEGA 75
           +++ P  H   +V I I +  +C TD   YT   +  PE            P  +GHE +
Sbjct: 17  SLKEPHIHAEDDVIIDISWCGICGTDLKEYTDGAIFFPEDGCVNHISNNNLPQAMGHEIS 76

Query: 76  GIVESVGEGVTNVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVRA 121
           GI+ SVG G    K GDHV+   TA C                C+ C++G  N+C  +  
Sbjct: 77  GIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNGMPNICKYLGL 136

Query: 122 TQGKGVMPDGTSR---FKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLL 178
           T G GV   G +           ++ H M     S                    S+C  
Sbjct: 137 T-GAGVEGGGFAEKMVINEHHCHKIPHHMPLDVASLIQPI---------------SVCW- 179

Query: 179 GCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYG 238
                     A K ++ ++G +V + G G +GL  I   K  G   I++ +    +R+  
Sbjct: 180 ---------HAVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPALIRRELA 230

Query: 239 NEFGATDFINPKSDLKDGQTIVEKLIEMTDG--GLDYTFDCTGNTKVMRDALEACHKGWG 296
            + GA  F +P +   D    ++ L EM  G  G DYTFDC+G    ++ A+E C    G
Sbjct: 231 EKMGARVF-DPSNMSLDNS--IKTLTEMAPGSQGFDYTFDCSGIPATLKVAIECC-TFRG 286

Query: 297 TSVIIGV 303
           T+V I V
Sbjct: 287 TAVNIAV 293

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 109/246 (44%), Gaps = 31/246 (12%)

Query: 25  LTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDP-EGAFPSILGHEGAGIVESVGE 83
           L ++ I V++P+A+E+ I ++++ VCH+D +   G  P +   P + GHEGAGIV ++G 
Sbjct: 25  LELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPLVGGHEGAGIVVAMGA 84

Query: 84  GVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEE 142
            V   K GD+  I    + C  C+ C+      C+    +   G   DG           
Sbjct: 85  SVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYADIS---GFTRDG----------- 130

Query: 143 LKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVA 202
                   +F QY                L  +  + C   T +  A KTAN+  G+ VA
Sbjct: 131 --------SFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF-KALKTANLTAGNWVA 181

Query: 203 VFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVE 261
           + GA G +G   IQ AK  G S ++ +D   +K    N+ G   F+    D    + +V 
Sbjct: 182 ISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVFL----DFSKSENLVP 236

Query: 262 KLIEMT 267
           +++  T
Sbjct: 237 EVVSAT 242

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 115/293 (39%), Gaps = 49/293 (16%)

Query: 38  HEVRIKIEYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESVGEGVTNVKPG 91
           H V+++I+ T +C +D   Y    +   G F    P +LGHE +GI+  VG  V  +K G
Sbjct: 31  HWVKVQIKATGICGSDVHFYKYGSI---GDFVVKSPMVLGHESSGIIAEVGSAVKTLKVG 87

Query: 92  DHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCS- 150
           D V        +  +   SG  NLC                            HF     
Sbjct: 88  DRVALEPGYPSRYTEATMSGHYNLCP-------------------------FMHFAATPP 122

Query: 151 ---TFSQYTXXXXXXXXXXXXXXXLESICLL---GCGVTTGYGAATKTANVQKGDTVAVF 204
              T ++Y                 E   LL     GV      A K A  + GD V VF
Sbjct: 123 CDGTLTKYYLTPFDFVYKLPDNVSYEEGALLEPLSVGVH-----ANKQAGTRFGDKVVVF 177

Query: 205 GAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLI 264
           GAG VGL     AKV GA +++ +D+ D+K +    FGAT  IN      + +  +   I
Sbjct: 178 GAGPVGLLNGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVINSSKLRINDEFELAVAI 237

Query: 265 EMTDGGL--DYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPF 315
           +   GG+  D   +CTG    +R  + A   G GT V +G+   +  I    F
Sbjct: 238 KEKLGGVDPDIVLECTGAEPCIRAGIRALKTG-GTFVQVGMGKDDANIPITQF 289

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 120/292 (41%), Gaps = 56/292 (19%)

Query: 39  EVRIKIEYTAVCHTDAYT-LSGV-----DPE------GAFPSILGHEGAGIVESVGEGVT 86
           EV I + +  +C +D +  L G      D E       A P  +GHE +GIV  VG  VT
Sbjct: 28  EVIIDVSWCGICGSDLHEYLDGPIFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVT 87

Query: 87  NVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
            VK GDHV+    + C              + C  C+ G  NLC+      G GV+  G 
Sbjct: 88  KVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRGSENLCTHA-GFVGLGVISGG- 145

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
             F  Q              SQ+                +E + +           A K 
Sbjct: 146 --FAEQ-----------VVVSQHHIIPVPKEIPLDVAALVEPLSVTW--------HAVKI 184

Query: 193 ANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSD 252
           +  +KG +  V GAG +GL  I   K  GAS+I++ +I +++ +   + G   F NP   
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVF-NPS-- 241

Query: 253 LKDGQTIVEKLIEMTDG--GLDYTFDCTGNTKVMRDALEAC-HKGWGTSVII 301
            K G   +E L  +T    G DY++DC+G       +L+A   KG  T++ +
Sbjct: 242 -KHGHKSIEILRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAV 292

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 122/306 (39%), Gaps = 59/306 (19%)

Query: 27  VEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSG-------------VDPEGAFPSILGHE 73
           + E T+ AP   E+ I + +  +C TD +                 +  EG  P  +GHE
Sbjct: 57  LPEPTISAPD--EMIIDVSWCGICGTDLHEFQDGPIFFPHDGCCHEISGEG-LPQAMGHE 113

Query: 74  GAGIVESVGEGVTNVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSV 119
            AG +   G GVT  K GD V+   T  C              + C  CK G  N+CS++
Sbjct: 114 IAGTIIECGPGVTKFKVGDRVVVEPTGTCKDRYRWPNSPNVDKEPCAACKKGLYNICSNL 173

Query: 120 RATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLG 179
               G GV   G                    F++                 ++   L+ 
Sbjct: 174 -GLVGAGVQSGG--------------------FAERLVMNERQCYKVPDHMSMDVAALIQ 212

Query: 180 CGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGN 239
               + +  A + +  +KG +V + GAG +GL  I      G S +++ +    +R +  
Sbjct: 213 PIAVSWH--AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGVSEVVVSEPAKIRRDFAE 270

Query: 240 EFGATDFINPKSDLKDGQTIVEKLIEMTDG--GLDYTFDCTGNTKVMRDALEACHKGWGT 297
           + GA  + +P +  KD    ++ L  +  G  G DY FDC+GN   ++ A+E C    GT
Sbjct: 271 KMGAIVY-DPSA--KDHDESIKYLRSIAPGGDGFDYAFDCSGNPATLKAAIE-CLTFRGT 326

Query: 298 SVIIGV 303
           +V + +
Sbjct: 327 AVNVAI 332

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 114/290 (39%), Gaps = 52/290 (17%)

Query: 39  EVRIKIEYTAVC------HTDAYTLSGVDPE------GAFPSILGHEGAGIVESVGEGVT 86
           EV I + +  +C      +TD       D E       A P  +GHE +GI+  VG  VT
Sbjct: 28  EVIIDVSWCGICGSDLHEYTDGPIFMPKDGECHALSNAALPLAMGHEMSGIIAKVGPRVT 87

Query: 87  NVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
            VK GDHV+    + C              + C+ CK G  NLC+      G GV+  G 
Sbjct: 88  KVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKGSENLCAH-SGFVGLGVISGG- 145

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                              F++                 L+   L+     T +  A K 
Sbjct: 146 -------------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVKL 184

Query: 193 ANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSD 252
           +  +KG +  V GAG +GL  I   K  GA +I++ ++ +++ K         F NP   
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRLKMAKSLDVEVF-NPAQH 243

Query: 253 LKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEAC-HKGWGTSVII 301
                 ++  L E  D G DY++DC+G       +L+A   KG  T++ +
Sbjct: 244 GHKSVELLRGLTESHD-GFDYSYDCSGIQATFETSLKALTFKGTATNIAV 292

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 120/292 (41%), Gaps = 56/292 (19%)

Query: 39  EVRIKIEYTAVCHTDAYT-LSGV-----DPE------GAFPSILGHEGAGIVESVGEGVT 86
           EV I + +  +C +D +  L G      D E         P  +GHE +GIV  VG  VT
Sbjct: 28  EVLIDVSWCGICGSDLHEYLDGPIFMPKDGECHALSNAGLPLAMGHEMSGIVAEVGPKVT 87

Query: 87  NVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
            VK GDHV+    + C              + C+ CK G  NLC+      G GV+  G 
Sbjct: 88  KVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKGSENLCTH-GGFIGLGVISGG- 145

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
             F  Q      H +                        L+   L+     T +  A K 
Sbjct: 146 --FAEQVAVSEHHIIPVPK-----------------EIPLDVAALVEPLSVTWH--AVKI 184

Query: 193 ANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSD 252
           +  +KG +  V GAG +GL  I   K  GA +I++ ++ +++ +     G   F NP   
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRIEMAKNLGVEVF-NPS-- 241

Query: 253 LKDGQTIVEKLIEMTDG--GLDYTFDCTGNTKVMRDALEAC-HKGWGTSVII 301
            K GQ  +E L  +T    G DY++DC+G       +L+A   KG  T++ +
Sbjct: 242 -KHGQKSIEVLRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAV 292

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 122/290 (42%), Gaps = 44/290 (15%)

Query: 25  LTVEEITV-EAPRAHEVRIKIEYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGI 77
           +TV++  V E    H V++ I+ T +C +D   YT   +   G F    P +LGHE +GI
Sbjct: 15  ITVDKRDVPEIKDPHYVKLHIKATGICGSDVHYYTQGAI---GQFVVKSPMVLGHESSGI 71

Query: 78  VESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKN 137
           V  VG  VTNVK GD V        +      SG  NLC  +          DGT     
Sbjct: 72  VAEVGSAVTNVKVGDRVAIEPGIPSRYSDETMSGNYNLCPHMVFAATPPY--DGT----- 124

Query: 138 QKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICL---LGCGVTTGYGAATKTAN 194
                          ++Y                 E   L   +  GV      A K A 
Sbjct: 125 --------------LTKYYLAPEDFVYKMPDHLSFEEGALAEPMSVGVH-----ANKLAG 165

Query: 195 VQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLK 254
            + G  V V GAG VGL     A+  GA+ ++ VDI ++K +   +FGAT  ++  S   
Sbjct: 166 TRFGSKVLVSGAGPVGLLAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSSS--- 222

Query: 255 DGQTIVEKLIEMTDGGL-DYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
           D +  V ++ ++  G L +   +C+G    +R  ++AC K  G  V +G+
Sbjct: 223 DEERFVSEVSKVLGGDLPNIVLECSGAQPAIRCGVKAC-KAGGHYVQVGM 271

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 95/228 (41%), Gaps = 39/228 (17%)

Query: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAEC--------------QKCKFCKSG 111
            P  +GHE +GIV  VG  VTN+K GDHV+   T  C               +C  C+ G
Sbjct: 67  LPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAECAACQRG 126

Query: 112 KTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXX 171
             N C+ +    G GV   G                    F++                 
Sbjct: 127 FYNCCAHL-GFMGLGVHSGG--------------------FAEKVVVSEKHVVKIPNTLP 165

Query: 172 LESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDIN 231
           L+   L+     + +  A + + +QKG +  V GAG +GL+ I   +  GAS+I++ +  
Sbjct: 166 LDVAALVEPISVSWH--AVRISKLQKGQSALVLGAGPIGLATILALQGHGASKIVVSEPA 223

Query: 232 DQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTG 279
           + +R    + G   F +P    +D   I++KL    + G D+ +DC+G
Sbjct: 224 EIRRNQAAKLGVETF-DPSEHKEDAVNILKKLAPGGE-GFDFAYDCSG 269

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 119/310 (38%), Gaps = 69/310 (22%)

Query: 16  AVAYEAGKPLTVEEITVEAPRAHE--VRIKIEYTAVCHTD----------------AYTL 57
           A+AY   K +   +   +   +HE  V I + +  VC +D                 + +
Sbjct: 3   ALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTHAM 62

Query: 58  SGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQK------------- 104
           SG       P  +GHE +GIV  VG  V+ VK GDHV+      C+              
Sbjct: 63  SG----QGLPQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHEREG 118

Query: 105 -CKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCST--FSQYTXXXXX 161
            C  CK+G  N C+ +                           +GC +  F++       
Sbjct: 119 LCIACKTGNPNCCTDLGFCG-----------------------LGCQSGGFAEKIVLSER 155

Query: 162 XXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRG 221
                     L+   L+     + +  A + + +Q G T  V GAG +GL+ +   +  G
Sbjct: 156 NVVKIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLALQSHG 213

Query: 222 ASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDG--GLDYTFDCTG 279
           A  II+ +  D +R+     GA  F NP    + G  ++E L ++  G  G ++++DC G
Sbjct: 214 AGTIIVSEPADTRRQKAEALGAQTF-NPT---EHGDNVIEALRKLAPGGEGFNFSYDCCG 269

Query: 280 NTKVMRDALE 289
            ++     L 
Sbjct: 270 TSETFSAGLH 279

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 106/277 (38%), Gaps = 52/277 (18%)

Query: 39  EVRIKIEYTAVCHTDAYTLS----------GVDPEGA--FPSILGHEGAGIVESVGEGVT 86
           EV I++ +  +C TD +  S          G  P      P  +GHE +GIV  +G  VT
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 87  NVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
            VK GDHV+      C              + C  C+ G  N+C+    T G G    G 
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT-GLGTSGGG- 145

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                              F++                 L+   L+     T + A  K 
Sbjct: 146 -------------------FAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KV 184

Query: 193 ANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSD 252
           A  QKG T  V GAG +GL+ I   K  GAS+I++ ++   +R      G   F NP ++
Sbjct: 185 AGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NP-AE 242

Query: 253 LKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALE 289
            KD    + K+ E    G D  FDC+G       AL 
Sbjct: 243 HKDAIAELRKIPEGAT-GFDAAFDCSGVKATFNTALH 278

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 112/280 (40%), Gaps = 55/280 (19%)

