Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C019707.351ON26026013810.0
ZYRO0F11726g7.351ON2512589051e-123
Kpol_530.307.351ON2602598981e-122
YLR201C (COQ9)7.351ON2602498701e-118
Suva_10.2967.351ON2602618611e-116
Skud_12.2657.351ON2602618291e-111
KLTH0H01232g7.351ON2572597971e-107
CAGL0A03949g7.351ON2682567811e-104
KLLA0D12320g7.351ON2502517731e-103
SAKL0F11396g7.351ON2542537611e-101
Kwal_56.246447.351ON2582597591e-101
TPHA0F029807.351ON2642657561e-100
TBLA0E004507.351ON2792287571e-100
KNAG0B026207.351ON2652617473e-99
NCAS0E028707.351ON2612627324e-97
NDAI0E044707.351ON2642497317e-97
Smik_12.2607.351ON2602617194e-95
KAFR0L014807.351ON2642496743e-88
Ecym_47227.351ON2532596656e-87
ACL147W7.351ON2462506621e-86
TDEL0D060803.540ON641155740.71
Kwal_27.103658.821ON1619188721.2
ADL164C3.45ON381103692.9
AEL244W8.542ON69088684.5
KLLA0E06557g7.436ON1120104675.9
TPHA0E037601.34ON79683666.6
ZYRO0A06534g5.402ON3749137659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C01970
         (260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   536   0.0  
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   353   e-123
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   350   e-122
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   339   e-118
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   336   e-116
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   323   e-111
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   311   e-107
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   305   e-104
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   302   e-103
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   297   e-101
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   296   e-101
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   295   e-100
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   296   e-100
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   292   3e-99
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   286   4e-97
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   286   7e-97
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   281   4e-95
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   264   3e-88
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   260   6e-87
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   259   1e-86
TDEL0D06080 Chr4 (1098208..1100133) [1926 bp, 641 aa] {ON} Anc_3...    33   0.71 
Kwal_27.10365 s27 complement(304808..309667) [4860 bp, 1619 aa] ...    32   1.2  
ADL164C Chr4 complement(402574..403719) [1146 bp, 381 aa] {ON} S...    31   2.9  
AEL244W Chr5 (178664..180736) [2073 bp, 690 aa] {ON} Syntenic ho...    31   4.5  
KLLA0E06557g Chr5 complement(590423..593785) [3363 bp, 1120 aa] ...    30   5.9  
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    30   6.6  
ZYRO0A06534g Chr1 complement(520491..531740) [11250 bp, 3749 aa]...    30   9.5  

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/260 (100%), Positives = 260/260 (100%)

Query: 1   MISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFN 60
           MISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFN
Sbjct: 1   MISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFN 60

Query: 61  ERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETP 120
           ERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETP
Sbjct: 61  ERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETP 120

Query: 121 VDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTE 180
           VDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTE
Sbjct: 121 VDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTE 180

Query: 181 KDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEE 240
           KDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEE
Sbjct: 181 KDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEE 240

Query: 241 FAWYTLLSTINLVKSQLARG 260
           FAWYTLLSTINLVKSQLARG
Sbjct: 241 FAWYTLLSTINLVKSQLARG 260

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  353 bits (905), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 175/258 (67%), Positives = 211/258 (81%), Gaps = 10/258 (3%)

Query: 4   KRLIAGSRIFARGYRPAGFEYINPINSR-GPLKYGKDSPQYKVLSHTLAKSVPMYGFNER 62
           KRL    ++  R Y P+  E++N  +SR GPL YG DSPQY VLSH L  SVP+ GFNER
Sbjct: 3   KRLC---QVSLRRYHPSKGEHLN--SSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNER 57

Query: 63  AIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVD 122
           AIV+SLN+L YPSTMLSVIG+SN PS  HSSPA+MEL+KFHLV KRL L++++S E    
Sbjct: 58  AIVHSLNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSE---- 113

Query: 123 QLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKD 182
           + PSLE L IKRLE+NVP+A HLSQLLS +S+PGPF VD ++PELHRLSDD+IY+S EKD
Sbjct: 114 EKPSLEDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKD 173

