Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B051502.153ON1191196253e-85
ZYRO0G06534g2.153ON112943553e-44
Skud_8.1772.153ON1301023531e-43
CAGL0I02728g2.153ON1111123502e-43
Smik_8.1942.153ON129963504e-43
Suva_15.3132.153ON1321103471e-42
YHR116W (COX23)2.153ON151963481e-42
SAKL0E10934g2.153ON113923414e-42
KLTH0B05148g2.153ON111923293e-40
Ecym_82052.153ON1141073269e-40
Kpol_505.202.153ON112923261e-39
Kwal_33.147762.153ON111923251e-39
NDAI0B043302.153ON127963201e-38
KLLA0F24024g2.153ON1221143173e-38
KNAG0H035202.153ON1091003112e-37
ABR130W2.153ON111913102e-37
KAFR0F007302.153ON1081113077e-37
NCAS0B070002.153ON108882772e-32
TPHA0F018702.153ON180732581e-28
TBLA0B012402.153ON119962104e-22
KLTH0C06732g7.390ON71475750.095
KAFR0H004905.648ON72844661.2
Ecym_22826.135ON56991661.2
KNAG0B030405.639ON53046642.3
TDEL0A069806.284ON6848594.1
Cgla_YGOB_Anc_6.2846.284ON7235594.3
Suva_10.665.205ON7227585.1
KAFR0A066704.144ON22434606.0
KLTH0H02552g6.284ON7745586.7
NDAI0F017506.34ON16234597.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B05150
         (119 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON...   245   3e-85
ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {O...   141   3e-44
Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W (...   140   1e-43
CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {O...   139   2e-43
Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W (...   139   4e-43
Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W...   138   1e-42
YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}  COX23Mitoch...   138   1e-42
SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly ...   135   4e-42
KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar...   131   3e-40
Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON} ...   130   9e-40
Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON} (55992..56...   130   1e-39
Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {O...   129   1e-39
NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2....   127   1e-38
KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} simil...   126   3e-38
KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.15...   124   2e-37
ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic hom...   124   2e-37
KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON...   122   7e-37
NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2....   111   2e-32
TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.15...   103   1e-28
TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON...    86   4e-22
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    33   0.095
KAFR0H00490 Chr8 complement(83827..86013) [2187 bp, 728 aa] {ON}...    30   1.2  
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    30   1.2  
KNAG0B03040 Chr2 complement(586400..587992) [1593 bp, 530 aa] {O...    29   2.3  
TDEL0A06980 Chr1 complement(1223058..1223264) [207 bp, 68 aa] {O...    27   4.1  
Cgla_YGOB_Anc_6.284 Chr11 (1060349..1060567) [219 bp, 72 aa] {ON...    27   4.3  
Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}...    27   5.1  
KAFR0A06670 Chr1 (1352405..1353079) [675 bp, 224 aa] {ON} Anc_4....    28   6.0  
KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa...    27   6.7  
NDAI0F01750 Chr6 (430632..431120) [489 bp, 162 aa] {ON} Anc_6.34...    27   7.8  

>TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score =  245 bits (625), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 1   MSNARPEKPSEDEKILSSEPNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMF 60
           MSNARPEKPSEDEKILSSEPNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMF
Sbjct: 1   MSNARPEKPSEDEKILSSEPNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMF 60

Query: 61  AIKGPSQYYDPCQESAQMSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           AIKGPSQYYDPCQESAQMSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE
Sbjct: 61  AIKGPSQYYDPCQESAQMSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119

>ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116W COX23 Mitochondrial intermembrane space protein
           that functions in mitochondrial
          Length = 112

 Score =  141 bits (355), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 62/94 (65%), Positives = 80/94 (85%)

Query: 26  VKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCLDR 85
           V +  KVDYAP+G  P KFQYYP+ PES ++R  FA+K  SQY+DPCQES++MS NCLDR
Sbjct: 19  VVEPKKVDYAPQGDSPDKFQYYPDKPESSLSRYRFAVKDASQYFDPCQESSRMSFNCLDR 78

Query: 86  NDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           N+Y++++CKEYFDAYRECKKQWL++RR++RS WE
Sbjct: 79  NNYDREMCKEYFDAYRECKKQWLRARRENRSLWE 112

>Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W
           (REAL)
          Length = 130

