Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B033608.773ON43643622580.0
YMR238W (DFG5)8.773ON45843417890.0
Suva_13.4228.773ON45843517620.0
Smik_13.4468.773ON45843517240.0
Skud_13.4078.773ON45843517140.0
SAKL0B05412g8.773ON45143517030.0
NDAI0K008408.773ON45943516640.0
NCAS0C008108.773ON45143516520.0
KAFR0B034908.773ON45143816480.0
ZYRO0F12210g8.773ON45343416460.0
TBLA0B033208.773ON45043616290.0
KNAG0J007008.773ON46342916210.0
CAGL0M05049g8.773ON45342816180.0
Kpol_1030.208.773ON45143516050.0
TPHA0J016008.773ON46144716000.0
KLLA0F24926g8.773ON45143715920.0
Kwal_55.202668.773ON45743815590.0
KLTH0E04048g8.773ON45444015440.0
Ecym_14748.773ON45443614460.0
AFR530W8.773ON45943614150.0
NCAS0A08740singletonON43439813570.0
ACL200WsingletonON46343513270.0
ACL201WsingletonON44843513240.0
NCAS0A08730singletonON63137813041e-175
TBLA0C03850singletonON56738412441e-167
ACL202WsingletonON45039711931e-161
KLTH0D08008g2.570ON44843511851e-160
Kwal_26.82252.570ON44943611741e-158
SAKL0D13574g2.570ON45143511701e-158
KLLA0E07723g2.570ON45043811491e-154
TPHA0I024702.570ON45243111321e-152
NDAI0C006802.570ON45243511321e-152
YKL046C (DCW1)2.570ON44943511211e-150
Suva_11.1802.570ON45043511191e-150
NDAI0B015102.570ON44743511181e-150
KAFR0I017402.570ON44843411111e-149
NCAS0H029002.570ON45343511111e-149
Smik_11.2022.570ON44943511101e-148
Skud_11.1832.570ON44943511081e-148
KAFR0A021702.570ON44943410941e-146
NCAS0A127502.570ON44743510751e-143
ABR060W2.570ON45143610611e-141
TBLA0H02580singletonON44943410511e-140
TBLA0H02590singletonON45043710511e-140
Ecym_45772.570ON45043510481e-139
CAGL0L01727g2.570ON44640110471e-139
TDEL0B065802.570ON44743210421e-138
KNAG0A071802.570ON46339110421e-138
ZYRO0E06380g2.570ON45343710321e-137
Kpol_1056.42.570ON45041510171e-134
TBLA0H026002.570ON4494369841e-129
CAGL0H04455g2.347ON66684713.7
Smik_9.1607.198ON131861704.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B03360
         (436 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {O...   874   0.0  
YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putat...   693   0.0  
Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238...   683   0.0  
Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238...   668   0.0  
Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238...   664   0.0  
SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly...   660   0.0  
NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {...   645   0.0  
NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {O...   640   0.0  
KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.7...   639   0.0  
ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} simila...   638   0.0  
TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {O...   632   0.0  
KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {...   629   0.0  
CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} simil...   627   0.0  
Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 b...   622   0.0  
TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {...   620   0.0  
KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]...   617   0.0  
Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {...   605   0.0  
KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {...   599   0.0  
Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar t...   561   0.0  
AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic ...   549   0.0  
NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON}            527   0.0  
ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic ...   515   0.0  
ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic ...   514   0.0  
NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON}            506   e-175
TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON}              483   e-167
ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic ho...   464   e-161
KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly...   461   e-160
Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C...   456   e-158
SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} high...   455   e-158
KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {...   447   e-154
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...   440   e-152
NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {O...   440   e-152
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...   436   e-150
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...   435   e-150
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...   435   e-150
KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {O...   432   e-149
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570    432   e-149
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...   432   e-148
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...   431   e-148
KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.5...   426   e-146
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...   418   e-143
ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic ho...   413   e-141
TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {O...   409   e-140
TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {O...   409   e-140
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...   408   e-139
CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa] ...   407   e-139
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...   405   e-138
KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON}            405   e-138
ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} simila...   402   e-137
Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON} ...   396   e-134
TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {O...   383   e-129
CAGL0H04455g Chr8 (419033..421033) [2001 bp, 666 aa] {ON} weakly...    32   3.7  
Smik_9.160 Chr9 complement(270288..274244) [3957 bp, 1318 aa] {O...    32   4.6  

>TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {ON}
           Anc_8.773 YMR238W
          Length = 436

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/436 (97%), Positives = 426/436 (97%)

Query: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60
           MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW
Sbjct: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60

Query: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN 120
           YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN
Sbjct: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN 120

Query: 121 GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180
           GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR
Sbjct: 121 GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180

Query: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           YTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG
Sbjct: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
           LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS
Sbjct: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           RMLGLTSVLVPSTQSKVDDLLKQ          GGTDGHTCGLNWNKQANDGYYGLGEQM
Sbjct: 301 RMLGLTSVLVPSTQSKVDDLLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQM 360

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIIT 420
           SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIIT
Sbjct: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIIT 420

Query: 421 AVILMVLVGGSIWMLF 436
           AVILMVLVGGSIWMLF
Sbjct: 421 AVILMVLVGGSIWMLF 436

>YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putative
           mannosidase, essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis in bud formation, involved in filamentous
           growth, homologous to Dcw1p
          Length = 458

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/434 (74%), Positives = 369/434 (85%), Gaps = 2/434 (0%)

Query: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62
           +DLD +SK SIC ATALIQ GMLDYYEGTR GGTVGMFQSPYYWW AGEAFGGM++NW+ 
Sbjct: 27  MDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLENWFL 86

Query: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNGA 122
           CEN T++ L+YD +LAQTG +YDY+P NQTMVEGNDDQG+WG+T+MGAVERNFT+P +G 
Sbjct: 87  CENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDPGDGK 146

Query: 123 PGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYT 182
           PGWLAM QA+FN + SRWD+ +CGGGLRWQIFTWN GYNYKNT+SNACLFQIAARLGRYT
Sbjct: 147 PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYT 206

Query: 183 GNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLA 242
           GN TYLEVAE VFDWLVDVGYVVL D  NVFDGAEID NCT I K+EW+YNHG+VLGGLA
Sbjct: 207 GNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGLA 266

Query: 243 FMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSRM 302
           +MYNATNG+ EWET +T+IL GA+SYFFKDSIMYES CQ  G  TCN+DQR+FK+IFSRM
Sbjct: 267 YMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYG--TCNTDQRTFKSIFSRM 324

Query: 303 LGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMSA 362
           LGLTSV+ P T+  +DDL+K           GGTDGHTCGLNW KQ NDGYYGLGEQMSA
Sbjct: 325 LGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQMSA 384

Query: 363 LEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITAV 422
           LEV+Q LLIH + AP+ E  GG+S GDANAG+N+S+ NVLQN L+I+  DRAGAAIITAV
Sbjct: 385 LEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKGDRAGAAIITAV 444

Query: 423 ILMVLVGGSIWMLF 436
           IL VL GG++WMLF
Sbjct: 445 ILSVLTGGAVWMLF 458

>Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/435 (72%), Positives = 364/435 (83%), Gaps = 2/435 (0%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            +DLD +S  SIC ATALIQ GMLDYYEGTR GGTVGMFQSPYYWW AGEAFGGM++NWY
Sbjct: 26  AMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVENWY 85

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
            C+N T++ L+YD +LAQTG  YDY+P NQTMVEGNDDQG+WG+T+MGAVERNFTNP NG
Sbjct: 86  LCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTNPDNG 145

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
           APGWLAM QA+FN + SRWD+ NCGGGLRWQIFTWN GYNYKNTISNACLFQIAARLGRY
Sbjct: 146 APGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRY 205

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN TYL+VAE VFDWLVDVGYVVL D  NV+DGAEID NCT I K+EW+YNHG+VLGG+
Sbjct: 206 TGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWTYNHGIVLGGM 265

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A+MYNATNG+SEW+T + Q+L GA SYFFKD IMYES CQ  G  TCN+DQR+FK+IFSR
Sbjct: 266 AYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYG--TCNTDQRTFKSIFSR 323

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
           MLGLTSV+ P T   +D L+K           GGTDGHTCGL+W K+ NDGYYGLGEQMS
Sbjct: 324 MLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQMS 383

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALEV+Q LLIH + AP+ E  GG+S GDANAG+N+S+ +VLQN L+I   DRAGAAIITA
Sbjct: 384 ALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDRAGAAIITA 443

Query: 422 VILMVLVGGSIWMLF 436
           VIL VL+GG++WMLF
Sbjct: 444 VILSVLIGGAVWMLF 458

>Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/435 (73%), Positives = 369/435 (84%), Gaps = 2/435 (0%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            ++LD +SK SIC ATALIQ GMLDYYEGTR GG VGMFQSPYYWW AGEAFGGM++NW+
Sbjct: 26  AMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWF 85

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
            CEN T++ L+YD +LAQTG +YDY+P NQTMVEGNDDQG+WG+T+MGAVERNFT+P++G
Sbjct: 86  LCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPSDG 145

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            PGWLAM QA+FN + SRWD+ +CGGGLRWQIFTWN GYNYKNTISNACLFQIAARLGRY
Sbjct: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRY 205

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN TYL+VAE VFDWLVDVGYVVL D  NVFDGAEID NCT I K+EW+YNHG+VLGGL
Sbjct: 206 TGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A+MYNATNG+SEWET +T+IL GA+SYFFKDSIMYES CQ    STCN+DQR+FK+IFSR
Sbjct: 266 AYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQ--DYSTCNTDQRTFKSIFSR 323