Query: 39  EVRIKIEYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEGAGIVESVGEGVT 86
           EV + + +  +C +D +  S      P+            P  +GHE +GI+  VG  VT
Sbjct: 28  EVILDVSWCGICGSDLHEYSDGPIFMPKDGECHSLSNAGLPQAMGHEMSGIIAKVGPKVT 87

Query: 87  NVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
            VK GDHV+    + C              + C  CK G  NLC+      G GV+  G 
Sbjct: 88  KVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKGCENLCTHA-GFIGLGVISGG- 145

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                              F++                 L+   L+     T +  A + 
Sbjct: 146 -------------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVRL 184

Query: 193 ANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSD 252
           +  +KG +  V GAG +GL  I   K  GA +I++ ++ +++ +     G   F +P+  
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVAERRMELARRLGVEIF-DPR-- 241

Query: 253 LKDGQTIVEKLIEMTDG--GLDYTFDCTGNTKVMRDALEA 290
            K G+  VE L  +T    G DY++DC+G       +L+A
Sbjct: 242 -KHGEKSVESLRALTKSHDGFDYSYDCSGIQATFDASLKA 280

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 116/287 (40%), Gaps = 69/287 (24%)

Query: 27  VEEITVEAPRAHEVRIKIEYTAVCHTD----------------AYTLSGVDPEGAFPSIL 70
           + E T++A  + +V+I I +  VC +D                 + +SGV      P  +
Sbjct: 18  LPEPTIQA--SDDVQIAISWCGVCGSDLHEYLDGPIFFPKDGEKHAMSGV----GLPQAM 71

Query: 71  GHEGAGIVESVGEGVTNVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLC 116
           GHE +G+V  +G GV N+K GDHV+   T  C              ++C  CK    N C
Sbjct: 72  GHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVKHASDEECAACKKDFYNCC 131

Query: 117 SSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCST--FSQYTXXXXXXXXXXXXXXXLES 174
           S +                           +GC +  F++                 L+ 
Sbjct: 132 SELGFCG-----------------------LGCHSGGFAEKVVISEKHVVKVPKDIPLDV 168

Query: 175 ICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQK 234
             L+     + +  A + + ++ G +  + GAG +GL+ +   +  GA  I++ + +  +
Sbjct: 169 AALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVVSEPSASR 226

Query: 235 RKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDG--GLDYTFDCTG 279
           RK     GA  F NP      G   V++L ++  G  G D+++DC+G
Sbjct: 227 RKQAEALGALTF-NP---FDHGDKAVDELRKIPPGSDGFDFSYDCSG 269

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 85/366 (23%), Positives = 143/366 (39%), Gaps = 69/366 (18%)

Query: 39  EVRIKIEYTAVCHTDAYT----------------LSGVDPEGAFPSILGHEGAGIVESVG 82
           E+ ++I Y  +C TD +                 LSG       P  +GHE AG V  +G
Sbjct: 28  ELILEINYCGICGTDLHEYIDGPIFFPEDGETNELSG----SGLPQAMGHEIAGTVVKIG 83

Query: 83  EGVTNVKPGDHVIALYTAECQK--------------CKFCKSGKTNLCSSVRATQGKGVM 128
             VT  K GDHV+      C+               C  CK G  N+CS++    G GV 
Sbjct: 84  PKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNKPWCSACKKGHYNVCSNL-GLIGNGV- 141

Query: 129 PDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGA 188
                    Q G       GC+   +                 ++   L+     + +  
Sbjct: 142 ---------QSG-------GCA---ERMCINESHCFKVPKDMPMDIAALIQPIAVSWH-- 180

Query: 189 ATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFIN 248
           A K A  ++G +V V G G +GL  +   +  G S I++ +    +R+     GAT +  
Sbjct: 181 AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCSDIVVSEPAKVRRELAERMGATTYDP 240

Query: 249 PKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEE 308
            + + +     + K+I   D G DY FD +G  + +  A+E C    GT+V + +    +
Sbjct: 241 SQHNTEKNIQNLRKMILGGD-GFDYVFDNSGTPETLETAIE-CLTVRGTAVNVAMWPPHK 298

Query: 309 EISTRPFQLVT-GRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVD---EFITNERPFTEI 364
            +   P  +    +++ GS       + +  G+I+ +++G +  D     IT + P   I
Sbjct: 299 RVEFSPMAVTKEEKIYTGSM---CYTQFDFEGVIDAFERGLIDKDIARHMITAKVP---I 352

Query: 365 NKAFED 370
               ED
Sbjct: 353 EDGLED 358

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 89/318 (27%), Positives = 125/318 (39%), Gaps = 78/318 (24%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALY 98
           EV IK  YT V + ++Y   G+ P    P +LG E  G V ++G+ V ++K GD V   Y
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYP-AELPYVLGREAVGTVVAIGKSVRDLKVGDKVS--Y 93

Query: 99  TAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXX 158
            A     +F K   +              +PD TS       E+LK              
Sbjct: 94  IAGATFAQFTKVPNSTHVFK---------LPDTTST------EQLK-------------- 124

Query: 159 XXXXXXXXXXXXXLESICLLGCGVTTGYGAAT---KTANVQKGDTVAVFGA-GTVGLSVI 214
                             L   G+  G  A T   +  +V+KGD V ++ A G VGL   
Sbjct: 125 ------------------LYAAGMIQGLTALTFVNEAYDVKKGDYVLLYAAAGGVGLIFN 166

Query: 215 QGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDG-GLDY 273
           Q  ++RGA  I +   N +K     E GA   IN K D      I+EK+ ++T G G+D 
Sbjct: 167 QLLRMRGAHTIAVASTN-EKLSLAKENGAEFLINSKED-----NILEKVQQITKGNGVDV 220

Query: 274 TFDCTGNTKVMRDALE---ACHKGWGTSVIIGVAAAEEEISTRPFQLV-----TGRVWKG 325
            FD  G     +D  E   +C K  GT V  G A+        PF L        R+ + 
Sbjct: 221 AFDSVG-----KDTFETTLSCLKRKGTFVSYGNASG----PVPPFPLSRLSPKNIRLLRP 271

Query: 326 SAFGGIKGRSEMGGLIED 343
             FG +    E     E+
Sbjct: 272 QLFGYVAQADEFRHYTEE 289

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 114/258 (44%), Gaps = 57/258 (22%)

Query: 25  LTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEG 84
           +  E+  V +    E+ IK +YT V + ++Y   G+ P    P +LG E +G V + G+G
Sbjct: 23  IKYEDYPVPSISEEELLIKNKYTGVNYIESYFRKGIYPCEK-PYVLGREASGTVVAKGKG 81

Query: 85  VTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGV-MPDGTSRFKNQKGEEL 143
           VTN + GD V     A      F +  K        ++QG  + +P GTS       EEL
Sbjct: 82  VTNFEVGDQV-----AYISNSTFAQYSKI-------SSQGPVMKLPKGTS------DEEL 123

Query: 144 KHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAV 203
           K                           L +  LL   V T      +  +V+KGD V +
Sbjct: 124 K---------------------------LYAAGLLQ--VLTALSFTNEAYHVKKGDYVLL 154

Query: 204 FGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEK 262
           F A G VGL + Q  K++GA   I V   D+K K   E+GA   IN        + I+ +
Sbjct: 155 FAAAGGVGLILNQLLKMKGA-HTIAVASTDEKLKIAKEYGAEYLINASK-----EDILRQ 208

Query: 263 LIEMTDG-GLDYTFDCTG 279
           +++ T+G G+D +FD  G
Sbjct: 209 VLKFTNGKGVDASFDSVG 226

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 84/355 (23%), Positives = 137/355 (38%), Gaps = 62/355 (17%)

Query: 27  VEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEG 74
           ++E  + AP   E+ I IE+  +C TD +  +      PE            P  +GHE 
Sbjct: 18  LKEPHIVAPD--ELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEM 75

Query: 75  AGIVESVGEGVTNVKPGDHVIALYTAECQK--------------CKFCKSGKTNLCSSVR 120
           AG V  VG GV N+K GD V+   T  C+               C  CK G  N+CS + 
Sbjct: 76  AGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKGYYNICSYL- 134

Query: 121 ATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGC 180
              G GV   G                    F++                 L+   L+  
Sbjct: 135 GLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVPLDVAALIQP 174

Query: 181 GVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNE 240
                +  A +    + G T  + GAG +GL  I      G   I++ +    +R+   +
Sbjct: 175 LAVCWH--AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEK 232

Query: 241 FGATDFINPKSDLKDGQTIVEKLIEMTDG--GLDYTFDCTGNTKVMRDALEACHKGWGTS 298
            GA  + +P +     +  ++ L  + DG  G DYTFDC+G    +  A++ C    GT+
Sbjct: 233 MGARVY-DPTA--HAAKESIDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQ-CLTFRGTA 288

Query: 299 VIIGVAAAEEEISTRPFQL-VTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVD 352
           V + +     +I   P  + +  R + GS         +   +IE  ++G + +D
Sbjct: 289 VNLAM-WGHHKIQFSPMDITLHERKYTGSM---CYTHHDFEAVIEALEEGRIDID 339

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 121/296 (40%), Gaps = 60/296 (20%)

Query: 26  TVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSG----------VDPEG--AFPSILGHE 73
           T+ E  + +P   EV I++ Y  +C TD +  +            +P      P  +GHE
Sbjct: 17  TLPEPKINSPD--EVLIEVSYCGICGTDLHEYTDGPIFFPKDGETNPLSNIPLPQPMGHE 74

Query: 74  GAGIVESVGEGVTNVKPGDHVIALYTAECQK-----------------CKFCKSGKTNLC 116
            +G V+++G  VT V+ GD V+      C+                  C  C++G  N C
Sbjct: 75  FSGFVKAIGSNVTKVEVGDKVVVEAGCGCKDVHRWPDSKLYEKRKDTFCSACENGIDNCC 134

Query: 117 SSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESIC 176
            +   T G GV+  G    +   GE  +H +                        +E I 
Sbjct: 135 ENYDFT-GLGVV-GGAFAERVVVGE--RHIVKLPE-----------EVPTDVGALVEPIS 179

Query: 177 LLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRK 236
           +           A + +  +KG +  + GAG +GL+ I   K  GAS+I++ ++ +++R 
Sbjct: 180 VAW--------HAVRVSKFEKGKSALILGAGPIGLAAILALKAHGASKIVVSELAERRRI 231

Query: 237 YGNEFGATDFINPKSDLKDGQTIVEKLIEMTDG--GLDYTFDCTGNTKVMRDALEA 290
             ++ G   F +P    K G   V +L  +  G  G DY FDC+G       AL+A
Sbjct: 232 LASKMGVEVF-DPS---KHGDNAVTELRNIPRGQHGFDYAFDCSGVKATFNTALKA 283

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 108/280 (38%), Gaps = 54/280 (19%)

Query: 39  EVRIKIEYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEGAGIVESVGEGVT 86
           ++ I I +  +C TD +  +      PE            P  +GHE AG+V  +G GV 
Sbjct: 28  DLIIDIAWCGICGTDLHEYTDGPIFFPEDGHTHDISGNGLPQAMGHEMAGVVSKIGPGVQ 87

Query: 87  NVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
             + GDHV+   T+ C              + C  CK G  N+CS +    G GV   G 
Sbjct: 88  GFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRGLYNICSHL-GLCGVGVQSGG- 145

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                              FS+                 L+   L+     + +  A + 
Sbjct: 146 -------------------FSERVVMNQKHVIKIPKHIPLDVAALVQPLAVSWH--AIRI 184

Query: 193 ANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSD 252
           + +  G +  V G G +GL  I   +  GAS+I++ +    +R+     GA  F +P   
Sbjct: 185 SGLTAGKSALVVGGGPIGLGTILALQAYGASKIVVSEPAKNRRELAKLMGAEVF-DPTE- 242

Query: 253 LKDGQTIVEKLIEMTDG--GLDYTFDCTGNTKVMRDALEA 290
             +    VE L ++  G  G DY+FDC+G     R ++ A
Sbjct: 243 -WEEHEAVEYLRKVAPGGDGFDYSFDCSGLPVTFRASVHA 281

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 111/286 (38%), Gaps = 64/286 (22%)

Query: 38  HEVRIKIEYTAVCHTDAYT----------------LSGVDPEGAFPSILGHEGAGIVESV 81
           +E+ I I +  +C +D +                 +SG+      P  +GHE +GIV  V
Sbjct: 27  NELEIDISWCGICGSDLHEYLDGPIFFPEEGKTHGVSGI----GLPQPMGHEMSGIVSKV 82

Query: 82  GEGVT-NVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVRATQGKG 126
           G GV  + K GDHV+   T  C                C  CK G  N C+ +    G G
Sbjct: 83  GPGVKGDYKVGDHVVVEATCTCLDRYRWPKIESSKLPPCSACKRGIYNCCTHL-GFCGLG 141

Query: 127 VMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGY 186
               G                    FS+                 L+   L+     + +
Sbjct: 142 AHGGG--------------------FSEKVVISEQHVIKIPKEIPLDIAALVEPISVSWH 181

Query: 187 GAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDF 246
             A K +N++ G +  V GAG +GL+ I   +  GA +I++ +    +R+   + G   F
Sbjct: 182 --AVKISNLKPGQSALVLGAGPIGLATILALQGHGAGKIVVSEPAQIRREQAAKLGVETF 239

Query: 247 INPKSDLKDGQTIVEKLIEMTDG--GLDYTFDCTGNTKVMRDALEA 290
            NP    + G+  VE+L ++  G  G D++FDC+G        L A
Sbjct: 240 -NP---FEHGEKAVEELRKIPPGGDGFDFSFDCSGMKATFDTGLHA 281

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 103/386 (26%), Positives = 158/386 (40%), Gaps = 60/386 (15%)

Query: 16  AVAYEAGKPLTVEEITV-EAPRAHEVRIKIEYTAVCHTDA--YTLSGVDPEGAF----PS 68
           AV  +    +T E+I   E   +H V+I ++ T +C +D   YT   +   G F    P 
Sbjct: 7   AVVLQKKGEITFEDIPAPEITDSHYVKIHVKKTGICGSDIHYYTHGSI---GEFVVKKPM 63

Query: 69  ILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVM 128
           +LGHE +G+V  VG+ VT V+ GD V        +     KSG  NLC  +         
Sbjct: 64  VLGHESSGVVVEVGKDVTLVQVGDRVAIEPGVPSRYSDETKSGHYNLCPHMAFAATPPY- 122