Query: 183 HNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFA 242
           H+DFAWYSKRL +SCAYVSSELFMAQD+S +Y+ETF+FAR+KL R   LGEYYNNTEE+ 
Sbjct: 174 HHDFAWYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWL 233

Query: 243 WYTLLSTINLVKSQLARG 260
           WYTLL++INL KSQ+ARG
Sbjct: 234 WYTLLNSINLAKSQMARG 251

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  350 bits (898), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 171/259 (66%), Positives = 210/259 (81%), Gaps = 4/259 (1%)

Query: 2   ISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNE 61
           + KR   G     R Y P   EY+ P  +  PL YGKDS QYK+LSH+L  SVP +GFNE
Sbjct: 6   VPKRTAFG---LTRFYHPNPKEYV-PQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNE 61

Query: 62  RAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPV 121
           RAIVNS+N LGYPS++LSVIGSSN PSF HSS ALMELLKF+LV KR  L+E+I L+TPV
Sbjct: 62  RAIVNSINLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPV 121

Query: 122 DQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEK 181
           ++LPSLE L+IKRL+M+VP+  HLSQL++QLSIPGPFL D S+PELHRL+DDMIYFS+EK
Sbjct: 122 EELPSLEDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEK 181

Query: 182 DHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEF 241
           DH DFAWY+KR+ VS AY+SS+LFMAQDRSP Y +TFEFA++KL R+  LG+YYNN EE+
Sbjct: 182 DHPDFAWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEY 241

Query: 242 AWYTLLSTINLVKSQLARG 260
           AWY L+++IN+ KS+ ARG
Sbjct: 242 AWYVLMNSINMAKSKAARG 260

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  339 bits (870), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 166/249 (66%), Positives = 203/249 (81%), Gaps = 2/249 (0%)

Query: 13  FARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNELG 72
           F R Y     E++ PI+ + PL YGK+SPQYKVLS  L K VP +GF+ER+IV SLNELG
Sbjct: 13  FFRLYHSNPIEHVKPIHIK-PLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELG 71

Query: 73  YPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLE-TPVDQLPSLEHLV 131
           YPS+M+S IG+ N PSFFHSS A+MEL+KF LVDKR  LTE I+ + TP  +LPSLEHL+
Sbjct: 72  YPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLL 131

Query: 132 IKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYSK 191
           +KRLEM+ P+  HLS+L+SQL+IP  FL + ++PELHRLSDDMIYFS EKDH+D AWY+K
Sbjct: 132 LKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAK 191

Query: 192 RLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLSTIN 251
           RLAVS  Y+ S+LFMAQD+S +YKETF FA++KLHRV  LGEYYNNTEEFAWYTL+ST+N
Sbjct: 192 RLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVN 251

Query: 252 LVKSQLARG 260
           L+KSQL RG
Sbjct: 252 LIKSQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  336 bits (861), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 166/261 (63%), Positives = 205/261 (78%), Gaps = 2/261 (0%)

Query: 1   MISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFN 60
           M S+  +  +    R Y     E++NP++ + PL YGK SPQYKVLS  L + VP +GF 
Sbjct: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIK-PLAYGKQSPQYKVLSLALQEYVPKHGFT 59

Query: 61  ERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLE-T 119
           ER+IV SLN+LGYPS+M+S IG+SN PSF HSS A+MELLKF LVDKR  LTE I+ + T
Sbjct: 60  ERSIVESLNKLGYPSSMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVT 119

Query: 120 PVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFST 179
           P  +LPSLEHL++KRLEM+ PV + L+ L+SQL+IP  FL + ++PELHRLSDDMIYFS 
Sbjct: 120 PHYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSN 179

Query: 180 EKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTE 239
           EKDH+D AWY+KRLAVS  Y+ S+LFMAQD+S D+ ETF FA++KLHRV  LGEYYNNTE
Sbjct: 180 EKDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTE 239

Query: 240 EFAWYTLLSTINLVKSQLARG 260
           EFAWYTL+ST+NLVKSQLARG
Sbjct: 240 EFAWYTLMSTVNLVKSQLARG 260

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  323 bits (829), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/261 (61%), Positives = 202/261 (77%), Gaps = 2/261 (0%)