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
           MLGLTSV+ P T   +DDL+K           GG DGHTCGLNW KQ NDGYYGLGEQM+
Sbjct: 324 MLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQMN 383

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALEV+Q LLIH + AP+ E  GG+S GDANAG+N+S+ NVLQN L+I+  DRAGAAIITA
Sbjct: 384 ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAAIITA 443

Query: 422 VILMVLVGGSIWMLF 436
           +IL VL+GG++WMLF
Sbjct: 444 IILSVLIGGAVWMLF 458

>Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/435 (72%), Positives = 367/435 (84%), Gaps = 2/435 (0%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            +DLD +SK SIC ATALIQ GMLDYY+GTR GG VGMFQSPYYWW AGEAFGGM++NW+
Sbjct: 26  AMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWF 85

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
            CEN T++ L+YD +LAQTG +YDY+P NQTMVEGNDDQG+WG+T+MGAVERNFT+P  G
Sbjct: 86  LCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPDEG 145

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            PGWLAM QA+FN + SRWD+ +CGGGLRWQIFTWN GYNYKNT+SNACLFQIAARLGRY
Sbjct: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRY 205

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN TYL+VAE VFDWLVDVGYVVL D  NVFDGAEID NCT I K+EW+YNHG+VLGGL
Sbjct: 206 TGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A+MYNATNG+SEWETR+TQIL GA++YFFKD+IMYES CQ    STCN+DQR+FK+IFSR
Sbjct: 266 AYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQ--DYSTCNTDQRTFKSIFSR 323

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
           MLGLTSV+ P T   +DDL+K           GGTDGHTCGL+W KQ +DGYYGLGEQMS
Sbjct: 324 MLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQMS 383

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALEV+Q LLIH + AP+ E  GG+S GDANAG+N+S+ NVLQN L+I    RAGAAIITA
Sbjct: 384 ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKGGRAGAAIITA 443

Query: 422 VILMVLVGGSIWMLF 436
           +IL VL+GG++WMLF
Sbjct: 444 IILSVLIGGAVWMLF 458

>SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/435 (71%), Positives = 360/435 (82%), Gaps = 3/435 (0%)

Query: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62
           +DLD SSKDSICYAT+LIQKGMLDYYEGT+ GGTVGMFQ PYYWWQAGEAFGGM+DN Y 
Sbjct: 19  IDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIYL 78

Query: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN-G 121
           C+N T++ LIYD M+AQTG +YDY+P NQ+MVEGNDDQGVWG+T+MGAVERNFTNPT  G
Sbjct: 79  CDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKEG 138

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            PGWLAM QA+FN + +RWD+ +CGGGLRWQIFTWN GYNYKNTI+N CLFQIAARLGRY
Sbjct: 139 VPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGRY 198

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGNDTYLEVA  V+DWL DVG+VVL+D  NVFDGA I+NNC+SI K+EW+YNHGVVLGG 
Sbjct: 199 TGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGGA 258

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A+MYNATNGS  W+TR+TQ+L GA  +FF +SIMYE  CQG G  TCN+DQRSFK+IFSR
Sbjct: 259 AYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSG--TCNNDQRSFKSIFSR 316

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
           MLGLTSVL P T+  +D L+K           GGTDGHTCGL+W    +DGYYGLGEQMS
Sbjct: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALE+MQ LLI     PFT   GGSS GD NAGLN+SSANVL+N L I  KDR GAAIITA
Sbjct: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITA 436

Query: 422 VILMVLVGGSIWMLF 436
           ++L V++GGS+WM+F
Sbjct: 437 IVLGVMIGGSVWMVF 451

>NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {ON}
           Anc_8.773
          Length = 459

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/435 (69%), Positives = 360/435 (82%), Gaps = 3/435 (0%)

Query: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62
           +DLD +SK+SIC AT+LIQ GM+DYY GT+ GGTVGMFQ PYYWW+AGEAFGGMI+NWY 
Sbjct: 27  IDLDITSKESICDATSLIQGGMMDYYWGTQYGGTVGMFQPPYYWWEAGEAFGGMIENWYL 86

Query: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNGA 122
           C+N T+E ++   +LAQTG +YDY+P NQ+MVEGNDDQGVWGLTLMGA ERNFT+P +G 
Sbjct: 87  CQNDTYEDMLKSALLAQTGSNYDYIPANQSMVEGNDDQGVWGLTLMGAAERNFTDPDDGT 146

Query: 123 PGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYT 182
           PGWLAM QA+FN +N+RWD+A+CGGGLRWQIFTWN GYNYKNTISNACLFQ+AARLGRYT
Sbjct: 147 PGWLAMTQAVFNTMNARWDSAHCGGGLRWQIFTWNSGYNYKNTISNACLFQLAARLGRYT 206

Query: 183 GNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLA 242
           GN TYLEVAE VF WLVDVGYV+L D  NVFDGAEID+NCT + ++EW+YNHGVVLGG A
Sbjct: 207 GNTTYLEVAEKVFTWLVDVGYVLLDDTANVFDGAEIDSNCTDMTQIEWTYNHGVVLGGAA 266

Query: 243 FMYNATNGSSEWETRVTQILGGAESYFF-KDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           +MYNATNGSS+WE+RVT++L GA +YFF  + IM+E+ CQ    +TCN+DQRSFK+IFSR
Sbjct: 267 YMYNATNGSSDWESRVTKLLKGATTYFFDSNGIMFENACQ--EYNTCNNDQRSFKSIFSR 324

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
           MLGLTSVL P T   VD L+K           GGTDGHTCGLNW K ++DGYYGLGEQM 
Sbjct: 325 MLGLTSVLAPFTSDTVDPLIKTSAAAAAKSCTGGTDGHTCGLNWAKGSHDGYYGLGEQMC 384

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALEVMQ LLIH + AP T  TGGSS GDA AGLN+++ NVL+N++ I   DRAGAAI+TA
Sbjct: 385 ALEVMQNLLIHDRPAPLTGNTGGSSKGDALAGLNSTTTNVLENKMTITNGDRAGAAIVTA 444

Query: 422 VILMVLVGGSIWMLF 436
           +IL VL GG++WM F
Sbjct: 445 IILGVLTGGAVWMFF 459

>NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {ON}
           Anc_8.773
          Length = 451

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/435 (68%), Positives = 351/435 (80%), Gaps = 3/435 (0%)

Query: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62
           +DLD +SKDSIC ATALIQKGMLDYYEG R GG VGMFQ PYYWW  G AFGGM++N Y 
Sbjct: 19  IDLDVTSKDSICAATALIQKGMLDYYEGERYGGAVGMFQPPYYWWNGGVAFGGMLENMYL 78

Query: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNP-TNG 121
           CEN TFESL+ D ++AQTG +YDY+P NQ+MVEGNDDQGVWGLT+M AVERNFT P  +G
Sbjct: 79  CENNTFESLLMDALVAQTGDNYDYIPSNQSMVEGNDDQGVWGLTIMDAVERNFTAPNKSG 138

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            PGWLAMAQA+FN + +RWD  +CGGGLRWQIFTWN GYNYKNTI+NACLFQ+AARLGRY
Sbjct: 139 VPGWLAMAQAVFNTMYARWDPDHCGGGLRWQIFTWNSGYNYKNTIANACLFQMAARLGRY 198

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN TYL+VAE VFDW+VD+ Y+VL D  NVFDGA+ID NCT I  LEW+YNHGVVLGG 
Sbjct: 199 TGNQTYLDVAEKVFDWMVDINYIVLNDKANVFDGADIDENCTDITTLEWTYNHGVVLGGC 258

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A+MYNATNGSS WETRV +IL GA+ YFF+D++M ES CQ    +TCN+DQR FK+IFSR
Sbjct: 259 AYMYNATNGSSTWETRVNKILAGAQEYFFQDNVMLESACQ--SYNTCNNDQRCFKSIFSR 316

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
           MLG TSVL P T   +D L+K           GG DGHTCGL+W K +NDGYYGLGEQM+
Sbjct: 317 MLGFTSVLAPFTAETIDPLIKASAEAAATSCTGGKDGHTCGLDWTKGSNDGYYGLGEQMN 376

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALE+M  LLIH + AP T  TGG+S GDA+AGLN+++ NVL+N+L I   DRAGAAI+TA
Sbjct: 377 ALEIMSNLLIHDRPAPLTANTGGTSEGDASAGLNSTTTNVLENKLKITQGDRAGAAIVTA 436

Query: 422 VILMVLVGGSIWMLF 436
           VIL + VGG++WMLF
Sbjct: 437 VILGIFVGGAVWMLF 451

>KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.773
           YMR238W
          Length = 451

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/438 (70%), Positives = 356/438 (81%), Gaps = 5/438 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            +DLD SSK SIC ATALIQ GMLDYYEG R GGTVGMFQSPYYWW+AGEAFGGM++NW+
Sbjct: 16  AIDLDTSSKTSICDATALIQDGMLDYYEGIRYGGTVGMFQSPYYWWEAGEAFGGMLENWF 75

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
            CEN TF+ +IYD +LAQTG  YD+MPENQTMVEGNDDQ VWGLT+M AVERNFT+PT+G
Sbjct: 76  LCENDTFKEIIYDAILAQTGSDYDFMPENQTMVEGNDDQCVWGLTIMDAVERNFTDPTDG 135

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
           +PGWL M QAIFN++ SRWD+ANCGGGLRWQIFTWN GY+YK+TISN CLFQ+A+RLGRY
Sbjct: 136 SPGWLYMTQAIFNEMWSRWDSANCGGGLRWQIFTWNSGYDYKSTISNVCLFQLASRLGRY 195