 Score =  140 bits (353), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 60/102 (58%), Positives = 81/102 (79%)

Query: 18  SEPNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQ 77
           +EP   G + D +KV+Y PK  DPS FQYYP++PE+ +N+  FA+K  SQYYDPC+ES++
Sbjct: 29  AEPAPRGPITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSK 88

Query: 78  MSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           +S  CL+RNDY++  C+EYFDAYRECKKQWL +RR++R QWE
Sbjct: 89  LSFQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130

>CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116w
          Length = 111

 Score =  139 bits (350), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 66/112 (58%), Positives = 86/112 (76%), Gaps = 6/112 (5%)

Query: 10  SEDEKILSS---EPNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPS 66
           + DE I+     +P+V     D  KVDYAPKG D ++++YYP+NPES +N+  FA+K  S
Sbjct: 2   AADEDIIKDGNYDPHVQT---DKDKVDYAPKGVDTTEYRYYPDNPESTLNKYRFAMKDHS 58

Query: 67  QYYDPCQESAQMSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQW 118
           QYYDPCQESA+MS  CL+ NDY++D CKEYFDAYRECKKQWL++RR+DR+ W
Sbjct: 59  QYYDPCQESAKMSFKCLELNDYDRDQCKEYFDAYRECKKQWLEARRKDRTNW 110

>Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W
           (REAL)
          Length = 129

 Score =  139 bits (350), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 60/96 (62%), Positives = 77/96 (80%)

Query: 24  GAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCL 83
           G V D +KV+Y PK  DPS FQYYP++PE+ VN+  FA+K  SQYYDPC+ES+++S  CL
Sbjct: 34  GPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCL 93

Query: 84  DRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           +RNDY++  C+EYFDAYRECKKQWL +RR +R QWE
Sbjct: 94  ERNDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129

>Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W
           (REAL)
          Length = 132

 Score =  138 bits (347), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 82/110 (74%)

Query: 10  SEDEKILSSEPNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYY 69
           S D     ++P   G V D SKV+Y P+  DPS FQYYP++PE+ VN+  FA+KG SQYY
Sbjct: 23  SSDNSAPPTQPARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYY 82

Query: 70  DPCQESAQMSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           DPC+ES+++S  CL+RN Y++  C++YFDAYRECKKQWL +RR +R QWE
Sbjct: 83  DPCEESSKLSFQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132

>YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}
           COX23Mitochondrial intermembrane space protein that
           functions in mitochondrial copper homeostasis, essential
           for functional cytochrome oxidase expression; homologous
           to Cox17p; contains twin cysteine-x9-cysteine motifs
          Length = 151

 Score =  138 bits (348), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 60/96 (62%), Positives = 78/96 (81%)

Query: 24  GAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCL 83
           G V D +KV+Y PK  DPS FQYYP++PE+ VN+  FA+K  SQYYDPC+ES+++S  CL
Sbjct: 56  GPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCL 115

Query: 84  DRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           +RNDY++  C+EYFDAYRECKKQWL +RR++R QWE
Sbjct: 116 ERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151

>SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly
           similar to gnl|GLV|CAGL0I02728g Candida glabrata
           CAGL0I02728g and similar to YHR116W uniprot|P38824
           Saccharomyces cerevisiae YHR116W COX23 Mitochondrial
           intermembrane space protein that functions in
           mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 113

 Score =  135 bits (341), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 57/92 (61%), Positives = 77/92 (83%)

Query: 28  DSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCLDRND 87
           D  KV++ P+  D S F++YP+NPES +N+  FA K PS+Y+DPCQES++MS  CL+ N+
Sbjct: 22  DKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKCLEMNN 81

Query: 88  YNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           Y++D+CKEYFDAYRECKKQWL+SRR++RSQWE
Sbjct: 82  YDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113

>KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar to
           uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 111

 Score =  131 bits (329), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 56/92 (60%), Positives = 76/92 (82%)

Query: 28  DSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCLDRND 87
           D +KVDYAPK  +   F++YP+NPES  N+  FA K  SQ+YDPCQES++MS+ CL+ N+
Sbjct: 20  DKTKVDYAPKNTESGSFKFYPDNPESSFNKYRFAAKDASQFYDPCQESSKMSMKCLELNN 79

Query: 88  YNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           Y++ +C+EYFDAYRECKKQWL++RR++RSQWE
Sbjct: 80  YDRSMCQEYFDAYRECKKQWLQARRRNRSQWE 111

>Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ABR130W
          Length = 114

 Score =  130 bits (326), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 77/107 (71%)

Query: 13  EKILSSEPNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPC 72
           + I S  P     V D +KV++ P   D S FQ+YP++PE+ +NR  F  KG S YYDPC
Sbjct: 8   DHIPSQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPC 67

Query: 73  QESAQMSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           +ES++MS  CL+ N+Y++ LC +YFDAYRECKKQWLK+RR+D S+W+
Sbjct: 68  EESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114

>Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON}
           (55992..56330) [339 nt, 113 aa]
          Length = 112

 Score =  130 bits (326), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 1/92 (1%)

Query: 28  DSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCLDRND 87
           D SKVD+A K  D    ++YP+NPES + +  F  K  SQYYDPCQESAQMS NCLDRN+
Sbjct: 22  DKSKVDFANKD-DKKDLKFYPDNPESTLAKYRFITKETSQYYDPCQESAQMSFNCLDRNN 80

Query: 88  YNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           Y+K  C+ YFDAYRECKKQWL++RRQDRSQWE
Sbjct: 81  YDKSKCRAYFDAYRECKKQWLRARRQDRSQWE 112

>Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {ON}
           YHR116W - Hypothetical ORF [contig 101] FULL
          Length = 111

 Score =  129 bits (325), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 55/92 (59%), Positives = 75/92 (81%)

Query: 28  DSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCLDRND 87
           D SK+DYAP+      +++YP+NPES  N+  FA K  SQ+YDPCQES++MS+ CL+ ND
Sbjct: 20  DKSKIDYAPQDAKAGSYKFYPDNPESSFNKFRFAAKDVSQFYDPCQESSKMSMKCLELND 79

Query: 88  YNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           Y++ +C+EYFDAYRECKKQWL++RR++RSQWE
Sbjct: 80  YDRSMCQEYFDAYRECKKQWLQARRKNRSQWE 111

>NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2.153
           YHR116W
          Length = 127

 Score =  127 bits (320), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 2/96 (2%)

Query: 24  GAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCL 83
              KD+  V++ P  +D S F+YYP++PE G+N+  F +K  S+YYDPCQES+QMS  CL
Sbjct: 33  NTTKDT--VNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCL 90

Query: 84  DRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           DRN++++D C EYFDAYRECKKQWL +RR +RSQW+
Sbjct: 91  DRNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126

>KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} similar
           to uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 122

 Score =  126 bits (317), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 87/114 (76%), Gaps = 4/114 (3%)

Query: 7   EKPSEDEKILSSEPNVNGAVK-DSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGP 65
           EK  + EK+     NV+ +++ + +KV++ P+  D + +++YP++PES +NR  FA+KG 
Sbjct: 12  EKLQQPEKVAE---NVDPSLELNKTKVNFTPEKTDVNTYKFYPDDPESTLNRYRFAVKGA 68

Query: 66  SQYYDPCQESAQMSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           S+YYDPCQES++MS  CL+ N+Y++DLC +YFDAYRECKKQWLK+RR+ R  WE
Sbjct: 69  SEYYDPCQESSKMSFKCLELNNYDRDLCHDYFDAYRECKKQWLKARREKREFWE 122

>KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.153
           YHR116W
          Length = 109

 Score =  124 bits (311), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 75/100 (75%), Gaps = 1/100 (1%)

Query: 20  PNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMS 79
           P V G V     VD+AP G +P +F+Y+P+ P+S  ++  F  KG S++YDPCQES++MS
Sbjct: 11  PAVEG-VSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMS 69

Query: 80  LNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
             CL++NDY++  CK YFDAYRECKKQWLK+RR ++SQWE
Sbjct: 70  FTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109

>ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR116W
          Length = 111

 Score =  124 bits (310), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 57/91 (62%), Positives = 71/91 (78%), Gaps = 1/91 (1%)

Query: 28  DSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCLDRND 87
           D + V++ P   D S FQ+YP+N ES + R   A KGPSQY DPCQESA MS+ CL+RN+
Sbjct: 21  DRAAVNFTP-STDASSFQFYPDNLESPLARYRXAAKGPSQYXDPCQESANMSMKCLERNN 79

