Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0C019607.352ON1071075303e-71
ZYRO0F11748g7.352ON1091064038e-52
TPHA0F029907.352ON1071063942e-50
NCAS0E028607.352ON1051053909e-50
Suva_10.2957.352ON1141063873e-49
KAFR0L014907.352ON1071073854e-49
YLR200W (YKE2)7.352ON1141033847e-49
Skud_12.2647.352ON1141063796e-48
Kpol_530.297.352ON1071063733e-47
NDAI0E044607.352ON1061033724e-47
Smik_12.2597.352ON1141063612e-45
TBLA0E004407.352ON1151003605e-45
Ecym_47217.352ON1071013579e-45
CAGL0A03971g7.352ON1061003491e-43
KLLA0D12298g7.352ON115983449e-43
KNAG0B026107.352ON1191033441e-42
KLTH0H01210g7.352ON1131043431e-42
SAKL0F11418g7.352ON1151043371e-41
Kwal_56.246487.352ON1131043334e-41
ACL146C7.352ON1071023335e-41
KLTH0E14014g8.798ON48668750.067
KLLA0C14476gna 1ON19642690.35
KAFR0D004301.46ON45629660.98
TDEL0G024502.315ON34150651.1
Suva_6.1047.186ON117037641.8
NDAI0D026005.88ON1167104641.8
KLLA0F18150g4.31ON23132597.4
Skud_7.4263.476ON39741598.0
ZYRO0B16412g5.706ON137250599.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0C01960
         (107 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   208   3e-71
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   159   8e-52
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   156   2e-50
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   154   9e-50
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   153   3e-49
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   152   4e-49
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   152   7e-49
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   150   6e-48
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   148   3e-47
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   147   4e-47
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   143   2e-45
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   143   5e-45
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   142   9e-45
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   139   1e-43
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   137   9e-43
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   137   1e-42
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   136   1e-42
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   134   1e-41
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   132   4e-41
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   132   5e-41
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    33   0.067
KLLA0C14476g Chr3 complement(1265344..1265934) [591 bp, 196 aa] ...    31   0.35 
KAFR0D00430 Chr4 complement(62690..64060) [1371 bp, 456 aa] {ON}...    30   0.98 
TDEL0G02450 Chr7 (467216..468241) [1026 bp, 341 aa] {ON} Anc_2.3...    30   1.1  
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    29   1.8  
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    29   1.8  
KLLA0F18150g Chr6 (1664428..1665123) [696 bp, 231 aa] {ON} some ...    27   7.4  
Skud_7.426 Chr7 (713299..714492) [1194 bp, 397 aa] {ON} YGR122W ...    27   8.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...    27   9.9  

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  208 bits (530), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 107/107 (100%), Positives = 107/107 (100%)

Query: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60
           MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE
Sbjct: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60

Query: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGAQ 107
           QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGAQ
Sbjct: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGAQ 107

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  159 bits (403), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 77/106 (72%), Positives = 92/106 (86%)

Query: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60
           MS+LAA YQ LQ ELE  ++ARQKLETQLQENKIV +EF+ LK D++VYKLTGNVLLPVE
Sbjct: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60

Query: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106
           Q +A +NV+KRLEFIQTEI RCENN+K KQ+EQE+++AELIKLR  
Sbjct: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSG 106

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  156 bits (394), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 91/106 (85%)

Query: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60
           MSD+AA YQ++Q ELE L+IARQKLETQLQENKIV++EF++L EDT +YKLTGNV+LP+E
Sbjct: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60

Query: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106
           Q EA SNV KRLEFI+ EI RCE N+K KQ E +KLR EL+K+RGA
Sbjct: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  154 bits (390), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (86%)

Query: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60
           M+DL A YQ+LQSELE  +IARQKLETQLQENKIV +EF +L ++T+VYKLTGNVLLPVE
Sbjct: 1   MADLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVE 60

Query: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRG 105
           Q EA SNV KRLEFIQ+EI +CE N+K KQ+E EK+RAE+IK+RG
Sbjct: 61  QDEARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKMRG 105

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  153 bits (387), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 77/106 (72%), Positives = 89/106 (83%)

Query: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60
           MS+L A YQ LQSELE  ++ARQKLETQLQENKIV+EEF +LKEDT VYKLTGNVLLPVE
Sbjct: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60

Query: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106
           QSEA  NV KRLEFI+TEI RCE N++ KQ+E E++R EL+KL  A
Sbjct: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNA 106

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  152 bits (385), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 77/107 (71%), Positives = 89/107 (83%)

Query: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60
           MS+LAA YQ LQSELE L++ARQKLETQLQENKIV++EF  LKE+TQVYKLTGNVLLP+E
Sbjct: 1   MSELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIE 60

Query: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGAQ 107
           Q EA  NV KRLEFI+ EI RCE N+K+KQ E E +R EL+KLR  Q
Sbjct: 61  QDEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLRSGQ 107

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  152 bits (384), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 76/103 (73%), Positives = 90/103 (87%)

Query: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60
           MS+L A YQ LQ+ELE  ++ARQKLETQLQENKIV+EEF +L+EDT VYKLTGNVLLPVE
Sbjct: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60