Query: 1   MISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFN 60
           M  + +      F R Y     E++ P++ + PL YGK SPQYKVLS  L + VP +GF+
Sbjct: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIK-PLTYGKQSPQYKVLSLALLEYVPKHGFS 59

Query: 61  ERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLE-T 119
           ER+IV SLN+LGYPS+M+S IG+SN PSFFHSS A+MEL+KF LVDKR  LTE I+ + T
Sbjct: 60  ERSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVT 119

Query: 120 PVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFST 179
              +LPSLEHL++KRLEM+  +   L+ L+SQL++P   L + ++PELHRLSDDMIYFS 
Sbjct: 120 SRYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSN 179

Query: 180 EKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTE 239
           E+DH+D AWY+KRLAVS  Y+ S+LFMAQD+S D+KETF FA+EKLH+V  LGEYYNNTE
Sbjct: 180 EEDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTE 239

Query: 240 EFAWYTLLSTINLVKSQLARG 260
           EFAWYTL+ST+NLVKSQLARG
Sbjct: 240 EFAWYTLMSTVNLVKSQLARG 260

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  311 bits (797), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 195/259 (75%), Gaps = 6/259 (2%)

Query: 6   LIAGSRIFARG-YRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAI 64
           ++A SRI AR  Y P+  E+    +S  PL YG  S Q+KVL H L K VP YGFNERA+
Sbjct: 1   MLALSRILARRLYHPSALEH-QLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERAL 59

Query: 65  VNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENIS---LETPV 121
           V SLN+L    ++LSVIG+SN PSF ++SPA++EL+KFHLV KR  LT+ +      +P 
Sbjct: 60  VASLNDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPA 119

Query: 122 DQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEK 181
           +  P+LE L  +RLE+N P+A HL+QLLS LSIPG FLV  ++PELHRLSDDM+YFS E 
Sbjct: 120 EP-PALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEP 178

Query: 182 DHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEF 241
           D NDFAWYSKR+A+SCA+VSSELFMAQDRS +Y +TFEFA EKLH VS LG+YYNNTEE+
Sbjct: 179 DANDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEY 238

Query: 242 AWYTLLSTINLVKSQLARG 260
            WYTLL ++NL KSQL R 
Sbjct: 239 MWYTLLMSVNLAKSQLTRS 257

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  305 bits (781), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 138/256 (53%), Positives = 192/256 (75%), Gaps = 1/256 (0%)

Query: 4   KRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERA 63
           ++ ++G     R Y P   EY+NP     PL Y  +SP++K+LSHT+  SVP +GF E+A
Sbjct: 13  QKQVSGLLSAVRRYHPTSNEYVNP-KVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKA 71

Query: 64  IVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVDQ 123
           IVNSLN +  PS ML+ IG+SN  +F HSSPA+MEL+KF LV+KR  + E I+      +
Sbjct: 72  IVNSLNAMKMPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEASK 131

Query: 124 LPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDH 183
           LPSLE L++KRL+M+VP+A HL+Q+ +QL +P  F+ + S+PEL RL+DDMIY+S EKDH
Sbjct: 132 LPSLESLLLKRLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDH 191

Query: 184 NDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAW 243
           +DFAWY+KR A++  Y++S+ FMAQD+S ++ ET EFA++KLH+V TLG+YYNN EEF W
Sbjct: 192 HDFAWYTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGW 251

Query: 244 YTLLSTINLVKSQLAR 259
           +TL+S +NL KSQ+AR
Sbjct: 252 FTLMSAVNLTKSQMAR 267

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  302 bits (773), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 150/251 (59%), Positives = 193/251 (76%), Gaps = 2/251 (0%)

Query: 10  SRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLN 69
           SR+F R Y P   E+  P   + PL YG DS Q+KVLS+ L K VP YGFNERAIV SLN
Sbjct: 2   SRVFTRLYHPNNLEHALPKIIK-PLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLN 60

Query: 70  ELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVDQLPSLEH 129
           ELG  S+ LSV+GSSN PSFF+ SP+++EL+KFHLV KR  L  ++ L++    LP L+ 
Sbjct: 61  ELGMGSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLDSD-KPLPDLKT 119