Query: 129 PDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICL--LGCGVTTGY 186
            DGT          +K+++    F                    E  C   L  GV    
Sbjct: 123 -DGTL---------VKYYLAPEDF---------LVKLPDHVSFEEGACAEPLAVGV---- 159

Query: 187 GAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDF 246
             A + A    G  V VFGAG VGL     A   GAS ++ VD+ + K +   +FGAT+ 
Sbjct: 160 -HANRLAETSFGKNVVVFGAGPVGLVTGAVAAAFGASAVVYVDVFENKLERSKDFGATNT 218

Query: 247 INP-KSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           IN  K   +D  T V K  E+     +   DC+G    +R A++   K  G+ V +G+  
Sbjct: 219 INSTKYKSEDELTEVIKS-ELKGEQPEIAIDCSGAEICIRTAIKVL-KAGGSYVQVGMG- 275

Query: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYK-------KGTLKVDEFITNE 358
             ++    P  ++  +  +    G  +          DYK       +G + V + IT+ 
Sbjct: 276 --KDNINFPIAMIGAKELR--VLGSFR------YYFNDYKIAVKLISEGKVNVKKMITHT 325

Query: 359 RPFTEINKA--FEDLHAGDCLRTVLD 382
             F E   A  F   H  + ++T++D
Sbjct: 326 FKFEEAIDAYNFNLEHGSEVVKTMID 351

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 111/303 (36%), Gaps = 53/303 (17%)

Query: 27  VEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEG 74
           +EE  + AP   E+ + I +  +C TD +  +      PE            P  +GHE 
Sbjct: 18  LEEPRIVAPD--ELVLDIAWCGICGTDLHEYTDGPIFFPEDGHTNEISHNPLPQAMGHEM 75

Query: 75  AGIVESVGEGVTNVKPGDHVIALYTAECQK--------------CKFCKSGKTNLCSSVR 120
           AG V  VG GVT  K GD V+   T  C+               C  CK G  N+CS + 
Sbjct: 76  AGTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRGLYNICSYL- 134

Query: 121 ATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGC 180
              G GV   G                    F++                 L+   L+  
Sbjct: 135 GLCGAGVQSGG--------------------FAERVVINESHCYKVPEFVPLDVAALIQP 174

Query: 181 GVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNE 240
                +  A    + + G T  + GAG +GL  I      G S I + +    +R+   +
Sbjct: 175 LAVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPAKVRRELAEK 232

Query: 241 FGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVI 300
            GA  F       KD    +  +    D G DYTFDC+G  +V  +A   C    GT+V 
Sbjct: 233 MGARVFDPTAHAAKDSIDYLRSVAPGGD-GYDYTFDCSG-LEVTLNASVQCLTFRGTAVN 290

Query: 301 IGV 303
           + +
Sbjct: 291 LAM 293

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 86/363 (23%), Positives = 135/363 (37%), Gaps = 53/363 (14%)

Query: 23  KPLTVEEITVEAPRA---HEVRIKIEYTAVCHTDAYTLS---GVDPEGAFPS-------I 69
           K     ++T   P+A   H+V I++E   +C ++ + L    G  P     S       +
Sbjct: 16  KDWATPKLTSFEPKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYGPKTQV 75

Query: 70  LGHEGAGIVESVGEGVTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVM 128
           +GHE  G V +VG  V+    GD V +    + C +C  C SG    C +  +T  K   
Sbjct: 76  VGHEVVGKVVAVGPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTYCKP-Y 134

Query: 129 PDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGA 188
           PDG   + +Q G           ++ +                 E +  L CG  T +  
Sbjct: 135 PDG---YVSQGG-----------YASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSP 180

Query: 189 ATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFIN 248
             +    +    VAV G G +G   I  A+  GA  +        KR    + GA  F+ 
Sbjct: 181 IKRNLQGKHDPKVAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGAHHFVA 239

Query: 249 P-KSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMR-DALEACHKGWGTSVIIGVAAA 306
              +D   G           D   D   +C  +T  +  +A+  C K     V +G+   
Sbjct: 240 TGDADWNAG----------LDDTFDLILNCASSTSSLDLNAMLPCLKVNCNFVSVGLPHI 289

Query: 307 EEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINK 366
           +EE+S +PF             G   G S++G   E  +   L V+    N RP+ E  K
Sbjct: 290 DEELSVKPFSFFKN--------GCNIGSSKLGSRSEAIELMQLAVEH---NFRPWVETIK 338

Query: 367 AFE 369
             E
Sbjct: 339 VSE 341

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 113/303 (37%), Gaps = 53/303 (17%)

Query: 27  VEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEG 74
           ++E  + AP   E+ I I +  +C TD +  +      PE            P  +GHE 
Sbjct: 18  LKEPQIVAPD--ELVIDIAWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEM 75

Query: 75  AGIVESVGEGVTNVKPGDHVIALYTAECQK--------------CKFCKSGKTNLCSSVR 120
           AG V  VG GV ++K GD V+   T  C+               C  CK G  N+CS + 
Sbjct: 76  AGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKGYYNICSYL- 134

Query: 121 ATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGC 180
              G GV   G                    F++                 L+   L+  
Sbjct: 135 GLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVPLDVAALIQP 174

Query: 181 GVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNE 240
                +  A      + G T  + GAG +GL  I      G   I++ +    +R+   +
Sbjct: 175 LAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPAKLRRELAEK 232

Query: 241 FGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVI 300
            GA  +   +   K+    +  + E  D G DYTFDC+G    +  A++ C    GT+V 
Sbjct: 233 MGARVYDPTEHAAKESIDYLRSIAEGGD-GFDYTFDCSGLEITLNAAIQ-CLTFRGTAVN 290

Query: 301 IGV 303
           + +
Sbjct: 291 LAM 293

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 86/340 (25%), Positives = 136/340 (40%), Gaps = 86/340 (25%)

Query: 28  EEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN 87
           E+  V +    ++ IK +YT V + ++Y   G+ P    P ILG E AG + + G+ VTN
Sbjct: 26  EDYPVPSISGKDLLIKNKYTGVNYIESYFRKGLYPCEK-PYILGREAAGTIVAKGKDVTN 84

Query: 88  VKPGDHVIALYTAE-CQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHF 146
            + GD V  +  +   Q  KF   G     S                  K    EELK +
Sbjct: 85  FEIGDKVAYISNSTFAQYTKFPSEGTVMKLS------------------KETNDEELKLY 126

Query: 147 MGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVF-G 205
                                    L+++  L            +  +V+KGD + +F  
Sbjct: 127 AAG---------------------LLQALTALSF--------TNEAYHVRKGDYILLFAA 157

Query: 206 AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIE 265
           AG VGL + Q  +++GA  I +    D+K +   E+GA   IN        + I++K++E
Sbjct: 158 AGGVGLILNQLLRMKGAHAIAVAS-TDEKLEIAKEYGAEYLINSSK-----EDILKKVLE 211

Query: 266 MTDG-GLDYTFDCTGNTKVMRDALE---ACHKGWGTSVIIGVAA------AEEEISTRPF 315
           +T+G G+D +FD  G     +D  E   A  K  G  V  G A+      +   +S +  
Sbjct: 212 ITNGEGVDASFDSVG-----KDTFEITLAALKRKGVFVSFGNASGLIPPFSINRLSPKNI 266

Query: 316 QLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFI 355
            LV               R ++ G I D K+     DEF+
Sbjct: 267 TLV---------------RPQLYGYIADLKEWKSYTDEFV 291

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 114/304 (37%), Gaps = 53/304 (17%)

Query: 26  TVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSG---VDPE---------GAFPSILGHE 73
           +++E  + AP   E+ I I +  +C TD +  +      PE            P  +GHE
Sbjct: 17  SLKEPRIVAPD--ELVIDIAWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHE 74

Query: 74  GAGIVESVGEGVTNVKPGDHVIALYTAECQK--------------CKFCKSGKTNLCSSV 119
            AG V  VG GV ++K GD V+   T  C+               C  CK G  N+CS +
Sbjct: 75  MAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKGYYNICSYL 134

Query: 120 RATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLG 179
               G GV   G                    F++                 L+   L+ 
Sbjct: 135 -GLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVPLDVAALIQ 173

Query: 180 CGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGN 239
                 +  A      + G T  + GAG +GL  I      G   I++ +    +R+   
Sbjct: 174 PLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPAKLRRELAE 231

Query: 240 EFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSV 299
           + GA  +   +   ++    +  + E  D G DYTFDC+G    +  A++ C    GT+V
Sbjct: 232 KMGARVYDPTEHAARESIDYLRSVAEGGD-GFDYTFDCSGLEVTLNAAIQ-CLTFRGTAV 289

Query: 300 IIGV 303
            + +
Sbjct: 290 NLAM 293

>SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 348

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 94/353 (26%), Positives = 137/353 (38%), Gaps = 66/353 (18%)

Query: 28  EEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN 87
           E+  V    A EV IK +++ +   ++Y   G+ P    P +LG E AG V + G+ V+ 
Sbjct: 40  EDFPVPNINADEVLIKNKFSGINFIESYFRKGLYPSQK-PYVLGREAAGTVVAKGDAVSK 98

Query: 88  VKPGDHVIALYTAE-CQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHF 146
              GD V  L      Q  K+ ++GK               +P  T+       E+LK +
Sbjct: 99  FNIGDKVAYLSPGTFAQYTKYPENGKIL------------KLPKETT------DEQLKFY 140

Query: 147 MGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGA 206
            G                             L  G+T          +V+KGD + ++ A
Sbjct: 141 AGS----------------------------LVQGLT-ALTFVNDAYDVKKGDYILLYAA 171

Query: 207 -GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIE 265
            G  GL   Q  K++GA   I V   D+K K   E+GA   IN   D       + K++E
Sbjct: 172 AGGAGLIFNQLLKLKGA-HTIAVASTDEKLKLAREYGAEYVINSSKD-----DTLSKVLE 225

Query: 266 MTDG-GLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAE-EEISTRPFQLVTGRVW 323
           +T+G G+   FD  G       +L+A  +  GT V  G A+      S         +V 
Sbjct: 226 ITNGEGVAAAFDSIGK-DTFEISLQAIKRK-GTLVSFGNASGPVPPFSINRLSSKNLKVL 283

Query: 324 KGSAFGGIKGRSEMG----GLIEDYKKGTLKVDEFITNERPFTEINKAFEDLH 372
           +   FG I    E       LIE    G LKV  FI+   P +E   A E L 
Sbjct: 284 RPQVFGYITTSEEWNHYASKLIELLSSGDLKV--FISGTYPLSEYRAATEALE 334

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 85/342 (24%), Positives = 132/342 (38%), Gaps = 62/342 (18%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIAL 97
           +E+ IK +YT +   ++Y   G+ P    P +LG E +G V + G+ V+     D V   
Sbjct: 47  NEILIKNKYTGINFIESYFRKGIYPSQK-PYVLGREASGTVVAKGKAVSKFNLADKVA-- 103

Query: 98  YTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTX 157
           Y +     ++ K  +T   S          +P+ T+                        
Sbjct: 104 YLSAGTFAQYTKIAETGHISK---------LPENTT------------------------ 130

Query: 158 XXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGA-GTVGLSVIQG 216
                         LE        V T    A +   V+KGD V ++ A G VGL+  Q 
Sbjct: 131 -----------DKQLELYAASLVQVLTALTFAKEAYTVKKGDFVLLYAAAGGVGLAFNQI 179

Query: 217 AKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDG-GLDYTF 275
            K  GA   I V   D+K +   EFGA   +N        + ++ +++E+T G G+D  +
Sbjct: 180 LKRLGA-HTIAVASTDEKLQLAKEFGAEYLVN-----SSKEDVLARVLEITQGQGVDVAY 233

Query: 276 DCTGNTKVMRDALEACHKGWGTSVIIGVAAAE-EEISTRPFQLVTGRVWKGSAFGGIKGR 334
           D  G        L A  +  GT V  G A+     I+         ++ + + FG I  +
Sbjct: 234 DSIGK-DTFETTLSALRRK-GTFVSFGNASGPVPPIAISRLSPKNIKILRPTLFGYIASQ 291

Query: 335 SEMGGLIEDYKKGTLKVDEF---ITNERPFTEINKAFEDLHA 373
            E     E+  K  L  +EF   IT   P  E  KA E+L A
Sbjct: 292 EEWAYYSEELIK-LLHSEEFKVLITKIYPLEEYRKATEELEA 332

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 109/275 (39%), Gaps = 41/275 (14%)

Query: 39  EVRIKIEYTAVCHTDAYTLS------------GVDPEGAFPSILGHEGAGIVESVGEGVT 86
           E+ + + +  +C TD +  +             V    + P  +GHE +G V  VG  VT
Sbjct: 28  ELIVDVAFCGICGTDLHEYTDGPIFMPKDGEKNVLSNKSIPQAMGHEFSGYVAKVGPKVT 87

Query: 87  NVKPGDHVIALYTAEC---QKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEEL 143
            VK GD V+   T  C    +    K  KT  C++ +             R  N    E 
Sbjct: 88  KVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACK------------DRCDNCC--EY 133

Query: 144 KHFMGCST----FSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGD 199
             FMG       F++                 ++   L+   ++  + AA + +    G 
Sbjct: 134 AGFMGLGVVGGAFAERIVTIEHHVVKLPDGFPMDVAALIE-PLSVAWHAA-RVSKFPPGK 191

Query: 200 TVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTI 259
           +  V GAG +GL++I   K +GAS+II+ +    +R+  +      F +P +    G   
Sbjct: 192 SALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRMHVETF-DPST---HGDKS 247

Query: 260 VEKLIEMT-DG-GLDYTFDCTGNTKVMRDALEACH 292
           V  L   T DG G D+ FDC+G        L+A H
Sbjct: 248 VAMLRSKTFDGKGFDFAFDCSGVPATFNTGLQAAH 282

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 78/319 (24%), Positives = 128/319 (40%), Gaps = 57/319 (17%)

Query: 27  VEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFP--------------SILGH 72
           + E  +E P   +V I I +  +C TD + L  +D    FP                +GH
Sbjct: 18  LPEPVIEKP--DDVLIDIVWCGICGTDLHEL--LDGPNFFPKDGETHEISGRGLPQAMGH 73