Query: 182 TGNDTYLEVAENVFDWLVDVGYV-VLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           TGNDTYL+VAE+V+DWLVDVG++ V      V+DGA+I  NCT I  ++WSYNHG++LGG
Sbjct: 196 TGNDTYLDVAESVYDWLVDVGFINVANGTAYVYDGADISENCTDITTIDWSYNHGILLGG 255

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
            A+ YNATNGSS WE+RVT I+ GA+S FF D IMYES CQ     TCN+DQRSFK+IFS
Sbjct: 256 AAYAYNATNGSSVWESRVTDIVEGAKSIFFSDGIMYESACQ--DYDTCNNDQRSFKSIFS 313

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           RMLG TSVL P T S +D L+K           GGTDGHTCGLNW  +  DG YGLGEQM
Sbjct: 314 RMLGFTSVLAPFTASTIDPLIKSSAAACALSCDGGTDGHTCGLNWQDKTCDGNYGLGEQM 373

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLN--TSSANVLQNQLDIQTKDRAGAAI 418
           SALEV+Q LLIH + AP+T  TGGSS GDA+AGLN  TSSA+VL+N L I +KDRAGAAI
Sbjct: 374 SALEVIQNLLIHDRPAPYTASTGGSSVGDASAGLNTTTSSADVLENNLTITSKDRAGAAI 433

Query: 419 ITAVILMVLVGGSIWMLF 436
           ITAVIL  + GG+IWMLF
Sbjct: 434 ITAVILGCMAGGAIWMLF 451

>ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} similar
           to uniprot|Q05031 Saccharomyces cerevisiae YMR238W DFG5
           Mannosidase essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis involved in filamentous growth homologous to
           Dcw1p
          Length = 453

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/434 (70%), Positives = 352/434 (81%)

Query: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62
           +DL    KDS+C ATALIQ+GMLDYY G + GG +GMFQ PYYWWQAGEAFGGMIDNW+F
Sbjct: 20  VDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWHF 79

Query: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNGA 122
           C+N TFE LI + ML Q GPHYDYMP+NQTMVEGNDDQGVWGLT+M AVERNFT+P +G 
Sbjct: 80  CKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGDGK 139

Query: 123 PGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYT 182
           PGWLAMAQA+FN++N RWD  +C GG+RWQIFTWN GYNYKNTISN C FQ+AARLGRYT
Sbjct: 140 PGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRYT 199

Query: 183 GNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLA 242
            N TYLEVAE VFDWL DVG+VVLKD GNVFDGA  D+NCT + +LEW+YNHG++LGG A
Sbjct: 200 NNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIILGGSA 259

Query: 243 FMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSRM 302
           +MYNATNGSS+WE RV QIL GA  YFF+D++MYES CQ   +S CN+DQRSFK+IFSRM
Sbjct: 260 YMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFSRM 319

Query: 303 LGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMSA 362
           LGLTSVLVPS   KVD LL            GG DGHTCGLNW K + D  YGLGEQMSA
Sbjct: 320 LGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMSA 379

Query: 363 LEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITAV 422
           LEV+Q  LIH    P+ E TGGSS GD+ AGLNT++ NVLQ +L IQ+KDRAGAAIIT V
Sbjct: 380 LEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKDRAGAAIITGV 439

Query: 423 ILMVLVGGSIWMLF 436
           +LMV+VGGS+WMLF
Sbjct: 440 VLMVVVGGSVWMLF 453

>TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {ON}
           Anc_8.773 YMR238W
          Length = 450

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/436 (68%), Positives = 353/436 (80%), Gaps = 3/436 (0%)

Query: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60
             +DLD SSK+SIC AT+LI KGMLDYY GT+ GGTVGMFQ PYYWW+AGEAFGGM++NW
Sbjct: 18  FAMDLDTSSKESICGATSLIIKGMLDYYWGTQYGGTVGMFQPPYYWWEAGEAFGGMLENW 77

Query: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN 120
           Y C+N T+  L++D + AQTGP YDY+P+NQTMVEGNDDQ +WGLT+M AVERNFTNPT 
Sbjct: 78  YLCQNDTYADLLFDALTAQTGPDYDYIPQNQTMVEGNDDQCIWGLTVMDAVERNFTNPTE 137

Query: 121 GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180
           G PGWLAM QA+FN + SRWD A+CGGGLRWQIFTWN GY+YKNTISNACLFQ+AARLGR
Sbjct: 138 G-PGWLAMGQAVFNTMWSRWDAADCGGGLRWQIFTWNSGYDYKNTISNACLFQMAARLGR 196

Query: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           YTGN+TYL+VA +VFDWL  VGYV + +   V+DGA+I  NCT I K +WSYN+G +LGG
Sbjct: 197 YTGNNTYLDVANDVFDWLTGVGYVNMDNAAEVYDGADISENCTDITKYQWSYNNGCMLGG 256

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
            A+MYNATNGSS WETRVTQ+L GA++YFF+D IMYES CQ     TCN+DQRSFK++FS
Sbjct: 257 AAYMYNATNGSSIWETRVTQLLNGAKAYFFQDDIMYESACQ--TAKTCNNDQRSFKSLFS 314

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           RMLG TSVLVPST+  +D L+            GGTDGHTCGLNW    +DGYYGLGEQM
Sbjct: 315 RMLGFTSVLVPSTRDIIDPLILASAQGAARTCNGGTDGHTCGLNWQASTHDGYYGLGEQM 374

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIIT 420
           SALEV+Q LLIH + AP+T   GGSS GDANAGLN +S NVL N LDI+T D+ GAAI+T
Sbjct: 375 SALEVIQNLLIHDRPAPYTSIDGGSSEGDANAGLNKTSKNVLSNDLDIKTGDKVGAAILT 434

Query: 421 AVILMVLVGGSIWMLF 436
           A +L +LVGG+IWMLF
Sbjct: 435 AGVLAILVGGAIWMLF 450

>KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {ON}
           Anc_8.773 YMR238W
          Length = 463

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/429 (68%), Positives = 345/429 (80%), Gaps = 3/429 (0%)

Query: 9   SKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYFCENTTF 68
           S D +C ATAL+  G+LDYY GTR GGTVGMFQ PYYWW AGEAFGGMI+NW+ C+N+T+
Sbjct: 37  SLDPVCSATALVTDGLLDYYSGTRYGGTVGMFQPPYYWWHAGEAFGGMIENWFLCQNSTY 96

Query: 69  ESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPT-NGAPGWLA 127
           E+L+ D  +AQTG +YDY+PENQTMVEGNDDQG+WGLT+M AVERNFT PT +G PGWLA
Sbjct: 97  ETLLMDAFIAQTGNNYDYIPENQTMVEGNDDQGIWGLTIMDAVERNFTKPTKDGVPGWLA 156

Query: 128 MAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYTGNDTY 187
           M+QA+FN + +RWDT +CGGGLRWQIFTWN GYNYKNTISNACLF +AARLGRYTGN TY
Sbjct: 157 MSQAVFNTMWARWDTQHCGGGLRWQIFTWNSGYNYKNTISNACLFNLAARLGRYTGNSTY 216

Query: 188 LEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLAFMYNA 247
           L+VA+ VFDW+V VGYVVL D  NVFDGA I++NCT+I   EWSYNHGVVLGG AFMYNA
Sbjct: 217 LDVADQVFDWMVSVGYVVLGDTANVFDGANIEDNCTTITTFEWSYNHGVVLGGTAFMYNA 276

Query: 248 TNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSRMLGLTS 307
           TNGSS WE RV +IL GA +YFF+DSIM+ES CQ  G   CN+DQR+FKAIFSRML  T+
Sbjct: 277 TNGSSVWEDRVNRILKGATTYFFRDSIMFESACQDTG--KCNNDQRTFKAIFSRMLSFTA 334

Query: 308 VLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMSALEVMQ 367
           VLVPST S +D L++           GGTDGHTCGLNW     DG YGLGEQMSALEVM 
Sbjct: 335 VLVPSTASTIDPLMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGLGEQMSALEVMN 394

Query: 368 QLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITAVILMVL 427
            LL+H + AP+T   GGSS GDA+AGLN+++ NV  N L+I+ KD+AGAAI+T VIL  L
Sbjct: 395 YLLVHDRPAPYTAAAGGSSVGDASAGLNSTATNVFANSLNIRGKDKAGAAIVTTVILGTL 454

Query: 428 VGGSIWMLF 436
            GGSIWMLF
Sbjct: 455 AGGSIWMLF 463

>CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046c or
           uniprot|Q05031 Saccharomyces cerevisiae YMR238w DFG5
          Length = 453

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/428 (67%), Positives = 349/428 (81%), Gaps = 2/428 (0%)

Query: 9   SKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYFCENTTF 68
           +KDSIC ATALIQ GMLDYYEGTR GGTVGMFQ PYYWWQAG AFGGM++NW+ C+N T+
Sbjct: 28  NKDSICAATALIQGGMLDYYEGTRYGGTVGMFQPPYYWWQAGVAFGGMLENWFLCQNDTY 87

Query: 69  ESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNGAPGWLAM 128
           + L+ + ++AQTGP+YDY+P NQT VEGNDDQGVWGLT++ AVERNF+ P +G PGWLAM
Sbjct: 88  KDLLMNALVAQTGPNYDYIPANQTTVEGNDDQGVWGLTILDAVERNFSAPIDGKPGWLAM 147