Query: 130 LVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWY 189
           L ++RL++N  VA HLSQLLS +S+PG FL   ++ ELH+L+DDMI++S E+DHNDFAWY
Sbjct: 120 LFLQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWY 179

Query: 190 SKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLST 249
           SKR+A+S AYVSSELFMAQD+S +++ET EFA+ KL++VS LG  YNNTEE+ W+TLLS+
Sbjct: 180 SKRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSS 239

Query: 250 INLVKSQLARG 260
           INL KSQ+ RG
Sbjct: 240 INLAKSQITRG 250

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  297 bits (761), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 156/253 (61%), Positives = 199/253 (78%), Gaps = 3/253 (1%)

Query: 8   AGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNS 67
           A S+I  RGY P   E+ +      PL Y KDSPQ+K+L++ L + VP YGFNERA+ +S
Sbjct: 5   AFSKIARRGYHPNNLEHASS-KVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSS 63

Query: 68  LNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVDQLPSL 127
            ++LGY S+ LSV+G+SN PSFF+SSPA++ELLKFHLV KR +LT+ ++  T   + PSL
Sbjct: 64  CSDLGYSSSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGVADGTL--ESPSL 121

Query: 128 EHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFA 187
           E+L +KRLEMN P+A HLSQLLS L++PG FL +Y++PELHRLSDDM+YFS E DHNDFA
Sbjct: 122 ENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFA 181

Query: 188 WYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLL 247
           WYSKRLA+S AYVSSELFMAQD+S DY++T +FA+EKL  +  LGE YNN EE+AWYTLL
Sbjct: 182 WYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLL 241

Query: 248 STINLVKSQLARG 260
           S+I+L KSQ+ R 
Sbjct: 242 SSISLAKSQMTRS 254

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  296 bits (759), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 144/259 (55%), Positives = 187/259 (72%), Gaps = 11/259 (4%)

Query: 12  IFARGYRPAGFEYINP-------INSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAI 64
           + AR +R  G  +  P            PL YG  S Q+KVL H L   VP YGFNERA+
Sbjct: 1   MLARSFRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERAL 60

Query: 65  VNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLE---TPV 121
           V SLN+LG  S +LS IG+ N P   +SSPA++EL+KFHLV KR  LT+++ +    +P 
Sbjct: 61  VASLNDLGLGSQVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPA 120

Query: 122 DQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEK 181
           +  P+LE L  KRLE+N+P+A+H++QLL+ L++PG FL+  ++PELHRLSDDMIYFS E 
Sbjct: 121 EP-PALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEP 179

Query: 182 DHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEF 241
           D NDFAWYSKR A+SCA+VSSELFMAQD+SP+Y +TFEFA +KLH V+ LG+YY NTEE+
Sbjct: 180 DANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEY 239

Query: 242 AWYTLLSTINLVKSQLARG 260
            WYTLL ++NL KSQ+ R 
Sbjct: 240 MWYTLLMSVNLAKSQITRS 258

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  295 bits (756), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 204/265 (76%), Gaps = 6/265 (2%)

Query: 1   MISK-RLI-AGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYG 58
           MI++ RLI   S + AR + PA  EY+ P N   P  Y KDSPQ+K+LSH +  +V  +G
Sbjct: 1   MINRGRLIFRKSGVNARFFHPATDEYVLP-NKLSPCTYTKDSPQFKILSHAIDNTVTKFG 59

Query: 59  FNERAIVNSLNELGY--PSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENIS 116
           F+ERAI+ ++ EL     STMLS IGSSN PSF HSSP++MELLKF+LV KR  + E + 
Sbjct: 60  FSERAIIEAMKELKIENQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLD 119

Query: 117 -LETPVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMI 175
            L    ++LPSLE L++KRLEM++P+ KH+S  +SQL IPGPFL+D ++PELHRL+DDMI
Sbjct: 120 PLTMQQEELPSLESLLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMI 179

Query: 176 YFSTEKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYY 235
           YFS EKDH+DFAWYSKRL VS AY+SS+LFMAQD S +YKET +FA++KL +V  LG+YY
Sbjct: 180 YFSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYY 239