Query: 73  EGAGIVESVGEGVTNVKPGDHVIALYTAECQK----------CKFCKSGKTNLCSSVRAT 122
           E AG+V  VG  VT  +PGDHV+   T  CQ           CK CK G  N+C  +   
Sbjct: 74  EMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCKACKRGMHNVCVHL-GL 132

Query: 123 QGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGV 182
            G GV   G +  K   GE  KH     ++                     ++C      
Sbjct: 133 CGCGVQSGGFAE-KVVIGE--KHCFKVPSWIPLDVAALIQPL---------AVCW----- 175

Query: 183 TTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFG 242
                 A K   V++G +  + G G +GL +I   +  G + I++ +    +R    + G
Sbjct: 176 -----HAVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIVVSEPAKIRRDLAEKMG 230

Query: 243 ATDFINPKSDLKDGQTIVEKLIEMTDG--GLDYTFDCTGNTKVMRDALEACHKGWGTSVI 300
           A   ++   D K  +  ++ L  ++    G D+TFDC+G +     +++ C    GT++ 
Sbjct: 231 A--IVSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSGISVTFESSIK-CLTFRGTAIN 287

Query: 301 IGVAAAEEEISTRPFQLVT 319
           + V   +  +   P  L +
Sbjct: 288 VAV-WGDSSVKHYPMDLTS 305

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/315 (23%), Positives = 119/315 (37%), Gaps = 52/315 (16%)

Query: 39  EVRIKIEYTAVCHTDAYTLSG------VDPE------GAFPSILGHEGAGIVESVGEGVT 86
           E+ + I Y  +C TD + L+       +D E         P  +GHE AGIV +VG GV 
Sbjct: 28  ELLVDIVYCGICGTDLHELTDGPIFFPLDNERNEISGNGLPQAMGHEMAGIVTAVGSGVK 87

Query: 87  NVKPGDHVIALYTAECQK--------------CKFCKSGKTNLCSSVRATQGKGVMPDGT 132
             + GDHV    T  C+               C  C+ G  N C  +    G GV   G 
Sbjct: 88  KFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCTSCQRGMYNCCDYL-GLIGNGVQSGG- 145

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
             F  +      H   C     +                  ++C            A   
Sbjct: 146 --FAERIVVNESHCYKCPDNLPWEVAALIQPI---------AVCW----------HAINI 184

Query: 193 ANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSD 252
           A  + G +V + G G +GL  I      G + II+ +    +R Y  + GA  +   +  
Sbjct: 185 AQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRRDYAEKMGAVVYDPLQCS 244

Query: 253 LKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEIST 312
            +     + K+    D G DY FDC+G    ++ ++E C    GT+V + + A  + ++ 
Sbjct: 245 HEQSIPNLRKMAPGAD-GFDYCFDCSGTPATLKASIE-CLTFRGTAVNVAMWATNKAVNF 302

Query: 313 RPFQLVTG-RVWKGS 326
            P  +    +++ GS
Sbjct: 303 YPMDITKQEKIYTGS 317

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 117/293 (39%), Gaps = 55/293 (18%)

Query: 39  EVRIKIEYTAVCHTDA--YTLSGV--DPEGA--------FPSILGHEGAGIVESVGEGVT 86
           E+ I + Y  +C TD   YT   +   P+G          P  +GHE +G+VE VG+G  
Sbjct: 28  ELIIAVSYCGICGTDLKEYTEGAIFFPPDGGHNEISGNGLPQAMGHEISGVVEKVGKGCK 87

Query: 87  NVKPGDHVIALYTAECQK--------------CKFCKSGKTNLCSSVRATQGKGVMPDGT 132
             K GDHV+   T  C+               C  C  G TN+C+ + A  G G+   G 
Sbjct: 88  TFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIGMTNICAHL-ALCGAGLESGG- 145

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                              F++                 L+   L+       +  A K 
Sbjct: 146 -------------------FAERLVINEAHVHKIPDHMPLDIGALIQPISVCWH--AVKV 184

Query: 193 ANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSD 252
           A+ +KG +  + G G +GL  I   K  G   I+L +    +R+Y  + GA  + +P   
Sbjct: 185 AHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRREYAGKMGAKVY-DPTGV 243

Query: 253 LKDGQTIVEKLIEM--TDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303
             D    V+ L EM     G DYTFDC+G    +  A+E C    GT+V + V
Sbjct: 244 PFDES--VKTLREMGPNGDGFDYTFDCSGLPITLNAAIECC-TFRGTAVNVAV 293

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 87/347 (25%), Positives = 136/347 (39%), Gaps = 72/347 (20%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIAL 97
           +E+ IK +Y  +   +AY   G+ P    P ILG E  G+V + G+ V N   GD V   
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPV-QLPQILGREATGVVVAKGQSVKNFDIGDKVA-- 93

Query: 98  YTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTX 157
           Y +     ++ K   + L S          +P  T+       ++LK +           
Sbjct: 94  YMSSSTFAQYTKYSSSGLISK---------LPSETT------DDQLKVYAAA-------- 130

Query: 158 XXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVF-GAGTVGLSVIQG 216
                              + G    T    A K   V++GD + ++  AG VGL + Q 
Sbjct: 131 ------------------LIQGLTALTFLDEAYK---VKEGDYILLYAAAGGVGLLMDQL 169

Query: 217 AKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMT-DGGLDYTF 275
            K RGA  I +V   ++K +   +FGA   IN        + I+++ +E+T D G+D  F
Sbjct: 170 LKERGAHAIAVVS-TEEKEELAKKFGAEYVINSSK-----EDILKRALEITNDKGVDAVF 223

Query: 276 DCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLV-----TGRVWKGSAFGG 330
           D  G  K   D      K  G+ V  G A+        PF L        R+ + + FG 
Sbjct: 224 DSVG--KDTFDISLNALKLKGSFVSFGNASG----PVPPFALSRLSSKNIRLMRPTLFGY 277

Query: 331 IKGRSEMG----GLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
           +    +       L E    G LK+   IT   P +E   A ++L +
Sbjct: 278 LAEPEDWDHYSKKLFELIDSGKLKIA--ITKTYPLSEYKIATQELES 322

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 84/351 (23%), Positives = 128/351 (36%), Gaps = 58/351 (16%)

Query: 35  PRAHEVRIKIEYTAVCHTDAYTLSG---VDPEGAFPS-------ILGHEGAGIVESVGEG 84
           PR  +V I++E   +C ++ + L      +P     S       ++GHE  G V +VG  
Sbjct: 33  PR--DVDIEVECCGICASELFALKNDWTHEPLACLSSKYGPKTQVVGHEVVGKVVAVGPE 90

Query: 85  VTNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEEL 143
           V+  K GD V +    + C +C  C+S     C+    T      PDG   + +Q G   
Sbjct: 91  VSLCKVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCNP-YPDG---YVSQGG--- 143

Query: 144 KHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAV 203
                   ++ +                 E +  L CG  T +    +    +K   VA+
Sbjct: 144 --------YASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNIQGKKNPRVAI 195

Query: 204 FGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKL 263
            G G +G   I  +K  GA  +  V     KR    + GA  FI                
Sbjct: 196 IGIGGLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGADHFIATSE------------ 242

Query: 264 IEMTDGGLDYTFD----CTGNTKVMR-DALEACHKGWGTSVIIGVAAAEEEISTRPFQLV 318
               + GLD TFD    C  +T  +  +AL  C K     V +G+   +E+   +PF   
Sbjct: 243 -PNWNAGLDDTFDLILNCASSTSSLDLNALLPCLKVNCNFVSVGLPHIDEDFKVKPFSFF 301

Query: 319 TGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFE 369
                     G   G S++G   E  +   L V     N RP+ E  K  E
Sbjct: 302 HN--------GCNIGSSKLGSREEAIELMQLAVKH---NFRPWVETIKVSE 341

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 120/305 (39%), Gaps = 52/305 (17%)

Query: 39  EVRIKIEYTAVCHTDAYT-LSGV-----DPEG------AFPSILGHEGAGIVESVGEGVT 86
           E+ I + Y  +C +D +  L G      D E       + P  +GHE +GIV  VG+ VT
Sbjct: 28  EIIIDVSYCGICGSDLHEYLEGPIFMPKDNETNEISNLSLPLAMGHEMSGIVREVGKNVT 87

Query: 87  NVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
            VK GD V+   ++ C              +KC  C  G  N C+    T G G +  G 
Sbjct: 88  KVKKGDKVVVEASSACSDVHRFATGKHYGEEKCPNCARGYDNCCAYAGFT-GLGFIGGG- 145

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
                              F++                 L+   L+     T + A  K 
Sbjct: 146 -------------------FAEQILVGEQHIVRIPDEIPLDVAALVEPLSVTWHAA--KV 184

Query: 193 ANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSD 252
               KG T  + G+G +GL++I   K  GAS+I++ ++   +RK   +     F +P   
Sbjct: 185 GKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEVAQVRRKLAEKMKVEVF-DPSVH 243

Query: 253 LKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEIST 312
            K+    +  L E  D G D+ FDC+G    M  A+ A  K  GT V + V  +  E + 
Sbjct: 244 GKNTSNELRLLTENKD-GFDFAFDCSGLEVTMNTAIHAT-KCRGTIVNVAVWGSTMEFNM 301

Query: 313 RPFQL 317
               L
Sbjct: 302 MDITL 306

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 109/281 (38%), Gaps = 53/281 (18%)

Query: 39  EVRIKIEYTAVCHTDAYT-LSG---VDPEGA--------FPSILGHEGAGIVESVGEGVT 86
           E+ I + +  +C +D +  L G   +  +G+         P  +GHE  G V+++G  VT
Sbjct: 28  EILIDVAWCGICGSDLHEYLDGPIFMPQDGSTHPLSNQPLPQPMGHEFCGFVKAIGNKVT 87

Query: 87  NVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVRATQGKGVMPDGT 132
            V  GD V+      C              ++C  C+ G  N C+    T G GV+    
Sbjct: 88  KVAVGDKVVVEAGCGCKDVHRWPQSHVYGKEQCTACRKGFDNCCTHAGFT-GLGVV---G 143

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT 192
             F  Q     +H +                        +E + +           A K 
Sbjct: 144 GAFAEQVVVGERHVVKLPE-----------EVPTDVGALVEPLSVAW--------HAVKV 184

Query: 193 ANVQKGD--TVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPK 250
           A  +KG      V GAG +GL+ I   K  GAS+I++ ++   +R+   + G   F   K
Sbjct: 185 AGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSELAAIRRELALKMGVEVFDPSK 244

Query: 251 S-DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEA 290
             D K G   + ++ E  D G D+ FDC+G       AL +
Sbjct: 245 HGDEKQGIKKLREIPEDHD-GFDFAFDCSGVETTFNTALHS 284

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 132/340 (38%), Gaps = 33/340 (9%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN-VKPGDHV-IA 96
           ++ +KIE   VC +D +  SG   + A P I+GHE  G V  VG   T+ VK GD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 97  LYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYT 156
                C KCK C +G  + C +   T         ++ +++        ++    ++ Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYCPNAIQTY--------STPYEDG-------YVSKGGYADYV 139

Query: 157 XXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQG 216
                                L CG  T +    +      G  VA+ G G +G   +  
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 217 AKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFD 276
           AK  GA  +  +     K++   + GA  FI  K +    +   ++        LD    
Sbjct: 199 AKAMGA-EVYAISRTSSKKEDAMKLGADHFIATKEEPDWHEKYFDE--------LDLVVV 249

Query: 277 CTGN-TKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAFGGIKGRS 335
           C G+ T +  + L       G  V I +    E +  +PF LV G     S  G ++   
Sbjct: 250 CAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV-GVSIANSLLGSMEELK 308

Query: 336 EMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHAGD 375
           ++  L+ + K   + V+    +E+   E+   FE +  GD
Sbjct: 309 QLLKLVSE-KDIKIWVETVPISEKGVHEV---FERMDKGD 344

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 106/267 (39%), Gaps = 66/267 (24%)

Query: 19  YEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIV 78
           Y+  K   +   T++ P  +++ IK +Y  V + ++Y   G+ P  A P+ILG E +   
Sbjct: 35  YDVIKYKDIATPTIQTP--NDIIIKNKYAGVNYIESYFRKGIYP-CALPAILGREAS--- 88

Query: 79  ESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKN- 137
                                                          GV+ D  +  KN 
Sbjct: 89  -----------------------------------------------GVVVDKGTNIKNF 101

Query: 138 QKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGA---ATKTAN 194
           + G+++ +   CS  +Q+T                E + L   G+  G  A    T+   
Sbjct: 102 EIGDKVAYIGNCS-MAQFTKIDNSMIMKLSSDSTNEDLKLYAAGILQGLTALSFVTEAYE 160

Query: 195 VQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDL 253
           V+KGD + V+ A G  GL   Q  K RGA  +I V  +D+K +   E GA   IN K+D 
Sbjct: 161 VKKGDYILVYAAAGGAGLIFDQLIKARGA-HVIAVCSSDEKLQLAKENGAEYLINSKTD- 218

Query: 254 KDGQTIVEKLIEMTDG-GLDYTFDCTG 279
                I+ K++E+TD  G+   FD  G
Sbjct: 219 ----DILTKVMEITDNKGVQAAFDSVG 241

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 72/317 (22%), Positives = 120/317 (37%), Gaps = 54/317 (17%)

Query: 27  VEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSG---VDPEGA---------FPSILGHEG 74
           + E  + AP   E+ I I +  +C TD +         PE            P  +GHE 
Sbjct: 18  LPEPKITAP--DELIIDISWCGICGTDLHEFQDGPIFFPENGCCHEISGEGLPQAMGHEI 75

Query: 75  AGIVESVGEGVTNVKPGDHVIALYTAEC--------------QKCKFCKSGKTNLCSSVR 120
           AGIV  +G  V   + GD V+   T  C              ++C  CK G  N+CS++ 
Sbjct: 76  AGIVSEIGPKVKKFQVGDRVVVEPTGTCKDRYRWPDAPNANQEECAACKKGLYNICSNL- 134

Query: 121 ATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGC 180
              G GV   G                    F++                 ++   L+  
Sbjct: 135 GLVGCGVQSGG--------------------FAERMVMNEAKCYKIPEHLTMDVAALIQP 174

Query: 181 GVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNE 240
              + +  A + +  + G +V + G G +GL  I      G + +++ +    +R    +
Sbjct: 175 IAVSWH--AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVVVSEPAKIRRDLAEK 232

Query: 241 FGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVI 300
            GA  + +P +   D      + I     G DYTFDC+GN   ++ A+E C    GT+V 
Sbjct: 233 MGAVVY-DPMTRDHDESIKYLRSIAPGGDGFDYTFDCSGNPATLKAAIE-CLTFRGTAVN 290

Query: 301 IGVAAAEEEISTRPFQL 317
           + +   +  +S  P  L
Sbjct: 291 VAI-WGKNPVSFLPMDL 306

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 94/350 (26%), Positives = 134/350 (38%), Gaps = 49/350 (14%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN-VKPGDHV-I 95
           H++ IK+E   VC +D +  SG   +   P ++GHE  G V  +GE   + +K GD V +
Sbjct: 36  HDIEIKVECCGVCGSDIHAASGNWGDLTKPLVVGHEIIGTVVRLGENCNSGLKLGDRVGV 95

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQY 155
                 C  C+ CK+     C     T G+   PDG S     KG    +F     F+  
Sbjct: 96  GAQVFSCLDCERCKNDNEPYCEGFVTTYGQD-YPDGYS----SKGGYADYFRVHEHFAVP 150

Query: 156 TXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKT--ANVQKGDTVAVFGAGTVGLSV 213
                                 L CG  T Y    +      +K   V + G G  GL  
Sbjct: 151 IPENIPSHLAAP----------LMCGGLTVYSPLVRNGCGPNKKVGIVGIGGIGHQGLLF 200

Query: 214 IQ--GAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVE--KLIEMTDG 269
            +  GA+V   SR         K++   + GA  FI  K +   G    +   LI +   
Sbjct: 201 AKAMGAEVYAISR------TSAKKEDAMKLGADHFIATKEEPDWGTKYFDTFDLIVVCAS 254

Query: 270 GL-DYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAF 328
            L D  F+   NT           K  G+ V I V    E +S +PF L  G     SA 
Sbjct: 255 SLTDVDFNTVPNTM----------KIGGSIVSISVPEQNETLSLKPFGL-KGVSISNSAL 303

Query: 329 GGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE--INKAFEDLHAGDC 376
           G I   SEM  L++   +  +K+        P  E  + +AFE +  GDC
Sbjct: 304 GSI---SEMRDLLKLVSENNIKL---WVETIPIGEKGVKEAFERMDKGDC 347

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 112/308 (36%), Gaps = 45/308 (14%)

Query: 36  RAHEVRIKIEYTAVCHTDAYTLSGV---DPEGAFPS-------ILGHEGAGIVESVGEGV 85
            AH+V I++E   +C ++ ++L      +P     S       ++GHE  G V +VG  V
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 86  TNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELK 144
           T    GD V +      C KC  C SG    C     T          SR+ +       
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTY--------CSRYADG------ 139

Query: 145 HFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVF 204
            ++    ++ +                 E +  L CG  T Y    +     K   VA+ 
Sbjct: 140 -YISQGGYASHVRAHEQFCFPIPDDIPSELVAPLQCGGLTVYSPIKRNIEGVKDPKVAII 198

Query: 205 GAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLI 264
           G G +G   I  +K  GA  +        K++   + GA  FI        G+       
Sbjct: 199 GIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFI------ATGE------- 244

Query: 265 EMTDGGLDYTFDCTGN-----TKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVT 319
           E  + GL+ TFD   N     T +  + L  C K     + +G+   +E+   +PF   +
Sbjct: 245 EGWESGLNDTFDLILNCASSTTSLDLNKLLPCLKINRNFISVGLPHVDEDFKVKPFSFFS 304

Query: 320 GRVWKGSA 327
                GS+
Sbjct: 305 NGCCIGSS 312

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 82/190 (43%), Gaps = 23/190 (12%)

Query: 194 NVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSD 252
           NVQKGD + V+ A G VGL   Q  K RGA R I V   D+K +   E+GA   IN   D
Sbjct: 164 NVQKGDFILVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTKD 222

Query: 253 LKDGQTIVEKLIEMTDG-GLDYTFDCTGNTKVMRDALEACH---KGWGTSVIIGVAA-AE 307
                 IVEK+ E T+G G+   FD  G     +D  E      K  GT V  G A+ A 
Sbjct: 223 -----DIVEKVKEFTNGEGVAAAFDSIG-----KDTFETTLQVVKRKGTIVSFGNASGAV 272

Query: 308 EEISTRPFQLVTGRVWKGSAFGGIKGRSEM----GGLIEDYKKGTLKVDEFITNERPFTE 363
              S         ++ +   F  +   SE       LI     G LK+   I+   P  +
Sbjct: 273 PPFSINRLSPKNLKLVRPQLFAYVADPSEWEHYSSELIRLIDSGELKIT--ISKVYPLKD 330

Query: 364 INKAFEDLHA 373
             +A EDL +
Sbjct: 331 YKEATEDLES 340

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 37  AHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIA 96
           A ++ IK +Y  +   + Y   G+ P    P +LG E  G V + G+ V     GD V  
Sbjct: 54  ATDLLIKNKYAGINFIEVYFRKGIYPSEK-PYVLGREAVGEVVAKGDQVDKYNVGDKVAY 112

Query: 97  LYTAE-CQKCKFCKSG 111
           L  +   Q  K+ ++G
Sbjct: 113 LSASTFAQFTKYPQNG 128

>Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 116/286 (40%), Gaps = 67/286 (23%)

Query: 1   MSGAATEGKSITCVAAVA-YEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSG 59
           MSG   E + +  +  V  Y+  K    E+  V      ++ IK +Y  V + ++Y   G
Sbjct: 1   MSGTIPETQKVVLIDGVGGYDVIK---YEDYPVPLISDEDLLIKNKYAGVNYIESYFRKG 57

Query: 60  VDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIAL-YTAECQKCKFCKSGKTNLCSS 118
           + P    P +LG E  G V + G+ V N + GD V  + ++   Q  KF  S K N+   
Sbjct: 58  LYPCEK-PYVLGREATGTVVAKGKDVNNFQIGDQVAYISHSTFAQYTKF--SSKGNVMR- 113

Query: 119 VRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLL 178
                    +P  TS                                       E + L 
Sbjct: 114 ---------LPKCTSD--------------------------------------EKMKLY 126

Query: 179 GCGVTTGYGAATKT---ANVQKGDTVAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQK 234
             G+     A + T    +V+KGD + V+ A G VGL + Q  K++GA  I +    D+K
Sbjct: 127 AAGLLQALTALSFTNEAYHVKKGDYILVYAAAGGVGLILNQLLKMKGAHAIAVAS-TDEK 185

Query: 235 RKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDG-GLDYTFDCTG 279
                + GA   IN        + ++E+++E+T+G G+D +FD  G
Sbjct: 186 LDIAKKNGAEYLINSSK-----EDVLERVLEITNGEGVDSSFDSIG 226

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 88/348 (25%), Positives = 129/348 (37%), Gaps = 48/348 (13%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHV-IA 96
           ++V +KIE   VC +D +T SG   E   P ++GHE  G V  +G     +K GD V I 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 97  LYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYT 156
                C +C  CKS     C     T  K    D T  + ++ G           ++ Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRK----DYTDGYNSKGG-----------YADYI 142

Query: 157 XXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQG 216
                                L CG  T +    +      G  V + G G +G   +  
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 217 AKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDY--T 274
           AK  GA     +  +  K++   + GA  FI  K              E  D    Y  T
Sbjct: 202 AKAMGA-ETFAISRSSAKKEDAIKMGADHFIATK--------------EEPDWATKYFDT 246

Query: 275 FD----CTGN-TKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAFG 329
           FD    C+ + T +  + +    K  G  V I V    E ++ +PF L+ G     SA G
Sbjct: 247 FDLIVVCSNSLTDIDFNVVPRTMKVGGKIVSICVPEQHEVMNLKPFGLI-GVSISNSALG 305

Query: 330 GIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE--INKAFEDLHAGD 375
           GI    +M  L+    K  LK+        P +E  + + FE +  GD
Sbjct: 306 GINEIKQMLDLVS---KKNLKI---WVETIPISEKGVKEVFERMEKGD 347

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN-VKPGDHV-I 95
           H+++IK+E   VC +D +  SG       P ++GHE  G V  VG+   N +K GD V +
Sbjct: 34  HDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVVKVGDRCDNGLKVGDRVGV 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDG 131
                 C +C  CK+   + C    AT G G  PDG
Sbjct: 94  GAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG 128

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 77/347 (22%), Positives = 130/347 (37%), Gaps = 72/347 (20%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIAL 97
           +E+ IK +Y  + + ++Y   G+ P    P +LG E +G+V + G+ VT     D V   
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKGDAVTKFDVNDKVA-- 115

Query: 98  YTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTX 157
           Y +     ++ K  +    S V                ++   E+LK + G         
Sbjct: 116 YLSSNTFAQYTKISEAGTVSKVP---------------QDSTDEQLKLYAGS-------- 152

Query: 158 XXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGA 217
                         L S+      V   Y        V+KGD + ++ A           
Sbjct: 153 ----------LVQALTSLAF----VREAYP-------VKKGDYILLYAAAGGAGLAFNQF 191

Query: 218 KVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDG-GLDYTFD 276
             +  +  I V   D+K +   E+GA   IN   D      ++ +++E+T+G G++  FD
Sbjct: 192 LKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSKD-----DVLARVLEITNGQGVEAAFD 246

Query: 277 CTGNTKVMRDALEACHKGW---GTSVIIGVAAAEEEISTRPFQLVTG---RVWKGSAFGG 330
             G     +D  E   K     GT V  G A+    +      ++T    ++ + S FG 
Sbjct: 247 SVG-----KDTFETSLKALKRKGTLVSFGNASG--PVPPVAINILTPKNIKLLRPSLFGY 299

Query: 331 IKGRSEM----GGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
           I    E       L +    G LK+   I+   P  E N+A E L +
Sbjct: 300 IATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLES 344

>Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 115/270 (42%), Gaps = 59/270 (21%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALY 98
           ++ IK +YT V + ++Y   G+ P    P +LG E  G++ + G+ VTN + GD V  + 
Sbjct: 37  DILIKNKYTGVNYIESYFRKGLYPCEK-PYVLGREATGVIVAKGKDVTNFETGDQVAYIS 95

Query: 99  TAE-CQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTX 157
            +   Q  KF   G          T  K  +P GTS       E++K +           
Sbjct: 96  NSTFAQYTKFPSEG----------TIMK--LPSGTS------DEKMKLYAAG-------- 129

Query: 158 XXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVF-GAGTVGLSVIQG 216
                         L+++  L            +  +V+KGD + V+  AG VGL + Q 
Sbjct: 130 -------------LLQALTALSF--------TNEAYHVKKGDYILVYAAAGGVGLILNQL 168

Query: 217 AKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDG-GLDYTF 275
            +++ A  I +     +K +   ++GA   I+        + I+ +++E+TDG G+D +F
Sbjct: 169 LRMKDAHAIAVASTY-EKLETAKDYGAEFLIDSSK-----EDILTRVLEITDGKGVDASF 222

Query: 276 DCTGNTKVMRDALEACHKGWGTSVIIGVAA 305
           D  G  K   D   A  K  G  V  G A+
Sbjct: 223 DSVG--KDTFDTTLAALKRKGVFVSFGNAS 250

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 86/352 (24%), Positives = 136/352 (38%), Gaps = 87/352 (24%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIAL 97
           +E+ +K +Y+ +   ++Y   G+ P    P ILG E +G V + G  V +   GD V   
Sbjct: 52  NELLVKNKYSGINFIESYFRKGIYPSEK-PLILGRESSGTVVAKGNSVKDFDIGDKV--- 107

Query: 98  YTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTX 157
                                                           ++  S F+QYT 
Sbjct: 108 -----------------------------------------------AYLSGSAFAQYTK 120

Query: 158 XXXX-XXXXXXXXXXLESICLLGCGVTTGYGAAT---KTANVQKGDTVAVFGA-GTVGLS 212
                           E++ L   G+     A T   +  NV+KGD +  + A G VGL 
Sbjct: 121 VDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFILNYAAAGGVGLI 180

Query: 213 VIQGAKVRGASRIILVDINDQ---KRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDG 269
           + Q  K RGA  I +V   ++    +K+G E+G    I+ K D      IV ++ E+T+ 
Sbjct: 181 LDQLLKERGAHTIAVVSTEEKLELAKKHGAEYG---IISSKED------IVTRVKEITNN 231

Query: 270 -GLDYTFDCTGNTKVMRDALE---ACHKGWGTSVIIGVAAAEEEISTRPFQLVTG--RVW 323
            G+D  FD  G     +D  E   +  K  GT V  G A+    +S  P   +TG  ++ 
Sbjct: 232 QGVDAAFDSIG-----KDTFETTISALKRKGTFVSYGNASG--PVSPFPLTKLTGNIKIL 284

Query: 324 KGSAFGGIKGRSEMGGLIEDY----KKGTLKVDEFITNERPFTEINKAFEDL 371
           + S F  I    E      ++      G LK++  I +  P +E  KA + L
Sbjct: 285 RPSLFSYIATSEEWKHYSREFVSLVSSGKLKIN--IGHVFPLSEYPKATQLL 334

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 129/313 (41%), Gaps = 65/313 (20%)

Query: 19  YEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIV 78
           Y+  K  T++  TVE   ++E+ IK  Y+ +   +AY   G+ P    P + G E +GIV
Sbjct: 36  YDVIKYKTIQTPTVE--NSNEMVIKNSYSGINFIEAYFRKGIYP-CELPYLPGREASGIV 92

Query: 79  ESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQ 138
             VG+ V N + GD V  L+       +F K  +T+    +                K+ 
Sbjct: 93  AEVGKDVKNFQIGDKVAYLHGETM--AEFTKIKETDPIIKLS---------------KDA 135

Query: 139 KGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKG 198
             E LK +      S                  L +I L+            +   V+KG
Sbjct: 136 SDENLKLYAAGLLQS------------------LTAITLIN-----------EAHEVKKG 166

Query: 199 DTVAVF-GAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQ 257
           + V V+  AG VGL + Q  K++GA  I +     +K +     GA   IN K      +
Sbjct: 167 EYVLVYAAAGGVGLLLDQLLKMKGAHTIAVCS-TKEKLELAKANGAEFSINSKE-----E 220