Query: 88  YNKDLCKEYFDAYRECKKQWLKSRRQDRSQW 118
           Y++DLC+EYFDAYRECKKQWL +RR+D SQW
Sbjct: 80  YDRDLCREYFDAYRECKKQWLSARRKDNSQW 110

>KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON}
           Anc_2.153 YHR116W
          Length = 108

 Score =  122 bits (307), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 79/111 (71%), Gaps = 8/111 (7%)

Query: 9   PSEDEKILSSEPNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQY 68
           P +D K+++ +  VN   +D         G + +KF+YYP++PES  +R  F  K P++Y
Sbjct: 6   PEQDPKLVTDKTKVNFVQEDP--------GTNTTKFKYYPDDPESAYHRDQFRTKQPTKY 57

Query: 69  YDPCQESAQMSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119
           YDPCQESAQ+S  CL+ N+Y++ LCK+YFDAYRECKKQWL +R+ DRS+WE
Sbjct: 58  YDPCQESAQLSFKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108

>NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2.153
           YHR116W
          Length = 108

 Score =  111 bits (277), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 69/88 (78%)

Query: 32  VDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCLDRNDYNKD 91
           V++ P  ++P  ++Y+P++P  G+N+  F +KG S+YYDPCQE ++MS  CL+RN ++K 
Sbjct: 20  VNFTPDEKNPGSYKYFPDDPVQGLNKYKFIMKGDSEYYDPCQECSEMSRKCLERNPFDKS 79

Query: 92  LCKEYFDAYRECKKQWLKSRRQDRSQWE 119
            C+EYFDAYR+CKK W+K+RR++R QWE
Sbjct: 80  QCQEYFDAYRDCKKMWMKTRRENRKQWE 107

>TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.153
           YHR116W
          Length = 180

 Score =  103 bits (258), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%)

Query: 42  SKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCLDRNDYNKDLCKEYFDAYR 101
           ++F++YP+NPES   +  F  K  SQYYDPC ESA+MS  CLD NDY++D C+ YFDAYR
Sbjct: 101 NRFKFYPDNPESSFAKYRFMSKDSSQYYDPCDESAKMSFKCLDMNDYDRDKCRAYFDAYR 160

Query: 102 ECKKQWLKSRRQD 114
           ECKKQWL++RR +
Sbjct: 161 ECKKQWLRARRNN 173

>TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score = 85.5 bits (210), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 61/96 (63%), Gaps = 5/96 (5%)

Query: 23  NGAVKDSSKVDYAPKGQDP----SKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQM 78
           NG+V  +   + +    DP    + FQY+P+ P S + R  FA K  S++YDPC ESAQM
Sbjct: 21  NGSVVQNDPTNVSFVHHDPDNHVTTFQYFPDKPTSTMTRFNFADKESSKFYDPCHESAQM 80

Query: 79  SLNCL-DRNDYNKDLCKEYFDAYRECKKQWLKSRRQ 113
           S+ C+ D  D +K +C E+F AYR+CKK W+ ++++
Sbjct: 81  SVRCMTDHPDDHKTVCAEFFAAYRDCKKAWIDAKKR 116

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 33.5 bits (75), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 2   SNARPEKPSEDEKILSSEPNVNGAV--KDSSKVDYAPKGQDPSKFQYYPENPESGV-NRL 58
           S+ RPE+ S +E+   S   + G V   D S +DY P+G+ PS +    +  ES   N+ 
Sbjct: 318 SSTRPEETSSEER--KSSALIRGPVLNVDHSLIDYLPQGEKPSLYTALKDLYESITENKF 375

Query: 59  MFAIKGPSQYYDPCQ 73
           +  +  P Q+ +  +
Sbjct: 376 LTGVVSPIQFVETLK 390

>KAFR0H00490 Chr8 complement(83827..86013) [2187 bp, 728 aa] {ON}
           Anc_5.648 YKR067W
          Length = 728

 Score = 30.0 bits (66), Expect = 1.2,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 24/44 (54%)

Query: 3   NARPEKPSEDEKILSSEPNVNGAVKDSSKVDYAPKGQDPSKFQY 46
           NA+  K  +DE I+ + P  + A+   +  +YAP+  +   FQY
Sbjct: 197 NAQISKILDDETIILTSPFKSEAISTPTNFNYAPRVDNTKTFQY 240

>Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii AFL014C
          Length = 569