Query: 236 NNTEEFAWYTLLSTINLVKSQLARG 260
           NNTEE+AWY LL+++N+VKS+++R 
Sbjct: 240 NNTEEYAWYVLLNSVNMVKSRMSRA 264

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  296 bits (757), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 138/228 (60%), Positives = 183/228 (80%), Gaps = 2/228 (0%)

Query: 33  PLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNELGYPSTMLSVIGSSNGPSFFHS 92
           PL YGKDS QY++L   +  SVP +GF ERAI+NS+N+LGY S+M+SV+GSSN  +  HS
Sbjct: 54  PLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYNSSMISVLGSSNTHNILHS 113

Query: 93  SPALMELLKFHLVDKRLNLTENISLETPVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQL 152
           SPA++ELLKF+LV KRL L+E I  ET    LPSLE+L++KRL+M+  +   L++++++L
Sbjct: 114 SPAVLELLKFNLVSKRLKLSEGIDPETK--DLPSLEYLLLKRLQMDKAIQSRLNEMITKL 171

Query: 153 SIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSP 212
           SIPG FL + S+PEL RLSDDMIYFS EKDH+D AWYSKRLAVS  Y++S++FMAQD S 
Sbjct: 172 SIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRLAVSTTYIASQIFMAQDTSV 231

Query: 213 DYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLSTINLVKSQLARG 260
           D  +T EFA++KL++V  LGEYYNNTEEF W+TL++++N+VKSQLAR 
Sbjct: 232 DCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIVKSQLARS 279

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  292 bits (747), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 193/261 (73%), Gaps = 9/261 (3%)

Query: 2   ISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNE 61
           +S+R +  +R+    Y P   EY N      PL Y  DSPQ ++L+H L   VP +GF E
Sbjct: 10  VSRRALLSTRL----YHPNPIEYANS-TVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTE 64

Query: 62  RAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENIS---LE 118
           RA++ S+  +GY S+M+SV+G+SN PS FHSSPA+MEL+KF+LV KR  LTE+++   L 
Sbjct: 65  RALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLG 124

Query: 119 TPVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFS 178
           +P   LPSLEHL++KRL+M+VP++K L  L +QL++P  F+V+ ++PEL RLSDDMIYFS
Sbjct: 125 SPA-ALPSLEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFS 183

Query: 179 TEKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNT 238
            EKDH D AWYSKRL VS AY +S+LFMAQD S + ++T EFAR+KLHR+ TLGEYYNN 
Sbjct: 184 NEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNV 243

Query: 239 EEFAWYTLLSTINLVKSQLAR 259
           EE+AWY++++T+N  K+  +R
Sbjct: 244 EEYAWYSIMTTVNRAKAGFSR 264

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  286 bits (732), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 196/262 (74%), Gaps = 3/262 (1%)

Query: 1   MISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFN 60
           M+++ ++       R Y P+  EY+ P  +  PL Y K+S QYK+LS+ L K VP +GF 
Sbjct: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPA-TLSPLTYNKESVQYKILSNALTKWVPKHGFK 59

Query: 61  ERAIVNSLNELGYPSTMLSVIGSSNGPSFFHS-SPALMELLKFHLVDKRLNLTENISLET 119
           E+AI +SLNELG+ S++LSVIG+SN P+ F S SPA+MEL+KF LV KR  LTEN+  +T
Sbjct: 60  EKAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDT 119

Query: 120 -PVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFS 178
            P ++LPSLE L++KRLEM+  + K +  L ++L+ P  FL D ++PELHRLSDDMIYFS
Sbjct: 120 TPKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFS 179

Query: 179 TEKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNT 238
            EKDH+D AWY+KRL VSCAYVSS+L+MAQD S D+++T  FA++KLHR+  LGEYYNNT
Sbjct: 180 NEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNT 239

Query: 239 EEFAWYTLLSTINLVKSQLARG 260
           EE+AWY  + + NLV+++LAR 
Sbjct: 240 EEYAWYMFMVSTNLVRARLARS 261

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  286 bits (731), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 183/249 (73%), Gaps = 4/249 (1%)

Query: 15  RGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNELGYP 74
           R +     EY     +  PL Y KDS QYK+LS+ L K VP  GF + AI +SLNEL   
Sbjct: 17  RAFHSNTLEYAKAA-TLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELDLS 75