Query: 258 TIVEKLIEMTDG-GLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAE------EEI 310
            +V++++E+T+  G+D  +D  G      D L A  K  G+ V  G A+          +
Sbjct: 221 NVVQRVMEITNNKGVDVAYDSIGKA-TFEDTLAAL-KLKGSLVSFGNASGPVPPLLINRL 278

Query: 311 STRPFQLVTGRVW 323
           S +  +LV  +++
Sbjct: 279 SPKNLKLVRPQLY 291

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 73/321 (22%), Positives = 118/321 (36%), Gaps = 48/321 (14%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPE----------GAFPSILGHEGAGIVESVGEGVTNV 88
           +V I+IE   +C ++ + L     +          G    ++GHE  G V +VG  VT  
Sbjct: 39  DVDIEIECCGICGSELHALQNNWSDEPLACLSAKIGPKSQVVGHEIVGHVVNVGNKVTKF 98

Query: 89  KPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFM 147
             G+ V +      C KC  C +G    C+    T      PDG   + +Q G       
Sbjct: 99  HKGERVAMGAQCGSCMKCNRCINGYEQFCTGCIETYCSE-YPDG---YVSQGG------- 147

Query: 148 GCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTAN--VQKGDTVAVFG 205
               ++ +                 + +  L CG  T Y    +       K   VA+ G
Sbjct: 148 ----YASHVRAHEHYIVHVPPQLDSKHVAPLQCGGLTVYSPIKRALKDVTDKKPRVAIIG 203

Query: 206 AGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIE 265
            G +G   I  +K      +  +  +D K++   + GA  F+N            EK + 
Sbjct: 204 IGGLGHMAIMISKALDC-EVWALSTSDSKKEDAKKMGADHFVN----------TTEKDVW 252

Query: 266 MTDGGLDYTF----DCT-GNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVT- 319
              GGL  TF     CT   TK+  ++L       G  + +G+ + ++ +   P QL   
Sbjct: 253 ---GGLQDTFHLILSCTISYTKLPFESLLGTLVATGKFISVGLPSKDQPLEIHPMQLAAH 309

Query: 320 GRVWKGSAFGGIKGRSEMGGL 340
           G  +  S  G IK   E+  L
Sbjct: 310 GVSFSASHLGSIKELEELLAL 330

>NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 87/350 (24%), Positives = 124/350 (35%), Gaps = 49/350 (14%)

Query: 37  AHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN-VKPGDHV- 94
            +++ IKIE   VC +D +  +G   +   P ++GHE  G V  +GE   + +K GD V 
Sbjct: 36  PNDIDIKIECCGVCGSDIHAAAGHWGDLEKPLVVGHEVIGTVVRLGENCNSGLKLGDRVG 95

Query: 95  IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQ 154
           +      C  C+ CKS     C S   T G+    DG S           H        +
Sbjct: 96  VGAQVFSCLDCERCKSNNEPYCPSFVTTYGQSYK-DGYSSKGGYADYIRVHEHFAVPIPE 154

Query: 155 YTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVI 214
                               +   GCG     G          G    +F          
Sbjct: 155 NIPSHLAAPLMCGGITVFSPLLRNGCGPGKKVGIVGIGGIGHMG---LIFAKA------- 204

Query: 215 QGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDY- 273
            GA+V   SR         K++   + GA  FI  K              E  D G  Y 
Sbjct: 205 MGAEVYAISR------TSAKKEDAMKLGADHFIATK--------------EEPDWGTKYF 244

Query: 274 -TFD----CTGN-TKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSA 327
            TFD    C  + T V  + +    K  G  V I V    E ++ +PF L+ G     SA
Sbjct: 245 DTFDLIVVCANSLTDVDFNVVPKAMKVGGNIVSICVPEQNEVLNLKPFGLL-GVSISNSA 303

Query: 328 FGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE--INKAFEDLHAGD 375
            GG+K   E+  L++   K  LK+        P  E  + +AFE +  GD
Sbjct: 304 LGGVK---EIKELLDLVSKNNLKI---WVETLPIGEEGVKQAFERMDKGD 347

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 98/393 (24%), Positives = 142/393 (36%), Gaps = 92/393 (23%)

Query: 1   MSGAATEGKSITCVAAVAYEAGKPLTV---EEITVEAPRAHEVRIKIEYTAVCHTDAYTL 57
           MS   TE K +     +  E G P  +   E+  V   R  ++ IK  Y  V   + Y  
Sbjct: 1   MSDIPTEQKVV-----LIRETGGPEVLRYEEDYPVPEVRGSDILIKNRYAGVNFIETYFR 55

Query: 58  SGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHV-------IALYTAECQKCKFCKS 110
           +G+ P    P +LG E  G+V ++G  V   K GD V        A YTA  +K    K 
Sbjct: 56  TGLYP-CEKPYVLGREAVGVVAAIGADVRRFKVGDRVACLSSGTFAQYTAVSEKSNVLK- 113

Query: 111 GKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXX 170
                            +PD       Q G EL+   G                      
Sbjct: 114 -----------------LPDDI-----QDG-ELQAVAGS--------------------- 129

Query: 171 XLESICLLGCGVTTGYGAATKTANVQKGDTVAVF-GAGTVGLSVIQGAKVRGASRIILVD 229
                 + G    T    A K    Q G+ V V+  AG VG  +IQ    R   R+I V 
Sbjct: 130 -----LVNGLTALTLVDEAYKP---QVGEIVLVYAAAGGVGQLLIQLLHARSV-RVIAVA 180

Query: 230 INDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDG-GLDYTFDCTGNTKVMRDAL 288
             D+K +     GA   IN        + IV K++E TDG G+  ++D  G     +D  
Sbjct: 181 STDEKLQIAKSRGAEFLIN-----SSREDIVAKVLEFTDGEGVGASYDSVG-----KDTF 230

Query: 289 EACH---KGWGTSVIIGVAA-AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEM----GGL 340
           E      K  GT V  G A+ A    S +       ++ +   +G +  R E       L
Sbjct: 231 ETTLQSVKRKGTIVSFGNASGAVPPFSIQRLTPKNLKILRPQLYGYLATREEWEYYSSKL 290

Query: 341 IEDYKKGTLKVDEFITNERPFTEINKAFEDLHA 373
           +   +   L ++  ITN  P  E  +  + L +
Sbjct: 291 LHLIRSKKLIIN--ITNLSPLEEFKRLTQLLES 321

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 82/342 (23%), Positives = 132/342 (38%), Gaps = 36/342 (10%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVT-NVKPGDHV-IA 96
           +V IK+    VC +D +  +G         ++GHE  G V  VG   T  VK GD V + 
Sbjct: 35  DVDIKVIACGVCGSDVHCAAGRHLPLFEDCVVGHEIIGEVVKVGPKCTAGVKVGDRVGVG 94

Query: 97  LYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYT 156
             +  C +C+ C +G    C          + PDG+   K Q G           F  + 
Sbjct: 95  AQSLSCLECESCIAGNEQYCKKNTVYTIASIYPDGS---KAQGG-----------FGSHV 140

Query: 157 XXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQG 216
                            +   L CG  T +    +   V  G TV + G G +G   I  
Sbjct: 141 RTHEYFVHPIPKELDTVNAAPLLCGGITAFSPLLR-GQVGPGKTVGIVGIGGIGHIAILF 199

Query: 217 AKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFD 276
           AK  GA ++I +  +  K++   + GA ++I       +G    +K      G +D+   
Sbjct: 200 AKAMGA-KVIAISRSASKKEDCLKLGADEYIAS----AEGDDWKQKFA----GSIDFMLL 250

Query: 277 CTGN-TKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAFGGIKGRS 335
           C  + +K   D+L +  K  G    IG+      +S  P  L+  +      F  +  R+
Sbjct: 251 CNSSFSKSNFDSLFSLIKLGGEVCSIGIPDMSYRLSISPLSLLGIKF----GFSALGSRN 306

Query: 336 EMGGLIEDYKKGTLKVDEFITNERPFTE--INKAFEDLHAGD 375
           E   + E  KK  +K+        P  E  +++AFE +  GD
Sbjct: 307 EFQKMFELVKKNNIKL---WVETLPIGEKGLHEAFERVENGD 345

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 90/349 (25%), Positives = 130/349 (37%), Gaps = 49/349 (14%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN-VKPGDHV-I 95
           H++ IKIE   VC +D +T SG   +   P ++GHE  G V  +G+  T+ +K GD V +
Sbjct: 35  HDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIGTVVRLGDKCTSGLKLGDRVGV 94

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQY 155
                 C +C  CKS     C+    T       DG     N KG           ++ Y
Sbjct: 95  GAQAFSCLECGRCKSDNEPYCTKSVWTYSTN-YEDGY----NSKG----------GYADY 139

Query: 156 TXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQ 215
                                 L CG  T +    +     +G  V + G G +G   + 
Sbjct: 140 IRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLRNG-CGRGKKVGIMGIGGIGHMALI 198

Query: 216 GAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDY-- 273
            AK  GA  +  +     K+    + GA  FI  K              E  D    Y  
Sbjct: 199 FAKAMGA-EVYAISRTSAKKDDSIKMGADHFIATK--------------EEPDWATKYFD 243

Query: 274 TFD----CTGN-TKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAF 328
           TFD    C+ + T +  D +    K  G  V I      E I+ +PF L+ G     SA 
Sbjct: 244 TFDLIVVCSNSLTDINFDVVPRTMKVGGKIVSICAPEQNEVINLKPFGLL-GVSISNSAL 302

Query: 329 GGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE--INKAFEDLHAGD 375
           GGI    +M  L+    K  LK+        P +E  + + FE +  GD
Sbjct: 303 GGINEIKQMLDLVS---KKDLKI---WVETVPISEKGVKEVFERMDMGD 345

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 91/379 (24%), Positives = 147/379 (38%), Gaps = 52/379 (13%)

Query: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63
           A  EG   T    V++   KP TV         A ++ +K+E   VC +D +  +G    
Sbjct: 34  AVVEGTEWTSPKKVSF---KPKTV--------YARDIVLKVEACGVCGSDIHCAAGHWGP 82

Query: 64  GAFPSILGHEGAGIVESVGEGVTN-VKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRA 121
              P ++GHE  G V  VG G    +K GD V +      C +C  C+S     CS++  
Sbjct: 83  RNNPLVVGHEIIGRVIEVGSGCKEGLKVGDRVGVGAQALSCLECSRCESENEQYCSNMTG 142

Query: 122 TQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCG 181
           T      PDG   + +Q G           ++ +                      L CG
Sbjct: 143 TYNFP-YPDG---YISQGG-----------YASHVIVHEHFAIPIPDNIPSHLAAPLMCG 187

Query: 182 VTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEF 241
             T +    ++ NV  G +V V G G +G   +  AK  GA+ +  +     K+    + 
Sbjct: 188 GITAFSPLLRS-NVGPGTSVGVVGIGGIGHMAVIFAKALGAN-VTAISRRSNKKDDALKL 245

Query: 242 GATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGN-TKVMRDALEACHKGWGTSVI 300
           GA  +I    D    +T            LD    C+ + T++  D + +  K  G  + 
Sbjct: 246 GADVYIAAVEDKDWHKTYANT--------LDLIVVCSSSLTELDFDRIPSLLKVGGKVLS 297

Query: 301 IGVAAAEEEISTRPFQLVTGRVWKGSAFGG--IKGRSEMGGLIEDYKKGTLKVDEFITNE 358
           I +  A E +  RP  L      KG + G   I   +E+  L++   K  LK+      E
Sbjct: 298 IAIPEASERLVLRPLLL------KGISIGTSVIGSPAEIKKLLDFVSKKNLKI---WVEE 348

Query: 359 RPFTE--INKAFEDLHAGD 375
            P +E  + + F  +++GD
Sbjct: 349 VPISEAGVAEVFRRMNSGD 367

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 113/309 (36%), Gaps = 40/309 (12%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN-VKPGDHV-I 95
           +++ IKIE   VC +D +  SG   +   P ++GHE  G V  VG   T+ +K GD V +
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQY 155
                 C  C  C +     C +V  T G    PDG              + G   ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG--------------YNGKGGYANY 138

Query: 156 TXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVIQ 215
                                 L CG  T Y    +      G  V + G G +G   I 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 216 GAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTF 275
            AK  GA  +  +  +D K++   + GA  FI  K +   G+   +         LD   
Sbjct: 198 FAKSMGA-EVYAISRSDAKKEDAFKLGADHFIATKDEPDWGKKYFDT--------LDLIV 248

Query: 276 DCTGNTK-VMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAFGGIK-G 333
            C G+ K V  D L       G  V I +  A E++    F L            GI  G
Sbjct: 249 ICAGSLKDVDFDNLPKAMTVGGKVVSISIPEASEKLEFSAFGL-----------AGISIG 297

Query: 334 RSEMGGLIE 342
            S +G ++E
Sbjct: 298 NSSLGSMVE 306

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 96/385 (24%), Positives = 149/385 (38%), Gaps = 51/385 (13%)

Query: 14  VAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHE 73
           +A V ++  K     E   +    ++V IKIE   VC +D +  +G   +   P ++GHE
Sbjct: 9   IAVVDHKDWKNPKKVEFPAKPFYDNDVDIKIEACGVCGSDIHCAAGNWGQKQTPLVVGHE 68

Query: 74  GAGIVESVGEGV-TNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDG 131
             G V  VG    T +K GD V +      C +C+ CK+     C+    T  +    DG
Sbjct: 69  IIGKVVKVGPKCKTGLKIGDRVGVGAQVFSCLECERCKNDNEPYCARFVTTYSQP-YEDG 127

Query: 132 TSRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATK 191
              + +Q G           ++ Y                 E    L CG  T Y    +
Sbjct: 128 ---YVSQGG-----------YANYVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYSPLLR 173

Query: 192 TANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
                 G  V + G G +G   I  AK  GA  +  +  ++ K++   + GA  +I  K 
Sbjct: 174 NG-CGPGKKVGILGIGGIGHMGILFAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATK- 230

Query: 252 DLKDGQTIVEKLIEMTDGGLDY--TFD----CTGN-TKVMRDALEACHKGWGTSVIIGVA 304
                        E  D G  Y  TFD    C  + T V  D +    K  G  V I V 
Sbjct: 231 -------------EEPDWGTKYFDTFDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISVP 277