Query: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKL 103
           QSEA +NV KRLEFI+TEI RCE N++ KQ+E EK+R+ELIKL
Sbjct: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  150 bits (379), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 76/106 (71%), Positives = 87/106 (82%)

Query: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60
           MS+L A YQ LQSELE  ++ARQKLETQLQENKIV+EEF ++ +DT VYKLTGNVLLPVE
Sbjct: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60

Query: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106
           QSEA  NV KRLEFI+TEI RCE N++ KQ E EK+R ELIKL  A
Sbjct: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNA 106

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  148 bits (373), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 88/106 (83%)

Query: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60
           MSDLA  YQ +Q ELE +++AR++LETQLQENKIV+EEF  LKEDTQVYKLTGNVLLPVE
Sbjct: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60

Query: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106
           Q EA SNV KRLEFI+ EI +CE+N+K+KQ E  KLR EL+K RG 
Sbjct: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGG 106

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  147 bits (372), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 89/103 (86%)

Query: 2   SDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQ 61
           S+L + YQ LQ ELE L++ARQKLETQLQENKIV EEF++L  ++QVYKLTGNVLLPV+Q
Sbjct: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62

Query: 62  SEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLR 104
            EA+SNV KRLEFIQTEI RCENN+K KQQE + +R+E++K+R
Sbjct: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  143 bits (361), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 72/106 (67%), Positives = 86/106 (81%)

Query: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60
           MS+L   YQ LQ ELE  ++ARQKLETQLQENKIV+EEF +L+E+T VYKLTGNVLLPV+
Sbjct: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60

Query: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106
           QSEA  NV KRLEFI+ EI RCE N+K KQ++ EK+R +LIKL  A
Sbjct: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNA 106

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  143 bits (360), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 85/100 (85%)

Query: 2   SDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQ 61
           ++LA  YQ  Q+ELE  ++ RQKLETQLQENKIV++EF +LKE+T+V+KLTGNVLLP+EQ
Sbjct: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63

Query: 62  SEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELI 101
            EA SN+ KRLEFIQTEI RCE N+KAKQ E EK+R+EL+
Sbjct: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  142 bits (357), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 81/101 (80%)

Query: 4   LAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQSE 63
           +AA Y  LQ ELE L++ RQKLETQLQENKIV+EE   LKED QVYKLTG VLLPVE  E
Sbjct: 6   VAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEE 65

Query: 64  ANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLR 104
           ANSNV+KRLEFIQ EI RCE N+K KQQE E+ R ELIKLR
Sbjct: 66  ANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLR 106

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  139 bits (349), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%)

Query: 2   SDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQ 61
           ++L A YQ+LQ+ELE LV ARQKLETQLQENKIV+EEF+ LKEDT VYKLTGNVLLPVE 
Sbjct: 3   AELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVEH 62

Query: 62  SEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELI 101
            +A +NV KRLEFI  EI RCE+N+++KQQE E +R +LI
Sbjct: 63  DDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  137 bits (344), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 79/98 (80%)

Query: 8   YQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQSEANSN 67
           Y  LQ ELE L++ARQKLETQLQENKIVS+EFS LK+D  VYKLTG VLLPVEQ EA  N
Sbjct: 10  YTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKGN 69

Query: 68  VAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRG 105
           V KRLEFI+ EI RCE N+K+KQQE E  R+EL+KLR 
Sbjct: 70  VEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  137 bits (344), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 71/103 (68%), Positives = 83/103 (80%)

Query: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60
           MS+ AA YQ  QS LE L++ARQKLETQLQENKIV EEF  LKED++VYKLTG+VLLPV+
Sbjct: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60

Query: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKL 103
           Q EA +NV KRLEFI  EI RCE N+K KQ+  E LR+EL+KL
Sbjct: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  136 bits (343), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 81/104 (77%)

Query: 3   DLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQS 62
           DL   Y   Q ELE LVIARQKLETQLQENKIV +EF  L+E+TQVYKLTGNVLLPVEQ 
Sbjct: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66

Query: 63  EANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106
           EA SNV+KRLEFI  EI RCE N+K KQ   EKLRAEL++ + A
Sbjct: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  134 bits (337), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (79%)

Query: 4   LAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQSE 63
           L+  Y  +QSELE LVIARQKLETQLQENKIV +EF  L++++QVYKLTG VLLPVEQ E
Sbjct: 9   LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68

Query: 64  ANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGAQ 107
           A  NV KRL+FI+ EI RCE N+K KQ + E+LR EL++LR A+
Sbjct: 69  AKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRTAK 112

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  132 bits (333), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 81/104 (77%)

Query: 3   DLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQS 62
           +L   Y   Q ELE LV ARQ+LETQLQENKIV +EF  LKE+TQVYKLTG VLLPVEQ 
Sbjct: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66

Query: 63  EANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106
           EA SNV+KRLEFI TEI RCE+N+K KQ   EKLRAEL++ + A
Sbjct: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEA 110

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  132 bits (333), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 79/102 (77%)