Query: 75  STMLSVIGSSNGPSFFHS-SPALMELLKFHLVDKRLNLTENIS--LETPVDQLPSLEHLV 131
           S++ SV+GSSN PS F S SPA+MELLKF LV KR  LTENI+  +ET  D+LPSLE L+
Sbjct: 76  SSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLL 135

Query: 132 IKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYSK 191
           I+RL+M+ P+   LS L +QL IP P L + ++PEL  LSDD+IYFS EKDH+D AWY+K
Sbjct: 136 IERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAK 195

Query: 192 RLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLSTIN 251
           RL VSCAYVSS+L+M ++   ++ +T +FA++KLHR+  LGEYYNNTEE+AWYTL+ ++N
Sbjct: 196 RLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMN 255

Query: 252 LVKSQLARG 260
           LVK++LARG
Sbjct: 256 LVKARLARG 264

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  281 bits (719), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 161/261 (61%), Positives = 205/261 (78%), Gaps = 2/261 (0%)

Query: 1   MISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFN 60
           M+ + ++       R Y P   E++   + + PL YGK+SPQYKVLS  L + VP +GF+
Sbjct: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIK-PLTYGKESPQYKVLSLALEQYVPKHGFS 59

Query: 61  ERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLE-T 119
           ER+IV SLNELGYPS+M+S I +SN PSFFHSS A+MEL+KF LVDKR  LTE I+ + T
Sbjct: 60  ERSIVESLNELGYPSSMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVT 119

Query: 120 PVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFST 179
           P  +LPSLEHL+++RLEM+ P+   LS+L+SQL+IP  FL + ++PELHRLSDDMIYFS 
Sbjct: 120 PQYKLPSLEHLLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSN 179

Query: 180 EKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTE 239
           EKDH+D AWY+KRLAVS  Y+ S+LFMAQD+S +YK+TF+FA+ KL+RV  LGEYYNNTE
Sbjct: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTE 239

Query: 240 EFAWYTLLSTINLVKSQLARG 260
           EFAWYTL+ST+NLVKSQL RG
Sbjct: 240 EFAWYTLMSTVNLVKSQLVRG 260

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  264 bits (674), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 189/249 (75%), Gaps = 5/249 (2%)

Query: 11  RIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNE 70
           +   R Y PA  EY+NP  +  PL Y  DS Q K+LSH+L + VP  GFNE++I+ S+N+
Sbjct: 20  KCLRRLYHPASNEYVNP-TTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSIND 78

Query: 71  LGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVDQLPSLEHL 130
           LGY S+M+SVIG+SN PSF HSSPA++EL+K++LV KR+ LT++ +  T      +L+ L
Sbjct: 79  LGYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTKDTNDNTTT----TLKEL 134

Query: 131 VIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYS 190
           ++KRLEM++P++  L  L +QL+ PG F+ D S+PEL +L+DDMI+FS EKDH+D AWYS
Sbjct: 135 LLKRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYS 194

Query: 191 KRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLSTI 250
           KRLAVS AYV+S++FM QD S +++ T +FA +K+ RV  LGEYYNN EE+AW+TL+++I
Sbjct: 195 KRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSI 254

Query: 251 NLVKSQLAR 259
           NLVKSQ +R
Sbjct: 255 NLVKSQFSR 263

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  260 bits (665), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 131/259 (50%), Positives = 179/259 (69%), Gaps = 13/259 (5%)

Query: 7   IAGSRIFARGYRPAGFEYINPI-----NSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNE 61
           I   RI   G+R   F ++N       N+  PL YG+ SPQYKVL+  L K VP  GF +
Sbjct: 3   IRCHRIMLGGFRR--FYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKD 60

Query: 62  RAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPV 121
            AIV++ NELGY S +L+ IG++N P+ F+ S ++ EL+KFHLV KR  L E+       
Sbjct: 61  SAIVDAANELGYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQED------Q 114

Query: 122 DQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEK 181
           +   +LE L +KRLE N  +  HL ++LS L+IPG FLV+  +PEL +L+DDMIY+STEK
Sbjct: 115 EGTKTLEELFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEK 174

Query: 182 DHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEF 241
           D ND AWYSKRLAVS AY+S+ELFMA+D SP+++ T EFA+ +++++  +G  YNN EEF
Sbjct: 175 DFNDLAWYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEF 234