Query: 305 AAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE- 363
             +E ++ +PF L+ G     S  G I   +EM  L++   +  +K+        P  E 
Sbjct: 278 EQDEVLTMKPFGLI-GVSIANSILGSI---AEMKQLLKLVSENNIKI---WVETLPVGEA 330

Query: 364 -INKAFEDLHAGDCLR--TVLDLKK 385
            + +AFE +  GD     T++D +K
Sbjct: 331 GVKEAFERMDKGDVRYRFTLVDYEK 355

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 85/355 (23%), Positives = 130/355 (36%), Gaps = 82/355 (23%)

Query: 25  LTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEG 84
           +  ++  V +  + +V +K +Y  V   +AY   G  P    P +LG E +G V  VG  
Sbjct: 22  IKYQDFAVPSIGSTDVLVKNKYAGVNFIEAYFRKGYYP-CELPYVLGREASGEVVQVGSE 80

Query: 85  VTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELK 144
           V + K GD V                                                  
Sbjct: 81  VKDFKIGDKV-------------------------------------------------- 90

Query: 145 HFMGCSTFSQYTXXXXXXXXXXXXXX-XLESICLLGCGVT---TGYGAATKTANVQKGDT 200
            ++G STF+QYT                 E + L G  +    T      +   V +GD 
Sbjct: 91  AYLGGSTFAQYTKKSTENHIMNLGQSCPDEDLKLYGSSLVQCLTAISFIDEAYKVMEGDY 150

Query: 201 VAVFGA-GTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTI 259
           + V+ A G VG  + Q    R A  +I V  + +K     E GA   IN   D      I
Sbjct: 151 ILVYAASGGVGSILCQLISQRKA-HVIAVASSAEKLAMAKENGAEFLINYAED-----DI 204

Query: 260 VEKLIEMTDG-GLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA------AEEEIST 312
           +EK+++ T+G G+   FD  G      D   A  +  GT V  G A+      A  ++S 
Sbjct: 205 LEKVMQYTNGKGVHAAFDSIGKDTFETDL--AALRRKGTLVSFGNASGMVPPFAINKLSP 262

Query: 313 RPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYK----KGTLKVDEFITNERPFTE 363
           +  +L+  +V+     G +  RSE       +K      +LKVD  I+   P +E
Sbjct: 263 KNLKLLRPQVY-----GYLGTRSEWDHYCSIFKHFVQSKSLKVD--ISGIYPLSE 310

>KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 366

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 52/122 (42%), Gaps = 8/122 (6%)

Query: 16  AVAYEAGKPLTVEEITVEA----PRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILG 71
           AV     K L+ E++   A    PR  +V I+IE   VC +D +   G   E   P ++G
Sbjct: 11  AVVDSHKKWLSPEKVVYPAKQFNPR--DVDIEIEACGVCGSDVHCAKGNWGEMKLPLVVG 68

Query: 72  HEGAGIVESVGEGV-TNVKPGDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMP 129
           HE  G V  +G+   T +K GD V +    + C  C  C +     C     T  +    
Sbjct: 69  HEIIGKVVRLGDKCDTGLKVGDRVGVGAQVSACLDCNRCNNDNEQYCPKFVTTYSQPYFE 128

Query: 130 DG 131
           DG
Sbjct: 129 DG 130

>NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 43/95 (45%), Gaps = 3/95 (3%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN-VKPGDHV-IA 96
           +V IKIE   VC +D +  SG   +   P I+GHE  G V  +G    N +K GD V + 
Sbjct: 36  DVDIKIECCGVCGSDIHAASGHWGDIEKPLIVGHEIIGTVVKLGSKCENGLKLGDRVGMG 95

Query: 97  LYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDG 131
                C KC  C +   + C     T G    PDG
Sbjct: 96  AQCYSCLKCDRCLNNNESYCQHFVTTYGMN-YPDG 129

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGV-TNVKPGDHV-I 95
           ++V ++IE   +C +D +  SG     + P ++GHE  G V  VG    T VK GD V +
Sbjct: 34  YDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKCHTGVKVGDRVGV 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDG 131
               + C  C  C S     C+    T  +   PDG
Sbjct: 94  GAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDG 128

>Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)
          Length = 125

 Score = 38.1 bits (87), Expect = 0.007,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 2/80 (2%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVIAL- 97
           +V IK+E   VC +D +  +G       P + GHE  G +  +G   ++    D  + + 
Sbjct: 35  DVEIKVEACGVCGSDIHCAAGHWGPRNDPLVAGHEIVGRIVRMGSRCSSQLKVDMRVGMG 94

Query: 98  -YTAECQKCKFCKSGKTNLC 116
             T  C KC  CK G+ N C
Sbjct: 95  AITFSCLKCSGCKKGEENYC 114

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVG-EGVTNVKPGDHV-I 95
           H+V IKIE   VC +D +  +G   +   P ++GHE  G V  +G +  + ++ G  V +
Sbjct: 34  HDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKSNSGLQVGQRVGM 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
                 C +C  CKS     C+    T G+
Sbjct: 94  GAQVFSCLECDRCKSDNEPYCTKFVTTYGQ 123

>Smik_3.203 Chr3 (301227..301247,301251..301589) [360 bp, 120 aa]
           {ON} YCR105W (REAL)
          Length = 120

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFP--SILGHEGAGIVESVGEGV-TNVKPGDHV 94
           H++ I+IE   +C +D +  +G    G  P   +LGHE  G V  VG    T +K GD V
Sbjct: 33  HDIDIEIEDCGICGSDFHIAAG--NWGPVPKNQVLGHEIIGRVVKVGPKCHTGIKIGDRV 90

Query: 95  -IALYTAECQKCKFCKSGKTNLCS 117
            +      C +C+ CKS     C+
Sbjct: 91  GVGAQALACLECERCKSDNEQYCT 114

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 2/90 (2%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVG-EGVTNVKPGDHV-I 95
           H+V IKIE   VC +D +  +G       P ++GHE  G V  +G +  + +K G  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQRVGV 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
                 C +C  CKS     C+    T  +
Sbjct: 94  GAQVFSCLECNRCKSDNEPYCTKFVTTYSQ 123

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 2/90 (2%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN-VKPGDHV-I 95
           H+V IKIE   VC +D +  +G       P ++GHE  G V  +G+   + +K G  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLGDKSNSGLKVGQRVGV 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
                 C +C  CKS     C+    T  +
Sbjct: 94  GAQVFSCLECDRCKSDNEPYCTKFVTTYSQ 123

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 76/345 (22%), Positives = 127/345 (36%), Gaps = 41/345 (11%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGV-TNVKPGDHV-I 95
           H++ IKI+   VC +D +  +G   +   P ++GHE  G V  +G    T +K GD V +
Sbjct: 34  HDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVVGHEIIGKVVKIGPKCNTGLKVGDRVGV 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQY 155
                 C +C  CK+     C     T  +    DG   + +Q G           ++ Y
Sbjct: 94  GAQVFSCLECDRCKNDNEPYCPKFVTTYSQP-YEDG---YVSQGG-----------YANY 138

Query: 156 TXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVI- 214
                                 L CG  T Y    +           V   G   + ++ 
Sbjct: 139 VRVHEHFAVKIPENIPDHLAAPLLCGGITVYSPLLRNGCGPGKKVGIVGIGGIGHMGLLF 198

Query: 215 ---QGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGL 271
               GA+V   SR      ++ K++   + GA  +I  K +   G+   +          
Sbjct: 199 AKAMGAEVYAISR------SNAKKEDSLKLGADHYIATKEEPNWGEKYFDT--------F 244

Query: 272 DYTFDCTGN-TKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAFGG 330
           D    C  + T V  D +    K  G  V I +   ++ ++ +PF L+ G     SA G 
Sbjct: 245 DLIVVCASSLTDVDFDVMPKAMKVGGRIVSISIPDEDQTLTMKPFGLL-GVSIANSALGS 303

Query: 331 IKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHAGD 375
           IK   ++  L+ + K   + V+     E     + +AFE +  GD
Sbjct: 304 IKEIEQLLKLVSE-KDIKIWVETLPVGE---AGVKEAFERMDKGD 344

>Kpol_257.4 s257 complement(12348..13430) [1083 bp, 360 aa] {ON}
           complement(12348..13430) [1083 nt, 361 aa]
          Length = 360

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 42/96 (43%), Gaps = 3/96 (3%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN-VKPGDHV-I 95
            +V +KIE   VC +D +  +          ++GHE  G V  VG   T  +K GD V +
Sbjct: 34  QDVDVKIEACGVCGSDIHCAASHWGPVVKNQVVGHEIVGRVVKVGPKCTTGIKIGDRVGV 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDG 131
               A C  C  C++     C  V  T G+   PDG
Sbjct: 94  GAQVASCLDCSRCQNDNEPYCPRVVTTYGQA-YPDG 128

>SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 359

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGV-TNVKPGDHV-I 95
           ++V I+I+   VC +D +  +G   +   P ++GHE  G V  VG    T VK GD V +
Sbjct: 34  NDVDIEIDACGVCGSDVHCAAGHWGDTQKPLVVGHEVIGRVVRVGPKCHTGVKIGDRVGV 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRAT 122
                 C KC  CKS     C     T
Sbjct: 94  GAQVYSCLKCDRCKSDNEPYCPKFVTT 120

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 85/365 (23%), Positives = 140/365 (38%), Gaps = 67/365 (18%)

Query: 27  VEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPS----ILGHEGAG-IVESV 81
           +E   V++ + H+  +KI+   +CH+D   L     +G FP+     +GHE  G +V++ 
Sbjct: 100 LENYRVQSLKPHQGLLKIKAVGLCHSDLTIL-----KGGFPASQRYAMGHEICGELVQTY 154

Query: 82  GEGVTNVKPGDHVIALYT----AECQKCKFCKSGKTNLCS-----SVRATQGKGVMPDGT 132
            +     +P   V  LYT    A C  C  CK G  + C+     +    Q  G+  DG 
Sbjct: 155 AD-----EPKYAVGELYTVVGNAPCGGCDSCKKGWESCCTANGEKACGLGQCYGIGRDGG 209

Query: 133 SRFKNQKGEELKHFMGCSTFSQYTXXXXXXXXXXXXXXXLESICLLGC-GVTTGYGAATK 191
             +      +L+H +                           IC +    V T Y A   
Sbjct: 210 --YAEYIAIDLRHLVKVP----------------KELVNKPEICAVATDAVLTPYHAIKN 251

Query: 192 TANVQKGD--TVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINP 249
                K       V G G +GL+ +Q A   G SR+I VD  D + +   E GA      
Sbjct: 252 IPGFAKTPDYCTLVIGLGGLGLNGMQVANALG-SRVICVDFKDSQLQKATEMGA------ 304

Query: 250 KSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEE 309
                  + + ++L      G+D   D  G+T  +  A+    K  G   ++G++AA  E
Sbjct: 305 -------EQVFKQLPTDASLGVDAVVDFVGHTSTIASAMFHL-KPHGFLALVGISAAGYE 356

Query: 310 ISTRPFQLVTGRVWKG--SAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEINKA 367
           I       + G+      S +G    + E+  LI        KV   +T+   FT++   
Sbjct: 357 IRFPALSYMLGKEISMIYSFWGTTSDQKEVLDLI-----AAGKVMPQVTSYSLFTDLPSK 411

Query: 368 FEDLH 372
            E++ 
Sbjct: 412 IEEMR 416

>Skud_3.175 Chr3 (288164..289249) [1086 bp, 361 aa] {ON} YCR105W
           (REAL)
          Length = 361

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFP--SILGHEGAGIVESVGEGV-TNVKPGDHV 94
           H+V I+IE   +C +D +  +G    G  P   +LGHE  G V  VG    T +K GD V
Sbjct: 34  HDVDIEIEACGICGSDFHIAAG--NWGPVPKNQVLGHEIIGRVVKVGPKCHTGIKLGDRV 91

Query: 95  -IALYTAECQKCKFCKSGKTNLCS 117
            +      C +C+ CKS     C+
Sbjct: 92  GVGAQALACLECERCKSDNEQYCT 115

>KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {ON}
           
          Length = 359

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN-VKPGDHV-I 95
           H++ IKIE   VC +D +  SG   +   P ++GHE  G +  +G    +  K GD V +
Sbjct: 34  HDIDIKIEACGVCGSDVHCASGNWGDTPKPLVVGHEIIGTIVKMGPKCNSGYKIGDRVGM 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRAT 122
                 C +C  C +     C+ V  T
Sbjct: 94  GAQAMSCLECDRCINDNEPYCAKVVCT 120

>YCR105W Chr3 (309070..310155) [1086 bp, 361 aa] {ON}
           ADH7NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 361

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFP--SILGHEGAGIVESVGEGV-TNVKPGDHV 94
           H+V ++IE   +C +D +    V   G  P   ILGHE  G V  VG    T VK GD V
Sbjct: 34  HDVDVEIEACGICGSDFHI--AVGNWGPVPENQILGHEIIGRVVKVGSKCHTGVKIGDRV 91

Query: 95  -IALYTAECQKCKFCKSGKTNLCSS 118
            +      C +C+ CKS     C++
Sbjct: 92  GVGAQALACFECERCKSDNEQYCTN 116

>ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 11/92 (11%)

Query: 37  AHEVRIKIEYTAVCHTDAYTLSG----------VDPEGAFPSILGHEGAGIVESVGEGVT 86
           AH+V I++E   +C ++ ++L                G    ++GHE  G V +VG+ V+
Sbjct: 35  AHDVDIEVECCGICASELFSLKNEWSSEPLTCMTSSYGPKSQVVGHEVVGKVVAVGDKVS 94

Query: 87  NVKPGDHV-IALYTAECQKCKFCKSGKTNLCS 117
             K GD + +    + C  C  C       C+
Sbjct: 95  LCKVGDRIGLGAQASSCMSCPRCHGNNEQYCA 126

>KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON}
           weakly similar to uniprot|P53912 Saccharomyces
           cerevisiae YNL134C
          Length = 398

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 106/269 (39%), Gaps = 46/269 (17%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVK-P-GDHVI 95
           HE+ I+ +YT + H D  +        +FP I G E +GIV   G  V   + P G  V 
Sbjct: 72  HEILIRNKYTGLNHVDWKSKKYRFNIHSFPWINGRESSGIVVRRGAKVDRDRFPIGAEVF 131