Query: 129 AQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYTGNDTYL 188
           +Q IFN + +RWD  +C GGLRWQIFTWN GYNYKNTISNACLFQIAARLGRYTGN TYL
Sbjct: 148 SQGIFNTMYARWDMQSCNGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYL 207

Query: 189 EVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLAFMYNAT 248
           +VAE VFDWLV VGY+VL + GNV+DGA++++NCT I  +EW+YNHGVVLGGLA+MYNAT
Sbjct: 208 DVAERVFDWLVGVGYIVLSEKGNVYDGAKVEDNCTDITAIEWTYNHGVVLGGLAYMYNAT 267

Query: 249 NGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSRMLGLTSV 308
           NGSS W++R+T +LGGA +YFF+D IMYES CQ     TCN+DQR FK+IFSRMLG TSV
Sbjct: 268 NGSSVWQSRLTSVLGGATAYFFQDDIMYESACQ--PYKTCNNDQRCFKSIFSRMLGFTSV 325

Query: 309 LVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMSALEVMQQ 368
           L P T   +D LLK           GGTDGHTCGL+W  + NDGYYGLGEQMSALEV+QQ
Sbjct: 326 LAPFTSDTIDPLLKASAMAAAGSCDGGTDGHTCGLDWQLKTNDGYYGLGEQMSALEVIQQ 385

Query: 369 LLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITAVILMVLV 428
           LLIH++ AP+    GG+S GDA AGLN+++ NVL+N L I   DRAGAAI+T ++L +++
Sbjct: 386 LLIHERPAPYRADNGGTSVGDAAAGLNSTTTNVLKNNLKITGGDRAGAAIVTTIVLGIII 445

Query: 429 GGSIWMLF 436
           GG+ WM+F
Sbjct: 446 GGAAWMMF 453

>Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 bp,
           451 aa] {ON} complement(37060..38049,38052..38417) [1356
           nt, 452 aa]
          Length = 451

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/435 (67%), Positives = 351/435 (80%), Gaps = 3/435 (0%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            +DLD +SKDSIC AT+LIQ GMLDYYEGTR GGTVGMFQ PYYWW+AGEAFGGMI+NW+
Sbjct: 20  AIDLDVNSKDSICAATSLIQGGMLDYYEGTRYGGTVGMFQPPYYWWEAGEAFGGMIENWF 79

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
            C+N T+  +IYD +LAQTG +YDY+P NQT VE    + V+G T+M A ERNFT P++G
Sbjct: 80  LCQNDTYHDIIYDALLAQTGSNYDYVPANQTFVEVMMIK-VFGGTVMDAAERNFTAPSDG 138

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WLAMAQA+FN + +RWD+ANCGGGLRWQI+TWN GYNYKNT+SNACLFQIAARLGRY
Sbjct: 139 KPDWLAMAQAVFNTMYARWDSANCGGGLRWQIYTWNSGYNYKNTVSNACLFQIAARLGRY 198

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGNDTYLEVAE VFDWLVDV +VVL D  NVFDGA I +NC+++ KLEWSYNHG+VLGGL
Sbjct: 199 TGNDTYLEVAEKVFDWLVDVNFVVLNDEANVFDGANITSNCSAVVKLEWSYNHGIVLGGL 258

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A+MYNATNG+S+WE+ +T++L GA+S FFK++IMYE  CQ    +TCN+DQRSFK+IFSR
Sbjct: 259 AYMYNATNGTSKWESGLTKVLNGAKSIFFKNNIMYEQACQDH--NTCNTDQRSFKSIFSR 316

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
           MLGLTSVL P T   +  L++           GGTDGHTCGLNWN   NDG YGLGEQM 
Sbjct: 317 MLGLTSVLAPYTSDTITPLIQASAEGAAKSCDGGTDGHTCGLNWNLGTNDGKYGLGEQMC 376

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALE+M  LLI  + AP+T   GG+S GD +AGLN +S +VL N LDI+ KDRAGAAI+TA
Sbjct: 377 ALEIMSNLLILNRPAPYTMHNGGTSVGDPSAGLNATSTSVLSNNLDIKQKDRAGAAIVTA 436

Query: 422 VILMVLVGGSIWMLF 436
           VIL VL+GGS+WMLF
Sbjct: 437 VILFVLLGGSVWMLF 451

>TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {ON}
           Anc_8.773 YMR238W
          Length = 461

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/447 (67%), Positives = 359/447 (80%), Gaps = 15/447 (3%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            + LD  SKDS+C ATALIQKGMLDYY+GTR GGTVGMFQ PYYWW+AGEAFGGM++NWY
Sbjct: 18  AITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENWY 77

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
            C+N TFESLI D ++ Q G +YDY+P NQT+VEGNDDQGVWGLT++GAVERN  +  +G
Sbjct: 78  LCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNLPDR-DG 136

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            PGWLA++QA+FN + +RWDTA CGGGLRWQI+TWN GYNYKNTISNACLFQIAARLGRY
Sbjct: 137 VPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLGRY 196

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN+TYLEVAE VFDW+VDV Y+VLKDV NV+DGA  + NC+ I + EWSYNHGVVLGGL
Sbjct: 197 TGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVLGGL 256

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A+MYNATNG+S+WET +TQ+L GA +YFFK++IMYES CQ     TCN+DQRSFK+IFSR
Sbjct: 257 AYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQ--EAKTCNTDQRSFKSIFSR 314

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
           MLG T VL P T + +D L++           GGTDG TCGL+W    NDGYYGLGEQMS
Sbjct: 315 MLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMS 374

Query: 362 ALEVMQQLLI------------HQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQ 409
           ALE++ QLL+               ++P+T  +GG+S GDA+AGLNT+S NVLQN LDI+
Sbjct: 375 ALEIINQLLVSSSGAAAEAASSGSASSPYTSSSGGNSTGDASAGLNTTSTNVLQNNLDIE 434

Query: 410 TKDRAGAAIITAVILMVLVGGSIWMLF 436
           +KD+AGAA+ TAVIL VLVGGS+WMLF
Sbjct: 435 SKDKAGAAVATAVILAVLVGGSVWMLF 461

>KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]
           {ON} similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/437 (67%), Positives = 342/437 (78%), Gaps = 3/437 (0%)

Query: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60
           + +DLD SSK SIC ATALIQ+G+ DYYEG   GGTVGMF SPYYWW+AG  FGGMI+NW
Sbjct: 17  LAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIENW 76

Query: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPT- 119
           Y C+NT++E ++YD ++AQTG  YDYMP NQTMVEGNDDQGVW LT+M AVERNFTNP  
Sbjct: 77  YLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPKE 136

Query: 120 NGAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLG 179
           +G PGWLAM QA+FNQ+ SRWD+ +C GGLRWQIFTWN GYNYKNTISN CLFQ+AARLG
Sbjct: 137 DGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLG 196

Query: 180 RYTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLG 239
           RYTGN TYLEVAE VFDWLVD+ +VV+K+  NVFDGA ID+NCTSI K EWSYNHGVVLG
Sbjct: 197 RYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWSYNHGVVLG 256

Query: 240 GLAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIF 299
           G A+MYNATNGS  W+TR  QILGGA S+FF+D IMYES CQ   ++ CN+DQR FKAIF
Sbjct: 257 GCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQ--ASNKCNTDQRVFKAIF 314

Query: 300 SRMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQ 359
           SRMLG TSVL P T   +  L+            GGTDGHTCGLNW     DG YGLGEQ
Sbjct: 315 SRMLGYTSVLAPFTTDTITPLIDTSAAAAAKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQ 374

Query: 360 MSALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAII 419
             ALE++ QLL+H   AP TE TGGSS+GDA+AGLN S+ NVLQ  ++I   D+AGA II
Sbjct: 375 ACALEIINQLLVHDLPAPLTESTGGSSSGDASAGLNVSTTNVLQKNINITAGDKAGAGII 434

Query: 420 TAVILMVLVGGSIWMLF 436
           T ++L VLV G++WM+ 
Sbjct: 435 TTIVLGVLVLGTVWMVL 451

>Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {ON}
           YMR238W (DFG5) - involved in pseudohyphal growth [contig
           152] FULL
          Length = 457

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/438 (65%), Positives = 341/438 (77%), Gaps = 6/438 (1%)

Query: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62
           +DLD SSKDSIC AT+LIQKG++DYYEG R GGTVGMFQ PYYWW+AGE FGGM++NW+ 
Sbjct: 22  IDLDTSSKDSICDATSLIQKGVMDYYEGNRFGGTVGMFQQPYYWWEAGEVFGGMMENWFL 81

Query: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPT-NG 121
           C+N T+E  +YD M+AQ GP YD+MP NQ+MVEGNDDQGVWGLTLM AVERNFTNPT  G
Sbjct: 82  CQNDTYEKTLYDAMIAQAGPDYDFMPSNQSMVEGNDDQGVWGLTLMSAVERNFTNPTEKG 141

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            PGWLAM Q +FN + SRWD+ +CGGGLRWQIFTWN GYNYKNT+SNACLFQ+AARLGRY
Sbjct: 142 VPGWLAMVQGVFNTMWSRWDSDHCGGGLRWQIFTWNSGYNYKNTVSNACLFQLAARLGRY 201

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVG--NVFDGAEIDNNCTSINKLEWSYNHGVVLG 239
           TGN+TYL  AE V++WLVD+G+V   + G  NV+DGA ID NCT I ++EWSYN G+VLG
Sbjct: 202 TGNETYLTKAETVWNWLVDIGFVRFNESGNANVYDGATIDKNCTDIVEIEWSYNQGIVLG 261