Query: 242 AWYTLLSTINLVKSQLARG 260
           AW+ LL+T+NL +SQL RG
Sbjct: 235 AWFQLLTTVNLARSQLVRG 253

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  259 bits (662), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 132/250 (52%), Positives = 169/250 (67%), Gaps = 6/250 (2%)

Query: 11  RIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNE 70
           R+  R Y P   E+    N   PL Y +DSPQYKVL   L   VP+ GFNERAIV +  +
Sbjct: 3   RVCRRLYHPNTLEHAVG-NRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGD 61

Query: 71  LGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVDQLPSLEHL 130
           LGY S +LS + + N P+  +   A++EL+KFHLV KR+ L +  +         S+E L
Sbjct: 62  LGYGSAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALADAAAQGNV-----SMEQL 116

Query: 131 VIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYS 190
            ++R+E + P+A  L+QLLS LS+PG FLV+ +MPEL RLSDD+IY+S EKDH D AWYS
Sbjct: 117 FLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYS 176

Query: 191 KRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLSTI 250
           KR AV+ AYVS+ LFMA+DRSP  +ET  FAR +L +V +LG  YNN EEFAWY LL  +
Sbjct: 177 KRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAM 236

Query: 251 NLVKSQLARG 260
           NLVKSQL RG
Sbjct: 237 NLVKSQLTRG 246

>TDEL0D06080 Chr4 (1098208..1100133) [1926 bp, 641 aa] {ON}
           Anc_3.540 YER041W
          Length = 641

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 69/155 (44%), Gaps = 24/155 (15%)

Query: 42  QYKVLSHTLAKSVPMYGFNERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLK 101
           Q KVL +    SV ++G N +A+++  N  G+PS    +        +FH  P L+  L 
Sbjct: 316 QEKVLKYCSENSVKLFGRNYKALLSKENMEGWPSQTAVMY-------YFH--PYLVPDLD 366

Query: 102 FHLVDKR-LNLTENISLETPVDQLPSLE------HLV-IKRLEMNVPVAKHLSQLLSQLS 153
               D R +N++EN+S +    Q   L+      HL  +   +     A   S +L  L 
Sbjct: 367 RSFFDSRYVNMSENLSYQDI--QFEKLQAYLSDIHLSGVTHFKRWYTEAMQESFVLRHLL 424

Query: 154 IPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAW 188
             GP+L D    E+ +++++  +F  E +     W
Sbjct: 425 NDGPYLYD----EM-KITEEKTFFGNEDNFQYSCW 454

>Kwal_27.10365 s27 complement(304808..309667) [4860 bp, 1619 aa] {ON}
            YML103C (NUP188) - Nucleoporin [contig 36] FULL
          Length = 1619

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 83/188 (44%), Gaps = 28/188 (14%)

Query: 47   SHTLAKSVPMYGFNERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMEL-LKFHLV 105
            S T  KS+ +    E  + +SLNE+G   T+L++  SS+  + F   P L EL L F   
Sbjct: 1350 SFTKIKSLQLPASFEMVLASSLNEVGTIKTVLNLYSSSHLLN-FEEEPVLCELALTF--- 1405

Query: 106  DKRLNLTENISLETPVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQ-------------L 152
                 +TE  S+    ++L S   L    LE  + VA    ++++Q             L
Sbjct: 1406 -----ITELCSINDVAEKLIS-NGLFSVLLESPISVAIQNGKVVAQTQPRLHTIWSDGLL 1459

Query: 153  SIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYSKRLAVSCAYV--SSELFMAQD- 209
            +I    L  +    L      + YFS +   +  +W  + LAVS A V  +S+L M Q  
Sbjct: 1460 TIILQLLSKFGKKVLPECCLFVSYFSKQISSSLSSWTDQTLAVSNAIVKETSQLIMLQRL 1519

Query: 210  -RSPDYKE 216
              + DY+E
Sbjct: 1520 FAALDYQE 1527

>ADL164C Chr4 complement(402574..403719) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL126C
           (MDH2)
          Length = 381

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 42/103 (40%), Gaps = 20/103 (19%)