Query: 96  ALYT--AECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFS 153
              T   E +   F +   T   S +     + ++PDGT+R   + G +    +G     
Sbjct: 132 LASTCYRELKTSTFQEF--TVFDSRLVWRLPREILPDGTTR--KRFGLDFAAGVG----- 182

Query: 154 QYTXXXXXXXXXXXXXXXLESICLLGCG-VTTGYGAATKTANVQKGDTVAVFG-AGTVGL 211
                                + L+  G   + +    +     +G ++ V+G + +VG+
Sbjct: 183 ---------------------VPLVTAGSALSSFVDFNEIGKADQGRSLVVWGGSSSVGI 221

Query: 212 SVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFIN---PKSDLKDGQTIVEKLIEMTD 268
             IQ A+  G  + I+   + +   Y  E GAT  I+   P  +L      V+K  E+  
Sbjct: 222 FTIQLARNLGIFKNIIAVSSLRYEDYLKELGATAVIDRTLPSEEL------VQKFQELCP 275

Query: 269 GGLDYTFDCTGNTKVMRDALEACHKGWGT 297
            G+DY  D   + K     LE    G GT
Sbjct: 276 TGVDYGVDVI-SKKTAELVLEILKDGKGT 303

>TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 38/90 (42%), Gaps = 11/90 (12%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSG----------VDPEGAFPSILGHEGAGIVESVGEGVTN 87
           H++ I++E   +C ++ ++L                G    ++GHE  G V  VGE VT 
Sbjct: 38  HDIDIEVECCGICASELFSLKNEWSNAPLACLSSSYGPKSQVVGHEVIGKVVKVGEKVTL 97

Query: 88  VKPGDHV-IALYTAECQKCKFCKSGKTNLC 116
            K G  V +    + C +C  C S     C
Sbjct: 98  AKLGQRVGLGAQASSCMQCGRCSSNNEQYC 127

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 2/90 (2%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVG-EGVTNVKPGDHV-I 95
           H++ IKIE   VC +D +  +G       P ++GHE  G V  +G +  + +K G  V +
Sbjct: 34  HDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGV 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
                 C +C  CK+     C+    T  +
Sbjct: 94  GAQVFSCLECDRCKNDNEPYCTKFVTTYSQ 123

>Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON}
           (51360..52445) [1086 nt, 362 aa]
          Length = 361

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 43/95 (45%), Gaps = 3/95 (3%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVG-EGVTNVKPGDHV-IA 96
           +V I+IE   VC +D +  SG   E     ++GHE  G V  +G E  T +K GD V + 
Sbjct: 35  DVDIEIEACGVCGSDIHCASGDWGERRDKLVVGHEVIGRVIKLGPECHTGLKIGDRVGVG 94

Query: 97  LYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDG 131
              A C  C+ C+      C     T  +   PDG
Sbjct: 95  AQVASCLDCERCEHDNEPYCPKFVTTYNQA-YPDG 128

>KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 5/96 (5%)

Query: 35  PRA---HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVG-EGVTNVKP 90
           P+A   H+V I+IE   VC +D +T +    E     ++GHE  G +  +G E  + +K 
Sbjct: 34  PKAFGPHDVDIEIECCGVCGSDIHTAASHWRELRDKMVVGHEIVGRIVKLGPECDSGLKI 93

Query: 91  GDHV-IALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
           GD V +   +  C +C  CK      C    +T  +
Sbjct: 94  GDRVGVGAQSFSCLECDRCKENNEPYCPKFVSTYNR 129

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 93/247 (37%), Gaps = 50/247 (20%)

Query: 36  RAHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVKPGDHVI 95
           + +E+ IK +Y  + H D  +        +FP + G E +GIV   GE V          
Sbjct: 72  KPYEILIKNKYIGLNHVDWKSKKYRFSIYSFPWVNGRESSGIVVRRGEKV---------- 121

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQY 155
                   + KF   G+  + S+                            +  STF +Y
Sbjct: 122 -------DEEKFPLGGEVFIASTTYRD------------------------LRTSTFQEY 150

Query: 156 TXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTANV----QKGDTVAVFGAGT-VG 210
           T               L+    +G  + T   A     NV    ++  ++ ++G  T VG
Sbjct: 151 TVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIVIWGGSTGVG 210

Query: 211 LSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGG 270
           + V+Q AK  G ++II +  + +  +Y    GAT  I+ +   +D   IV ++ ++   G
Sbjct: 211 IFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIHREEKTED---IVNEIKKICPNG 266

Query: 271 LDYTFDC 277
           + +  D 
Sbjct: 267 VSHGVDL 273

>Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR105W
           - Hypothetical ORF [contig 68] FULL
          Length = 364

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 3/81 (3%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVK--PGDHV-I 95
           ++ ++IE   VC +D + ++G       P  +GHE  G + ++GE V   K   GD V +
Sbjct: 35  DIELEIEACGVCGSDIHAVAGDWGRLYKPFAVGHEIVGKISAMGEQVNKEKFHLGDRVGV 94

Query: 96  ALYTAECQKCKFCKSGKTNLC 116
                 C KC  C  G+   C
Sbjct: 95  GAQIDSCGKCTRCSRGRQQNC 115

>Kpol_1057.24 s1057 (53467..54549) [1083 bp, 360 aa] {ON}
           (53467..54549) [1083 nt, 361 aa]
          Length = 360

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 37/80 (46%), Gaps = 2/80 (2%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTN-VKPGDHV-IA 96
           +V IKIE   VC +D +  +      A   ++GHE  G V  VG   T  +K GD V + 
Sbjct: 35  DVDIKIEACGVCGSDVHCAASHWGPVAEKQVVGHEIIGRVLKVGPKCTTGIKVGDRVGVG 94

Query: 97  LYTAECQKCKFCKSGKTNLC 116
                C +C  CKS   + C
Sbjct: 95  AQAWSCLECSRCKSDNESYC 114

>KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 82/348 (23%), Positives = 121/348 (34%), Gaps = 47/348 (13%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGV-TNVKPGDHV-I 95
           H++ I++    VC +D +  SG   E   P ++GHE  GIV   G    + +K  D V +
Sbjct: 34  HDIDIRVLACGVCGSDIHCASGHWGEIPKPLVVGHEIIGIVVKTGPRCDSGLKVEDRVGV 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQY 155
                 C  C  C       C +  +T  K    DG   + +Q G           ++ Y
Sbjct: 94  GAQALSCLDCDRCTHDNEPYCPNRVSTYAKSYR-DG---YVSQGG-----------YADY 138

Query: 156 TXXXXXXXXXXXXXXXLESICLLGCGVTTGYGAATKTA-----NVQKGDTVAVFGAGTVG 210
                                 L CG  T +    +        V       +   G + 
Sbjct: 139 VRVHEHFAVLIPESIPSHLAAPLMCGGLTVFSPLLRNGCGPGKKVGILGIGGIGHMGVL- 197

Query: 211 LSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGG 270
           L+   GA+V   SR         K+    + G   FI  K +  D     EK  +     
Sbjct: 198 LAKAMGAEVYAISR------TSSKKADAVKLGTDHFIATKEE-PDWH---EKYFDT---- 243

Query: 271 LDYTFDCTGN-TKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAFG 329
           LD    C G+ T V  D L       G  V I +    E +  +PF LV G     S  G
Sbjct: 244 LDLLVICAGSLTDVDFDTLPKIMTVGGRVVSIAIPEQHEILKLKPFGLV-GVSIANSLLG 302

Query: 330 GIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE--INKAFEDLHAGD 375
            +K   E+  L+E   K  +K+        P  E  +N+AF  +  GD
Sbjct: 303 SMK---ELKELLELVAKNNIKI---WVETIPIGEKGVNEAFTRMEKGD 344

>KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 2/91 (2%)

Query: 37  AHEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVG-EGVTNVKPGDHV- 94
           +H+V I+IE   VC +D +  +    E     ++GHE  G V  VG E  T +K GD V 
Sbjct: 33  SHDVDIEIECCGVCGSDIHCAASHWSEVREDLVVGHEVIGRVVKVGPECNTGLKLGDRVG 92

Query: 95  IALYTAECQKCKFCKSGKTNLCSSVRATQGK 125
           +      C +C  CK      C     T  +
Sbjct: 93  VGAQVFSCLECDRCKEDNEPYCQKFVTTYNQ 123

>TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 38  HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGV-TNVKPGDHV-I 95
           ++V IKIE   VC +D +  S          ++GHE  G V  +G      +K GD V +
Sbjct: 34  YDVDIKIEACGVCGSDVHRASSNWGPVKANQVVGHEIVGRVVKLGPKCKLGLKVGDRVGV 93

Query: 96  ALYTAECQKCKFCKSGKTNLCSS 118
                 C  CK CKS     C S
Sbjct: 94  GAQAKSCLNCKRCKSDNEPYCKS 116

>Smik_6.36 Chr6 (64079..64342) [264 bp, 88 aa] {OFF} YJR159W (HSP)
          Length = 88

 Score = 32.7 bits (73), Expect = 0.30,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 43/93 (46%), Gaps = 10/93 (10%)

Query: 272 DYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAFGGI 331
           D  F+C G  K +++ L  C K  GT+V IG+   +E     P    +G++     + G 
Sbjct: 1   DVAFECPGTQKSVKEDLR-CEKNDGTAVQIGMHPLDENWRISPSTRFSGKI----MYKGP 55

Query: 332 KG--RSEMGGLIEDYKKGTLKVDEFITNERPFT 362
            G  R +    I   K  T   D F++ ++P+T
Sbjct: 56  PGHYRDDHSLAINVDKTIT---DRFLSRDQPYT 85

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 32.0 bits (71), Expect = 0.31,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 189 ATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFI 247
           A +   V+ GD V V     +GL V    +  G  +++L+   D K++   +FG T FI
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 32.3 bits (72), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 3/83 (3%)

Query: 223 SRIILVDINDQKRKYGNEFGAT-DFINPKSDLKDGQTIVEKLIEMTDG-GLDYTFDCTGN 280
           S +I VD+ D K +   +FGAT  F + K  + + Q + ++L ++  G   D  F+C+G 
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSGA 60

Query: 281 TKVMRDALEACHKGWGTSVIIGV 303
              +   ++    G GT V +G+
Sbjct: 61  DICIEAGVKTTKVG-GTMVQVGM 82

>Smik_14.193 Chr14 complement(352041..353171) [1131 bp, 376 aa] {ON}
           YNL134C (REAL)
          Length = 376

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 59/141 (41%), Gaps = 11/141 (7%)

Query: 174 SICLLGCGVTTGYGAATK--TANVQKGDTVAVFGAGT-VGLSVIQGAK-VRGASRIILVD 229
           S+   G  +T  +G   K      Q+   +  +G  T VG  +IQ AK + G S+II+V 
Sbjct: 149 SLTTAGMVLTHSFGLDMKWEPPKAQRDHPILFWGGATGVGQMLIQLAKKLHGFSKIIVVA 208

Query: 230 INDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALE 289
               +++   ++GA +      D  D   I +  I+     L Y  DC  NT+ ++   +
Sbjct: 209 SRKHEKQL-KDYGADELF----DYHDADVIEQ--IKKKHNNLTYLVDCVSNTETIQQVYK 261

Query: 290 ACHKGWGTSVIIGVAAAEEEI 310
                   ++I      E+ I
Sbjct: 262 CAADDLDATIIQLTTLTEKNI 282

>TPHA0F02090 Chr6 (465913..466995) [1083 bp, 360 aa] {ON} 
          Length = 360

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 38/95 (40%), Gaps = 2/95 (2%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGV-TNVKPGDHV-IA 96
           +V I+IE   VC +D +  +          ++GHE  G V  VG    T +K GD V + 
Sbjct: 35  DVDIEIEACGVCGSDVHCAASHWGPVKDNQVVGHEIIGKVVKVGPKCNTGIKVGDRVGVG 94

Query: 97  LYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDG 131
                C  C  CK    N C     T G     DG
Sbjct: 95  AQALACLDCNRCKEDHENYCFGNIWTYGGPTYADG 129

>Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W -
           Hypothetical ORF [contig 311] FULL
          Length = 379

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVK--PGDHV-I 95
           ++ ++IE   VC +D + +SG       P  +GHE  G + ++G  V   K   GD V +
Sbjct: 50  DIELEIEACGVCGSDIHAVSGDWGRLYKPFAVGHEIIGKISAMGAQVNKEKFHLGDRVGV 109

Query: 96  ALYTAECQKCKFCKSGKTNLC 116
              T  C  C  C   +   C
Sbjct: 110 GAQTNSCGDCTRCSRDRQQNC 130

>TBLA0D05550 Chr4 (1364888..1366012) [1125 bp, 374 aa] {ON}
           Anc_2.133 YNL134C
          Length = 374

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 40/94 (42%), Gaps = 7/94 (7%)

Query: 193 ANVQKGDTVAVFGAGT-VGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKS 251
           A VQK + V ++G  T VG  +IQ +K   A   ++V  + +  K   E+GA        
Sbjct: 169 AKVQKDEPVLIWGGATAVGEMIIQLSKKMNAFSTVIVVASKKHEKKLKEYGADVLF---- 224

Query: 252 DLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMR 285
           D  D   I +  I      + Y  DC  N   ++
Sbjct: 225 DYHDSDVINQ--ITKKYPNIRYLIDCVSNRSTIQ 256

>Kwal_27.12835 s27 complement(1395770..1396864) [1095 bp, 364 aa]
           {ON} YCR105W - Hypothetical ORF [contig 261] FULL
          Length = 364

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 39  EVRIKIEYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESVGEGVTNVK--PGDHV-I 95
           ++ ++IE   VC +D + +SG       P  +GHE  G + ++G  V   K   GD V +
Sbjct: 35  DIELEIEACGVCGSDIHAVSGDWGRLYKPFAVGHEIIGKISAMGAQVNKEKFHLGDRVGV 94

Query: 96  ALYTAECQKCKFCKSGKTNLC 116
              T  C  C  C   +   C
Sbjct: 95  GAQTNSCGGCTRCSRDRQQNC 115

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,584,081
Number of extensions: 1520181
Number of successful extensions: 3815
Number of sequences better than 10.0: 203
Number of HSP's gapped: 3694
Number of HSP's successfully gapped: 267
Length of query: 385
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 274
Effective length of database: 40,753,473
Effective search space: 11166451602
Effective search space used: 11166451602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)