Query: 240 GLAFMYNAT-NGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAI 298
           G A+MYNAT NG+S+WE+R+ QI+GG+   FF++ IMYE+ CQ  G   CN DQRSFK+I
Sbjct: 262 GAAYMYNATHNGTSDWESRLNQIVGGSTDIFFRNKIMYEATCQDSG--KCNQDQRSFKSI 319

Query: 299 FSRMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGE 358
           FSRML LT  L P T  K+D L+K           GGTDGHTCGLNW K  +DG+YGLGE
Sbjct: 320 FSRMLSLTRTLAPYTADKIDPLMKASAEGAAKSCTGGTDGHTCGLNWEKGEHDGWYGLGE 379

Query: 359 QMSALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAI 418
           Q  ALE +Q  L   + AP+T   GG+S GD  AGLN +S NVL + L+I  KD+ GA+I
Sbjct: 380 QACALEGIQSQLYSMRPAPYTADNGGTSVGDTEAGLNKTSTNVLHSDLNITQKDKVGASI 439

Query: 419 ITAVILMVLVGGSIWMLF 436
           ITAV+L VLVGGSIWM+F
Sbjct: 440 ITAVLLAVLVGGSIWMIF 457

>KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {ON}
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 454

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/440 (64%), Positives = 341/440 (77%), Gaps = 6/440 (1%)

Query: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60
           +G+DLD S   SIC AT+LIQ G++DYY GTRIGGTVGMFQ PYYWW+AGE FGGM++NW
Sbjct: 17  LGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENW 76

Query: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPT- 119
           + C+N T+  +IYD M+ Q GP YD+MP NQ+MVEGNDDQGVWGLT+M A ERNFTNPT 
Sbjct: 77  FLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTE 136

Query: 120 NGAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLG 179
           +G PGWLAMAQ +FN +  RWD+ +CGGG+RWQIFTWN GYNYKNT+SNAC+FQ+AARLG
Sbjct: 137 DGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLG 196

Query: 180 RYTGNDTYLEVAENVFDWLVDVGYVVLKDVG--NVFDGAEIDNNCTSINKLEWSYNHGVV 237
           RYTGNDTYL  AE V+DWLVDVG+VVL + G  NV+DGA ID+NCT I K EWSYN G+V
Sbjct: 197 RYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIV 256

Query: 238 LGGLAFMYNAT-NGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFK 296
           LGG A+MYNAT N +S W++R+ QI+GG+  +FFKD +MYES CQ   + TCN DQRSFK
Sbjct: 257 LGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQ--DSKTCNQDQRSFK 314

Query: 297 AIFSRMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGL 356
           +IFSRML LT  L P T   +D L++           GGTDGHTCGLNW    +DGYYGL
Sbjct: 315 SIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGL 374

Query: 357 GEQMSALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGA 416
           GEQ  ALE +Q L+  ++ AP+T   GGSS GD  A LN++S NVLQ+ + I  KD+ GA
Sbjct: 375 GEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGA 434

Query: 417 AIITAVILMVLVGGSIWMLF 436
           +IITAVIL VLVGGSIWM+F
Sbjct: 435 SIITAVILAVLVGGSIWMIF 454

>Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFR530W
          Length = 454

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/436 (61%), Positives = 327/436 (75%), Gaps = 3/436 (0%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
           GL LD  SKDSIC AT  IQ+G++DYY G+  GG VGMF  PYYWW+AG  F GM++NWY
Sbjct: 21  GLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWY 80

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
            C+N  + S +Y+ M+AQTG +YDY+P NQ+M EGNDDQG+WGL +MGAVERNF +   G
Sbjct: 81  LCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVERNFPDAQMG 140

Query: 122 -APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180
             PGWL MAQA+FN + +RWD+ +CGGGLRWQIFTWN GY+YKNTI+N CLFQ+AARLGR
Sbjct: 141 NVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCLFQLAARLGR 200

Query: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           YTGN TYL++A   F WLVDV +VVLKD  NVFDGA I +NC  I  +EW+YNHGV+LGG
Sbjct: 201 YTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIEWTYNHGVILGG 260

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
            A+MYNATNG   WETR+ QILGGA ++FF+++IMYE  CQ +    CN+DQRSFK+IFS
Sbjct: 261 CAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDN--KICNNDQRSFKSIFS 318

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           RML +TSVL P T+  +D LL+           GG DG TCGL+W   + DGYYGLGEQ 
Sbjct: 319 RMLAVTSVLAPFTRETIDPLLEASAAAAAASCSGGKDGETCGLDWTTGSWDGYYGLGEQA 378

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIIT 420
           SALEV+Q LLIH KA P T+  GG+S GD  AGL T   NVL ++L+I +KDR  AA+IT
Sbjct: 379 SALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSKDRIKAALIT 438

Query: 421 AVILMVLVGGSIWMLF 436
           AV L +LVG ++WM+ 
Sbjct: 439 AVCLGLLVGTALWMVI 454

>AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5)
          Length = 459

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/436 (57%), Positives = 323/436 (74%), Gaps = 4/436 (0%)

Query: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62
           LDLD SS++ +C+ T  IQKG++DYY G++ GG VGMFQ PYYWW+AGE FGGM++NWY 
Sbjct: 26  LDLDLSSREDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYL 85

Query: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNP-TNG 121
           C+N  +ES++ + M+AQTG  +DY+P NQ+  EGNDDQGVW L +MGAVERNF +P   G
Sbjct: 86  CDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEG 145

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            PGWL M Q +FN++ +RWD  NCGGGLRWQIF WN GY YKNTI+N CLFQ+AARLGRY
Sbjct: 146 MPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRY 205

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN TYL+VA  VF WLVDV Y+VL+D   VFDGA I  NC+ I  +EWSYNHG++L G 
Sbjct: 206 TGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGA 265

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A+MYNAT GS EWE+ VT+IL GA  ++F+D IMYE  CQ    +TC++DQRSFK+IFSR
Sbjct: 266 AYMYNATGGSPEWESHVTKILAGAADFYFRDKIMYERACQ--DYNTCDNDQRSFKSIFSR 323

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
           ML +TSV+ P T+  +D+L+             GT G+TCGLNW+K   DG YGLGEQ S
Sbjct: 324 MLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQAS 383

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNT-SSANVLQNQLDIQTKDRAGAAIIT 420
           ALE++Q +LIH KA P T  TGG S G+ +AGL+  S   +L+   +I  KDR GA++IT
Sbjct: 384 ALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLIT 443

Query: 421 AVILMVLVGGSIWMLF 436
           A+ L +++G ++WM+F
Sbjct: 444 AISLGLMLGCALWMIF 459

>NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/398 (63%), Positives = 299/398 (75%), Gaps = 8/398 (2%)

Query: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62
           + L+ +S  SIC AT++I KG+LDYYEGTR  GTVGMFQ PYYWW+AG AFGGM++NWY 
Sbjct: 27  IKLNVTSNTSICDATSIITKGILDYYEGTRFNGTVGMFQQPYYWWKAGSAFGGMLENWYL 86

Query: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPT-NG 121
           C+N TFESL+ D ML Q G  YDY+PENQTMVE NDDQGVWGLT+MGAVERNFT+P    
Sbjct: 87  CQNDTFESLLTDAMLHQAGKDYDYLPENQTMVEANDDQGVWGLTIMGAVERNFTDPQGKD 146

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            PGWLAMAQ+IFNQ+ SRWDT +CGGGLRWQI+ WN GYNYKNTIS ACLFQ+AARLGRY
Sbjct: 147 VPGWLAMAQSIFNQMYSRWDTGSCGGGLRWQIYDWNKGYNYKNTISTACLFQMAARLGRY 206

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLK-DVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           TGN TYL+VA+  F W+VD+GY+ L    G VFDGA I++NC+ I KLEWSYNHG+VLGG
Sbjct: 207 TGNSTYLKVADKTFQWMVDIGYIQLNTSSGRVFDGAHIESNCSDITKLEWSYNHGIVLGG 266

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
            A+MYNAT  S EW     +IL GA +YFF++  M E+ CQ      CN+DQR+FK+IFS
Sbjct: 267 CAYMYNATK-SPEWGMNTIKILNGATTYFFQNKTMLETACQRPDRVFCNNDQRTFKSIFS 325

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           RMLGLTSV+ P T  ++D L+ Q          GG D  TCGLNW +  NDGYYGLGEQ+
Sbjct: 326 RMLGLTSVMAPFTSERIDPLIVQSAEAAALSCTGGFDNETCGLNWLEGKNDGYYGLGEQL 385

Query: 361 SALEVMQQLLIHQKAAPFTEQT-----GGSSAGDANAG 393
           SALEV+Q LLIH++  P+  +T     GG S GD  AG
Sbjct: 386 SALEVIQNLLIHKRPPPYMAKTDKNKVGGVSKGDPAAG 423

>ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 463

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/435 (56%), Positives = 305/435 (70%), Gaps = 5/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            LD+D +S +SIC AT LIQ G+LDYYEG R GG VG FQ PYYWW AGEAFGGM++NWY
Sbjct: 30  ALDVDFNSSESICDATKLIQVGILDYYEGLRPGGRVGFFQKPYYWWMAGEAFGGMVENWY 89

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTN-PTN 120
            C NT ++ L+ D M++Q G + DY+P +Q M+EGNDDQG+WGL +MGA ERNF + P  
Sbjct: 90  LCNNTEYQDLLTDAMVSQIGENKDYVPSHQKMIEGNDDQGIWGLLVMGAAERNFPDAPPE 149