Query: 26  NPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNER-------------AIVNSLNELG 72
           NP+NS  P+         +++ H  AK  P  G   R             A V SL ELG
Sbjct: 158 NPVNSLVPVMV------RQLIRHAEAKQAPHAGVERRVFGVTQLDMVRASAFVRSLGELG 211

Query: 73  YPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENI 115
                + VIG  +G +       + + L+F L ++R  LT  +
Sbjct: 212 NEVPSVPVIGGHSGETILPLFGPVQQRLQFSL-EQRKKLTHRV 253

>AEL244W Chr5 (178664..180736) [2073 bp, 690 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL074W (YTA6)
          Length = 690

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 5/88 (5%)

Query: 19  PAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNELGYPSTML 78
           PA +EY  P+  R  LK+ +       +   + ++VP  G    +     N    P    
Sbjct: 296 PAKYEYTKPVIRRPQLKFSQPQGSRNKVKAKVLETVPPDGLRSPSPKRGSNSDKSP---- 351

Query: 79  SVIGSSNGPSFFHSSPALMELLKFHLVD 106
            VI SS  P+   +SP  + LL+ ++ D
Sbjct: 352 -VIESSPNPTTDSNSPQEISLLEKNIKD 378

>KLLA0E06557g Chr5 complement(590423..593785) [3363 bp, 1120 aa]
           {ON} some similarities with uniprot|P38167 Saccharomyces
           cerevisiae YBL101C ECM21 Non-essential protein of
           unknown function promoter contains several Gcn4p binding
           elements
          Length = 1120

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 43/104 (41%), Gaps = 22/104 (21%)

Query: 41  PQYKVLSHTLAKSVPMYGFNERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELL 100
           P+YK+L+   A+SVP YG +E              T L  I S++      ++  +++ L
Sbjct: 817 PKYKLLNKKSARSVPPYGIDEF-------------TQLENIKSNSTSRRGSTTSGVIDFL 863

Query: 101 KFHLVDKRLNLTENISLETPVDQLPSLEHLVIKRLEMNVPVAKH 144
                 K  +++ N+ L  P  +          R   N+P+  H
Sbjct: 864 SGRKSRKNSSISNNLDLPKPTTKF---------RTNSNLPIVNH 898

>TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {ON}
           Anc_1.34 YCL039W
          Length = 796

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 28  INSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNELGYPSTMLSVIGSSNG- 86
           ++S+ PLK   D     V++ T+           + ++N+LNE+G+  T +++   S G 
Sbjct: 30  VSSKPPLKTLTDESVNPVMNETVGNVFDKVQLT-KLLINTLNEMGFSDTAIALEKESGGV 88

Query: 87  ---PSFFHSSPALMELLKFHLVD 106
               S  H    L+E  K+  +D
Sbjct: 89  RVESSNVHQLIRLLESGKYEYID 111

>ZYRO0A06534g Chr1 complement(520491..531740) [11250 bp, 3749 aa] {ON}
            highly similar to uniprot|P38811 Saccharomyces cerevisiae
            YHR099W TRA1 Histone acetyltransferase component putative
            ortholog of human TRRAP which is an essential cofactor of
            c-Myc
          Length = 3749

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 56/137 (40%), Gaps = 11/137 (8%)

Query: 18   RPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNELGYPSTM 77
            R      I  +  RG L YG++     V +H+L     ++    R I N   E  Y    
Sbjct: 1172 RNIAISGIKRVYERGKLIYGEEL----VFTHSL-----VFALFRRFIHNCYEEAFYDKRA 1222

Query: 78   LSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVDQLPSLEHLVIKRLEM 137
              VIG          S   ++  +F L+D  L + ++   ETP D   S E L+++ L  
Sbjct: 1223 -GVIGIKTLIEI-GISAKFLKRSQFELIDGLLFVLKDTPSETPADITESAEELLLQVLRT 1280

Query: 138  NVPVAKHLSQLLSQLSI 154
             +     L+  +SQ +I
Sbjct: 1281 TLSDVNELNSKISQNTI 1297

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,324,363
Number of extensions: 1239906
Number of successful extensions: 3508
Number of sequences better than 10.0: 39
Number of HSP's gapped: 3583
Number of HSP's successfully gapped: 39
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)