Query: 4   LAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQSE 63
           +A  Y  LQ ELE LV+ RQKLETQLQENKIV+EE   L+ +TQVYKLTG VLLPVEQ E
Sbjct: 6   VATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQEE 65

Query: 64  ANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRG 105
           A  NV+KRLEFI+ EI RCE N+K KQ+E E  RA L+KLRG
Sbjct: 66  AEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 33.5 bits (75), Expect = 0.067,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 17  VLVIARQKLETQ---LQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQSEANSNVAKRLE 73
           VL+I+   LE +   + ENK + E+F E+     + K   N++ P + S  N +  K L 
Sbjct: 124 VLLISSNLLEAENPKISENKQLLEKFQEVAPTQVLIKEVENIIKPHDYSPWNKSFTKLLV 183

Query: 74  FIQTEIGR 81
           F QTE  R
Sbjct: 184 FNQTEFDR 191

>KLLA0C14476g Chr3 complement(1265344..1265934) [591 bp, 196 aa]
          {ON} conserved hypothetical protein
          Length = 196

 Score = 31.2 bits (69), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 30 QENKIVSEEFSELKED-TQVYKLTGNVLLPVEQSEANSNVAK 70
          ++NKI + EF E  E   +++ L GN    V Q++ N N+AK
Sbjct: 19 RDNKISTSEFLEASESLVKLFDLLGNAAFVVVQNDLNGNIAK 60

>KAFR0D00430 Chr4 complement(62690..64060) [1371 bp, 456 aa] {ON}
           Anc_1.46 YCL029C
          Length = 456

 Score = 30.0 bits (66), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (75%)

Query: 72  LEFIQTEIGRCENNLKAKQQEQEKLRAEL 100
           LE IQ  I  CENN++  +QE+++L+A+L
Sbjct: 211 LEEIQPTIDACENNIREIEQERDQLKAQL 239

>TDEL0G02450 Chr7 (467216..468241) [1026 bp, 341 aa] {ON} Anc_2.315
           YGL153W
          Length = 341

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 48  VYKLTGNVLLPVEQSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLR 97
           VY+LT   ++P    EA S + +  E IQ+   + +  L A +QEQEK+R
Sbjct: 109 VYELTRRYVVPNILPEAKSKLEQDKEEIQSYFDKVDKVLNAIEQEQEKVR 158

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 29.3 bits (64), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 64  ANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAEL 100
            +S +  R E I  EIG CEN +K +Q + E+ R E+
Sbjct: 739 PSSQIMARNEEILREIGECENEIKIRQMDLERCRQEV 775

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
            Anc_5.88 YGR238C
          Length = 1167

 Score = 29.3 bits (64), Expect = 1.8,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 11/104 (10%)

Query: 4    LAAAYQAL---QSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60
            +A A +AL   Q E+E   +  +KL+ +L+  +I+S        D  V  ++G       
Sbjct: 1060 VATASKALKISQQEVEKYKLLNKKLQLELEREQIMSSS----SPDDSVTGMSGT----TN 1111

Query: 61   QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLR 104
             SE  S+   R   +  +I   E  L   +QE++ ++ E+++L+
Sbjct: 1112 VSEQPSHSTARETHLNMKISNLEAELFIIKQERDSMKDEMLELK 1155

>KLLA0F18150g Chr6 (1664428..1665123) [696 bp, 231 aa] {ON} some
           similarities with uniprot|Q07821 Saccharomyces
           cerevisiae YLL027W ISA1 Mitochondrial matrix protein
           involved in biogenesis of the iron-sulfur (Fe/S) cluster
           of Fe/S proteins isa1 deletion causes loss of
           mitochondrial DNA and respiratory deficiency depletion
           reduces growth on nonfermentable carbon sources
          Length = 231

 Score = 27.3 bits (59), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 22/32 (68%)

Query: 67  NVAKRLEFIQTEIGRCENNLKAKQQEQEKLRA 98
           NVAK+ E +QT+  + + N++ K++ + KLR 
Sbjct: 92  NVAKKGEPLQTQPPKVDENIQPKKRAKRKLRP 123

>Skud_7.426 Chr7 (713299..714492) [1194 bp, 397 aa] {ON} YGR122W
           (REAL)
          Length = 397

 Score = 27.3 bits (59), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 4   LAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKE 44
           L+  +Q LQ +L ++++A  KL +++ ++ I   EF ELKE
Sbjct: 150 LSLEFQLLQ-QLGIVILALSKLRSKVSKDAIADLEFQELKE 189

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W Hypothetical ORF
          Length = 1372

 Score = 27.3 bits (59), Expect = 9.9,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 9   QALQSELEVL--VIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVL 56
           QAL  +L+ +  VI +Q++E Q + +++ + + +ELK    +YK+  +++
Sbjct: 415 QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLI 464

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.125    0.310 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,504,334
Number of extensions: 360547
Number of successful extensions: 2205
Number of sequences better than 10.0: 220
Number of HSP's gapped: 2191
Number of HSP's successfully gapped: 247
Length of query: 107
Length of database: 53,481,399
Length adjustment: 77
Effective length of query: 30
Effective length of database: 44,652,117
Effective search space: 1339563510
Effective search space used: 1339563510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)