Query: 121 GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180
            APGWLA+AQA+FN + +RWD  NCGGGLRWQIF WN GY+YKNTISNACLFQIAARL R
Sbjct: 150 RAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNNGYDYKNTISNACLFQIAARLAR 209

Query: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           +TGN TY +VAE VFDWLVD   V L++   V DGA I   C   +KLEW+YNHGVVL G
Sbjct: 210 FTGNSTYQDVAETVFDWLVDSKLVQLENDAKVLDGAHISERCEDHSKLEWTYNHGVVLAG 269

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
            A+MYN TNGS+ W  R+ ++L G+   FF + I+YE  CQ      CN DQRSF++IFS
Sbjct: 270 CAYMYNITNGSAVWGDRLNKVLNGS-LLFFPNGILYERACQ--DVQKCNDDQRSFRSIFS 326

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           RML LTSVL P T+++++  +++          GG DGHTCG+ W     DG YGLGEQ+
Sbjct: 327 RMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQL 386

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQ-NQLDIQTKDRAGAAII 419
           SALE++Q  LIH K  P T   G  S GD +AGL  +S N++  +   I  KDR GA  +
Sbjct: 387 SALEIIQNTLIHTKPPPTTANEGAKSKGDPSAGLYDNSPNIITLSTRQIGLKDRVGAGFM 446

Query: 420 TAVILMVLVGGSIWM 434
           T V+L+  + GSIWM
Sbjct: 447 TVVLLIPFITGSIWM 461

>ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 448

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/435 (56%), Positives = 303/435 (69%), Gaps = 5/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            LD+D +S +SIC AT LIQ G+LDYYEG + GG  G    PYYWW AGEAFGGM++NWY
Sbjct: 15  ALDVDFNSSESICDATKLIQVGILDYYEGAKPGGRAGFLVKPYYWWMAGEAFGGMVENWY 74

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTN-PTN 120
            C NT ++ L+ D M++Q G + DYMP +Q MVEGNDDQG+WGL +MGA ERNF + P  
Sbjct: 75  LCNNTEYQDLLTDAMVSQIGENKDYMPSHQKMVEGNDDQGIWGLLVMGAAERNFPDAPPE 134

Query: 121 GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180
            APGWLA+AQA+FN + +RWD  NCGGGLRWQIF WNGGY+YKNTISNACLFQIAARL R
Sbjct: 135 RAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNGGYDYKNTISNACLFQIAARLAR 194

Query: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           +TGN TY +VAE VFDWLVDV  V L++   V DGA I   C   ++LEW+YNHGVVLGG
Sbjct: 195 FTGNSTYQDVAETVFDWLVDVKLVELENDARVLDGAHISERCEDHSQLEWTYNHGVVLGG 254

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
            A+MYN TNGS+ W  R+ ++L G+   FF++ I+YE  CQ    + CN DQRSF++IFS
Sbjct: 255 CAYMYNITNGSAVWGDRLNKVLNGS-LLFFENGILYERACQ--DVNKCNDDQRSFRSIFS 311

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           RML LTSVL P T+++++  +++          GG DGHTCG+ W     DG YGLGEQ+
Sbjct: 312 RMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQL 371

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSAN-VLQNQLDIQTKDRAGAAII 419
           SALE++Q  LIH K  P T   G  S GD  AGL  SS N +      I+ KDR GA   
Sbjct: 372 SALEIIQNTLIHTKPPPTTANEGAKSQGDPGAGLQLSSPNSITLPTRQIRLKDRVGAGFA 431

Query: 420 TAVILMVLVGGSIWM 434
           T V L+  + GSIWM
Sbjct: 432 TVVFLLPFITGSIWM 446

>NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  506 bits (1304), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 233/378 (61%), Positives = 287/378 (75%), Gaps = 4/378 (1%)

Query: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60
           + L LD +S  SIC AT+L+QKG+LDYYEGT  GGTVGMFQ+PYYWW +G AFG MI+NW
Sbjct: 27  LSLTLDQTSSKSICDATSLLQKGILDYYEGTTYGGTVGMFQAPYYWWHSGCAFGSMIENW 86

Query: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN 120
           Y C++ T+ESLI D +LAQ G +YD++P+NQTMVEGNDDQGVWGL LM A ER F     
Sbjct: 87  YLCQDDTYESLITDAILAQAGDNYDFVPQNQTMVEGNDDQGVWGLALMDAAEREFPQ-VK 145

Query: 121 GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180
           G P WL MA+ IF  + +RWD ANCGGGLRWQI++WN GY+YKNT+S  CLFQ+AARLGR
Sbjct: 146 GQPSWLTMAENIFESMFARWDNANCGGGLRWQIYSWNNGYDYKNTVSTTCLFQLAARLGR 205

Query: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDV-GNVFDGAEIDNNCTSINKLEWSYNHGVVLG 239
           YTGN+TY++ A   FDWL  VG+V+ K+  G VFDGA+I  NCT+I K EWSYNHG+VLG
Sbjct: 206 YTGNETYVKAANQAFDWLQGVGFVMFKNNDGYVFDGADISTNCTNIKKYEWSYNHGIVLG 265

Query: 240 GLAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIF 299
           G A+MYN T+GSS WETR +Q+L  A SYFF++ IM+E+ CQ   ++ CN+DQRSF++IF
Sbjct: 266 GAAYMYNLTDGSSTWETRTSQLLNLASSYFFQNGIMFEAECQ--TSNICNNDQRSFRSIF 323

Query: 300 SRMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQ 359
           +RMLG TS++ P T   +D LLK           GG DGHTCGLNW     DG YGLGE+
Sbjct: 324 ARMLGKTSIMAPFTAETIDPLLKTTSKAAANACSGGKDGHTCGLNWLNSNFDGNYGLGEE 383

Query: 360 MSALEVMQQLLIHQKAAP 377
           MSA+EV+Q LLIHQ+ AP
Sbjct: 384 MSAMEVIQNLLIHQRPAP 401

>TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  483 bits (1244), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 217/384 (56%), Positives = 284/384 (73%), Gaps = 4/384 (1%)

Query: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62
           +++D  SK+SIC AT+LIQ G+LDYYEG R GGTVG+FQ PYYWWQ+GEAFG +++NWY 
Sbjct: 17  IEIDTHSKESICNATSLIQDGLLDYYEGNRYGGTVGIFQPPYYWWQSGEAFGSLLNNWYL 76

Query: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNGA 122
           C+N T+E LIYD +LAQ GP+YD++P+NQTMVEGNDDQGV+ +T++ A+ERNFT P  G+
Sbjct: 77  CQNDTYEKLIYDAILAQAGPNYDFVPKNQTMVEGNDDQGVFDMTILDAMERNFTAPPKGS 136

Query: 123 PGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYT 182
           P WL M Q +FN +  RWDT +C GG+RWQI++WN GY+YKN +S   LF IAARL RYT
Sbjct: 137 PSWLDMNQRVFNSMYDRWDTTSCNGGIRWQIYSWNNGYDYKNAVSTGSLFHIAARLARYT 196

Query: 183 GNDTYLEVAENVFDWLVDVGYVVLKD-VGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           GN +Y +VA+ +FDWL  V YV+  D  G V DGA I+ NCT I ++EW+YN G+++ G 
Sbjct: 197 GNASYFQVADTIFDWLTSVNYVMFDDKYGYVMDGASIEQNCTDITRIEWTYNFGIIMDGC 256

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFF-KDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
           A++YNATNGS++WE   T++L GA+  FF K+ IMYE+ CQ +  + CN+DQRSFKA+ +
Sbjct: 257 AYLYNATNGSAKWEQCTTKLLAGAKDDFFDKNDIMYEAACQTN--NKCNNDQRSFKALLA 314

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           R LG TSVL P T+S +  ++            GG DGHTCGL+W K  NDGYYG+GEQM
Sbjct: 315 RFLGTTSVLAPYTESTIKPMINASAIGAAKSCNGGYDGHTCGLSWQKGTNDGYYGMGEQM 374

Query: 361 SALEVMQQLLIHQKAAPFTEQTGG 384
           SALE++Q LLI+    P     GG
Sbjct: 375 SALEIIQNLLINDYPPPLVAPNGG 398

>ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 450

 Score =  464 bits (1193), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 221/397 (55%), Positives = 279/397 (70%), Gaps = 4/397 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            LD++ +S  SIC AT LIQ+G+LDYYEG R GG VG FQ PYYWW AG+ FGGM++NWY
Sbjct: 14  ALDVNFNSSASICNATKLIQQGILDYYEGLRPGGRVGFFQEPYYWWMAGDVFGGMVENWY 73

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTN-PTN 120
            C+NT ++ L+ + M++Q G + DY+P +Q MVEGNDDQG+WGL +M A ER+F + P +
Sbjct: 74  LCDNTEYKDLLTEAMVSQIGENKDYVPWHQRMVEGNDDQGIWGLLVMDAAERDFPDAPPD 133

Query: 121 GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180
            APGWLA+AQA+FN + +RWD  NC GGL WQI+ WN GY+YKNTISN  LFQIAARL R
Sbjct: 134 QAPGWLALAQAVFNTMWARWDMDNCAGGLLWQIYPWNVGYDYKNTISNGYLFQIAARLAR 193

Query: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           +TGN TY  VAE VFDWLVD   V L +V  V DGA +  NCT   + EW+YN+GVVLGG
Sbjct: 194 FTGNSTYGRVAETVFDWLVDSKLVQLDNVALVLDGAHVYTNCTDFTRYEWTYNYGVVLGG 253