 Score = 30.0 bits (66), Expect = 1.2,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 13/91 (14%)

Query: 4   ARPEKPSEDEKILSSEPNVNGA--VKDSSKVDYAPK-----GQDPSK--FQYYPENPESG 54
           A+ +  +ED+ I S  PN + +  +K  +K+ +        G D ++   QY P+ P+S 
Sbjct: 129 AKCDDETEDQDI-SPPPNASPSTHLKARTKIVFKQNIAEACGLDMTQRILQYIPQPPQSS 187

Query: 55  VNRLMFAIKGPSQYYDPCQESAQMSLNCLDR 85
           V R +++I   SQY+     S   SLN   R
Sbjct: 188 VKRALYSIGSRSQYH---YSSGAQSLNKFAR 215

>KNAG0B03040 Chr2 complement(586400..587992) [1593 bp, 530 aa] {ON}
           Anc_5.639 YOR043W
          Length = 530

 Score = 29.3 bits (64), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 66  SQYYDPCQESAQMSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSR 111
           SQ+ +  QE  +  ++ L       +  +E+ D   E K QWLK R
Sbjct: 288 SQWGNRTQEGGKTVISSLSLCRLANETTQEFRDTLEEVKSQWLKER 333

>TDEL0A06980 Chr1 complement(1223058..1223264) [207 bp, 68 aa] {ON}
           Anc_6.284 YMR194C-B
          Length = 68

 Score = 27.3 bits (59), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 70  DPCQESAQMSLNCLDRNDYNKDLCKEYFD-AYRECKKQWLKSRRQDRS 116
           DPC+  A    NCL  +DY +  C++  D  YR C K + +  ++++S
Sbjct: 3   DPCKPEACAIQNCLISSDYKESKCQDLVDQLYRCCDKFYKEDGKENKS 50

>Cgla_YGOB_Anc_6.284 Chr11 (1060349..1060567) [219 bp, 72 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 72

 Score = 27.3 bits (59), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 72  CQESAQMSLNCLDRNDYNKDLCKEYFD-AYRECKK 105
           CQ+ A    +CL  N YN+D C    D  Y+ CKK
Sbjct: 9   CQKEACAIQDCLQSNGYNEDRCSRLIDNLYKCCKK 43

>Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}
           YLL009C (REAL)
          Length = 72

 Score = 26.9 bits (58), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 81  NCLDRNDYNKDLCKEYFDAYRECKKQW 107
            C+  N  + D CKE+ D Y+EC K +
Sbjct: 38  TCILFNGQDSDKCKEFIDKYKECMKGY 64

>KAFR0A06670 Chr1 (1352405..1353079) [675 bp, 224 aa] {ON}
          Anc_4.144 YLR326W
          Length = 224

 Score = 27.7 bits (60), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 24 GAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNR 57
          G V+D SK DY+ K   P+K  YY E P  G  R
Sbjct: 15 GYVQDLSK-DYSAKHFQPTKDPYYTERPGGGTKR 47

>KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa]
           {ON} similar to uniprot|Q3E7A9 Saccharomyces cerevisiae
           YMR194C-B
          Length = 77

 Score = 26.9 bits (58), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 20/45 (44%)

Query: 70  DPCQESAQMSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQD 114
           DPC+  A     CL +  +++  C    D+  EC  ++   R  D
Sbjct: 3   DPCKPQACAIQGCLTKTGFDESKCSHLIDSLYECCSKFYNERGAD 47

>NDAI0F01750 Chr6 (430632..431120) [489 bp, 162 aa] {ON} Anc_6.34
           YMR002W
          Length = 162

 Score = 27.3 bits (59), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 17/34 (50%)

Query: 72  CQESAQMSLNCLDRNDYNKDLCKEYFDAYRECKK 105
           C  +A+    CLD ND N  +C  Y    + C++
Sbjct: 124 CDGAAKSFTKCLDDNDGNFQICDYYLQQLKACQE 157

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.129    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,807,234
Number of extensions: 613346
Number of successful extensions: 1462
Number of sequences better than 10.0: 67
Number of HSP's gapped: 1460
Number of HSP's successfully gapped: 67
Length of query: 119
Length of database: 53,481,399
Length adjustment: 88
Effective length of query: 31
Effective length of database: 43,390,791
Effective search space: 1345114521
Effective search space used: 1345114521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)