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
            A+MYN TNGS  W  R+ ++L GA   FF++ IMYE  CQ      CN+DQR FK+IF+
Sbjct: 254 CAYMYNFTNGSPVWANRLNRVLNGA-LLFFENGIMYERTCQ--DVDRCNNDQRFFKSIFT 310

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           RML LTSVL P T+++++  +++          GG+DGHTCGL W     DG  GLGEQ+
Sbjct: 311 RMLALTSVLAPHTKARIEPNIRKSAEAAAKSCNGGSDGHTCGLVWRNYTWDGKAGLGEQL 370

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTS 397
            ALE++Q  LIH K  P T + G  S GD  AGLN+S
Sbjct: 371 CALEIIQNTLIHTKRPPLTAKQGAKSKGDPAAGLNSS 407

>KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 448

 Score =  461 bits (1185), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/435 (50%), Positives = 301/435 (69%), Gaps = 6/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            LD D  ++ SI  ATAL+  G+LDYY G + G T+GMF +PYYWW+AG A+G ++D W+
Sbjct: 20  ALDFDVDNEGSIKNATALVAGGLLDYYTGQQYGQTIGMFSNPYYWWEAGGAWGSILDFWW 79

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           + +N T+ +++ + +L Q G ++DY+P NQ+  EGNDDQ  WGL +M A ERNFTNP   
Sbjct: 80  YTQNDTYNAMLEEALLYQAGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNPPET 139

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WL +AQA+FN +  RWD  +CGGGLRWQIFTWN GY+YKNT+SN  LF +AARL RY
Sbjct: 140 EPQWLYLAQAVFNTMALRWDDESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLARY 199

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN+TY++ AE VFDW+  +G +   D   V+DGA++D NC++I KL W+YN G+++ G 
Sbjct: 200 TGNNTYVDWAEKVFDWMKGIGLLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGLLMSGC 259

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A++YN T GS  W TR  + L  ++  FF +SI+YE  CQ    +TCN+DQRSFKA FSR
Sbjct: 260 AYLYNYT-GSETWHTRTFEFLNSSD-IFFNNSILYERTCQ--EANTCNTDQRSFKAYFSR 315

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
            LGLT+ LVP+ ++++ D ++           GGTDGHTCGLNW     DG +GLGEQM+
Sbjct: 316 FLGLTAQLVPAARNQIMDWIRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGEQMA 375

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALE+MQ +L   + AP+T  TGGSS G+  AG  TS+ N+  + LDI T  RA A IITA
Sbjct: 376 ALEIMQNVLCLDRPAPYTAATGGSSVGNGAAGTETSATNL--SPLDITTGSRAAAGIITA 433

Query: 422 VILMVLVGGSIWMLF 436
           VI + +V  ++W++ 
Sbjct: 434 VIGLSIVACTVWLVL 448

>Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C -
           Hypothetical ORF [contig 58] FULL
          Length = 449

 Score =  456 bits (1174), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 221/436 (50%), Positives = 299/436 (68%), Gaps = 5/436 (1%)

Query: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60
           +G+ LD ++ +SI  ATAL+  G+LDYY G + G T+GMF  PYYWW+AG A+G ++D W
Sbjct: 19  LGIYLDVNNTESIKNATALVAGGLLDYYTGLQYGETIGMFSDPYYWWEAGGAWGSILDYW 78

Query: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN 120
           ++ +N T+  ++   +L Q+G ++DY+P NQ+  EGNDDQ  WGL +M A ERNFTNP  
Sbjct: 79  HYTQNDTYNKILEQALLYQSGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNPPP 138

Query: 121 GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180
             P WL +AQA+FN +  RWD   CGGGLRWQIFTWN GY+YKNT+SN  LF +AARL R
Sbjct: 139 DQPQWLYLAQAVFNTMALRWDEDTCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLAR 198

Query: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           YTGNDTY+E AE VFDW+  +  +  ++   V+DGA++D+NCT I KL W+YN G+++ G
Sbjct: 199 YTGNDTYVEWAEKVFDWMKGIKLLTEENENFVYDGAKVDDNCTVITKLIWTYNQGLLMSG 258

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
            A++YN T G+ +W TR  + L  +   FF +S++YE  CQG  T +CN+DQRSFKA FS
Sbjct: 259 SAYLYNYT-GAEKWHTRTFEFLNSSH-IFFNNSVLYERACQGV-TVSCNTDQRSFKAYFS 315

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           R +GLT+ LVP ++SK+   ++           GG DGHTCGLNW     DG +GLGEQM
Sbjct: 316 RFMGLTAQLVPESRSKIMAWIQASALGAAQSCSGGRDGHTCGLNWFYDGWDGKWGLGEQM 375

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIIT 420
           SALE+MQ LL   + AP+T +TGGSS G+  AG  TS+ N+  + L I    RA A IIT
Sbjct: 376 SALEIMQNLLCLDRPAPYTAETGGSSVGNGAAGTETSATNL--SPLAITAGSRAAAGIIT 433

Query: 421 AVILMVLVGGSIWMLF 436
           AVI + +V  +IW++ 
Sbjct: 434 AVIGLSIVACTIWLVL 449

>SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 451

 Score =  455 bits (1170), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 215/435 (49%), Positives = 293/435 (67%), Gaps = 5/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            +DLD    +S+  ATAL+  G++DYY G + G T+GMF +PYYWW+AG A+G M+D W+
Sbjct: 22  AMDLDVDDLNSLKNATALVAYGLMDYYTGLQYGQTIGMFSNPYYWWEAGGAWGSMLDYWW 81

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           + EN T+  ++   +L QTG  +DY+P NQ+  EGNDDQ  WGL +M A ERNF+NP   
Sbjct: 82  YMENDTYNDIVKQALLYQTGDDHDYVPLNQSTTEGNDDQAFWGLAVMAAAERNFSNPDPD 141

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WL +AQA+FN +  RWD  +CGGGLRWQIFTWN GY+YKN++SN  LF IAARL RY
Sbjct: 142 QPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFTWNSGYDYKNSVSNGALFHIAARLARY 201

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN +Y++ AE VFDW+ DVG +   D   V DG  ID+NCTS+   +W+YNHG+++ G 
Sbjct: 202 TGNQSYVDWAEKVFDWMRDVGLITEGDWAFVHDGVSIDDNCTSVTPYQWTYNHGLIMAGS 261

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A++YN T GS  W  R  + L  +  +F   SI++E+ CQ   ++TCN+DQRSFKA FSR
Sbjct: 262 AYLYNFT-GSEVWHNRTKEFLHSSSVFFKNGSILWEAACQ--ASNTCNTDQRSFKAYFSR 318

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
            LGLT+ LVP ++S++ + ++           GG DGHTCG+NW   + DG+YGLGEQM+
Sbjct: 319 FLGLTAQLVPESRSQIMEWIRSSAKGAAESCSGGRDGHTCGINWFNGSWDGFYGLGEQMA 378

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALE++Q +    + AP+T  TGGSS GD+ AG  T   N+    L I    RAGA IITA
Sbjct: 379 ALEIIQNVRCLDRPAPYTSTTGGSSQGDSAAGTETHPTNL--TPLTITAGSRAGAGIITA 436

Query: 422 VILMVLVGGSIWMLF 436
           VI + +V  ++W++ 
Sbjct: 437 VIGISIVACAVWLVL 451

>KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {ON}
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 450

 Score =  447 bits (1149), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 222/438 (50%), Positives = 292/438 (66%), Gaps = 8/438 (1%)

Query: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60
            GLDLD +  +S+  AT+L+  G++DYY G + G T+GMF SP YWWQAG A+G ++D W
Sbjct: 19  FGLDLDVNDLNSLKNATSLVAYGLMDYYTGLQYGKTIGMFASPSYWWQAGGAWGSILDYW 78

Query: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN 120
           ++ EN T+  ++   +L QTG ++DYMP NQT+ EGNDDQ  WG  +M A ERN+ NP +
Sbjct: 79  FYMENDTYNDILTQALLYQTGDNHDYMPLNQTVTEGNDDQAFWGFAVMAAAERNYPNPPD 138

Query: 121 GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180
             P WL +AQA+FN ++SRWD  +CGGGLRWQIFTWN GY+YKN++SNA LF ++ARL R
Sbjct: 139 DEPQWLYLAQAVFNTMSSRWDMDSCGGGLRWQIFTWNSGYDYKNSVSNAALFHLSARLAR 198

Query: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDVGN--VFDGAEIDNNCTSINKLEWSYNHGVVL 238
           YTGN +Y E AE ++DW+ D+  +V ++     V+DGA I+ NCT   K +W+YN G++L
Sbjct: 199 YTGNSSYTEWAEKIYDWMQDIQLLVDEEPTQYYVYDGASIEENCTDTVKYQWTYNQGLML 258

Query: 239 GGLAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAI 298
            G A++YN T  S  W  R    L  +   FF +SIMYE+ CQG G   CN+DQRSFKA 
Sbjct: 259 SGSAYLYNFTE-SETWHERTKNFL-NSSGIFFNNSIMYEAACQGSG--YCNNDQRSFKAY 314

Query: 299 FSRMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGE 358
           FSR LGLT+ LVP T+  V  LL+           GGTDGHTCGLNW     DG YGLGE
Sbjct: 315 FSRFLGLTAQLVPETRDTVLALLQASAQGAADSCSGGTDGHTCGLNWFYGGWDGKYGLGE 374

Query: 359 QMSALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAI 418
           QM+ALEVMQ L    + AP+T   GG+SAG+  AG   S  N+    L I   D+AGA I
Sbjct: 375 QMAALEVMQNLRCLDRPAPYTADDGGTSAGNPAAGTEQSPTNLA--PLTIGKGDQAGAGI 432

Query: 419 ITAVILMVLVGGSIWMLF 436
           ITAVI + ++G  +W++ 
Sbjct: 433 ITAVIGITIIGSVVWLII 450

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score =  440 bits (1132), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 217/431 (50%), Positives = 282/431 (65%), Gaps = 6/431 (1%)

Query: 5   LDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYFCE 64
           LD  + +S+  ATAL+  G++DYY G + G T+GMF  PYYWW+AG A+G M+D W+F E
Sbjct: 27  LDLDNYESLQNATALVAYGLMDYYTGLQYGKTIGMFSDPYYWWEAGGAWGCMLDYWFFME 86

Query: 65  NTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNGAPG 124
           N T+  +I   +L Q G   DY+P NQ+  EGNDDQ  WG+  M A ERNFTNP    P 
Sbjct: 87  NDTYNDIIKQALLYQVGTANDYVPLNQSTTEGNDDQAFWGIAAMMAAERNFTNPAEDEPQ 146

Query: 125 WLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYTGN 184
           WL +AQA+FN +  RWDT +CGGGLRWQIF WN GY+YKN++SN  LF IAARL RYTGN
Sbjct: 147 WLYLAQAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDYKNSVSNGALFHIAARLARYTGN 206

Query: 185 DTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLAFM 244
           D+Y E AE V+DW+VDV  +       V+DG + ++NCT+I K +W+YN G++L G A++
Sbjct: 207 DSYAEWAEKVYDWMVDVDLITQDQYYFVYDGVDSNDNCTTITKYQWTYNQGLILSGCAYL 266

Query: 245 YNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSRMLG 304
           YN T GS  W TR    L  + S FF D+I+YE+ CQ     TCN+DQRSFKA FSR LG
Sbjct: 267 YNYT-GSELWHTRTKNFL-SSSSVFFNDTILYEAACQNQ--ETCNTDQRSFKAYFSRFLG 322

Query: 305 LTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMSALE 364
           +T+ LVP T+  +   +            GGTDGHTCG+NW     DG YGLGEQM+ALE
Sbjct: 323 VTAQLVPETRDNIMKWIDASAYGAAESCSGGTDGHTCGINWFYGGWDGKYGLGEQMAALE 382

Query: 365 VMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITAVIL 424
           ++       + AP+T   GGSS GD  AG  TS+ N+  + L+I    RAGA IITAVI 
Sbjct: 383 ILVNTRALDRPAPYTSSNGGSSTGDGAAGTETSATNL--SPLNITAGSRAGAGIITAVIG 440

Query: 425 MVLVGGSIWML 435
           + +V  + W++
Sbjct: 441 ISIVACACWLV 451

>NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {ON}
           Anc_2.570
          Length = 452

 Score =  440 bits (1132), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 219/435 (50%), Positives = 284/435 (65%), Gaps = 6/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            L++D    DS+  AT+L+  G++DYY G + G T+GMF  PYYWW+AG A+G M+D WY
Sbjct: 24  ALEIDLDDIDSLRNATSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGSMLDYWY 83

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           + +N T+   I   +L QTG + DY+P NQ+  EGNDDQ  WG+ +M A ERNFTNP   
Sbjct: 84  YMDNDTYNDEIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWGIAVMTAAERNFTNPPED 143

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
           +P WL +AQA+FN +  RWD   CGGGLRWQIF WN GY+YKNT+SN  LF +AARL RY
Sbjct: 144 SPQWLYLAQAVFNTMALRWDGDTCGGGLRWQIFVWNSGYDYKNTVSNGALFHMAARLARY 203

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN +Y++ AE V+DW+ +VG V       V+DG  I NNC++I   +W+YNHG+V+ G 
Sbjct: 204 TGNQSYVDWAEKVYDWMYEVGLVSNGSSMFVYDGVNIANNCSTITPYQWTYNHGLVMAGA 263

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A++YN T  +  W  R T++L  A + FF +SIMYE+ CQ  G ++CN+DQRSFKA FSR
Sbjct: 264 AYLYNFTE-NEVWHNR-TKMLVDASTVFFNNSIMYEAACQ--GPNSCNTDQRSFKAYFSR 319

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
            LG T+ LVP T+SK+  L+            GGTDGHTCGLNW     DG YGLGEQM 
Sbjct: 320 FLGATAQLVPETRSKILPLINASAIAAGKSCSGGTDGHTCGLNWFIGDWDGMYGLGEQMC 379

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALEVM       K AP+T   GGSS GD  AG      N+    L I    RAGA IITA
Sbjct: 380 ALEVMVNTRCLHKPAPYTSTNGGSSVGDGAAGTEHHPTNLA--PLHITKGSRAGAGIITA 437

Query: 422 VILMVLVGGSIWMLF 436
           VI + ++  ++W++F
Sbjct: 438 VIGISILACALWLVF 452

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score =  436 bits (1121), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 217/435 (49%), Positives = 281/435 (64%), Gaps = 6/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            ++LD  + +S+  AT+LI  G++DYY G + G TVGMF  PYYWW+AG A+G M+D W+
Sbjct: 21  AVELDLDNYESLQNATSLIAYGLMDYYTGNQYGKTVGMFSDPYYWWEAGGAWGCMLDYWF 80

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           F +N T+   I   M+ Q G   DY+P NQ+  EGNDDQ  WG+  M A ERNFTNP   
Sbjct: 81  FMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPEN 140

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WL +AQA+FN +  RWD  +CGGGLRWQIF WN GY+YKNT+SN  LF IAARL RY
Sbjct: 141 EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARY 200

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN TY++ AE V++W+V V  +       V+DG  ID+NCT +   +W+YN G++L G 
Sbjct: 201 TGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLLAGS 260

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A++YN T GS  W TR  + L  A   FF D I+YE+ CQ  G ++CN+DQRSFKA F+R
Sbjct: 261 AYLYNFT-GSDLWHTRTKEFL-NASQVFFHDGIVYEAACQ--GPNSCNTDQRSFKAYFAR 316

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
            LG+T+ LVP T++++   L            GGTDGHTCGLNW     DG YGLGEQMS
Sbjct: 317 FLGVTAQLVPETRNQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQMS 376

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALEVM       K AP+T + GGSS GD  AG      N+    L+I    +AGA IITA
Sbjct: 377 ALEVMVNTRALDKPAPYTAENGGSSVGDGAAGTQAQPTNLA--PLNITKGSKAGAGIITA 434

Query: 422 VILMVLVGGSIWMLF 436
           VI + +V  ++W++F
Sbjct: 435 VIGISIVACALWLVF 449

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score =  435 bits (1119), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 216/435 (49%), Positives = 282/435 (64%), Gaps = 6/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            ++LD  +  S+  AT+LI  G++DYY G + G TVGMF  PYYWW+AG A+G M+D W+
Sbjct: 22  AVELDLDNYQSLQNATSLIAYGLMDYYTGDQYGKTVGMFSDPYYWWEAGGAWGCMLDYWF 81

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           F EN T+   I   M+ Q G   DY+P NQ+  EGNDDQ  WG+  M A ERNFTNP + 
Sbjct: 82  FMENDTYNDEITAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPSD 141

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WL +AQA+FN +  RWD  +CGGGLRWQIF WN GY+YKNT+SN  LF IAARL RY
Sbjct: 142 EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARY 201

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN+TY++ AE V++W+V V  +       V+DG  ID+NCT +   +W+YN G++L G 
Sbjct: 202 TGNETYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLLAGS 261

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A++YN T GS  W TR  + L  A   FF D I+YE+ CQ  G ++CN+DQRSFKA F+R
Sbjct: 262 AYLYNFT-GSDLWHTRTKEFL-NASQVFFHDGIVYEAACQ--GPNSCNTDQRSFKAYFAR 317

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
            LG+T+ LVP T+S++   L            GGTDGHTCGLNW     DG YGLGEQM+
Sbjct: 318 FLGVTAQLVPETRSQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQMA 377

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALEVM       + +P+T   GGSS GD  AG      N+  + L+I    +AGA IITA
Sbjct: 378 ALEVMVNTRALDRPSPYTADNGGSSVGDGAAGTQAQPTNL--SPLNITKGSKAGAGIITA 435

Query: 422 VILMVLVGGSIWMLF 436
           VI + +V  ++W++F
Sbjct: 436 VIGISIVACALWLVF 450

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  435 bits (1118), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 218/435 (50%), Positives = 280/435 (64%), Gaps = 6/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            L LD ++  S+   TAL+  G++DYY G + G TVGMF +PYYWW+AG A+G M+D W+
Sbjct: 19  ALSLDLNNYQSLENDTALVAYGLMDYYNGDQYGQTVGMFSNPYYWWEAGGAWGTMLDYWF 78

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           F EN T+  LI   +L QTG + DY+P NQ+  EGNDDQ  WG+  M A ERNFTNP   
Sbjct: 79  FMENDTYNDLIMSALLHQTGENNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPES 138

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
           +P WL +AQA+FN +  RWD  NCGGGLRWQIF WN GY+YKN++SN  LF +AARL RY
Sbjct: 139 SPQWLYLAQAVFNTMALRWDAQNCGGGLRWQIFVWNSGYDYKNSVSNGALFHLAARLARY 198

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN +Y++ AE  +DW+ DVG +       V+DG  I+ NCT+I   +WSYN G++L G 
Sbjct: 199 TGNQSYVDWAEKTYDWMSDVGLISNGTQKYVYDGTSIETNCTTITSYQWSYNQGLMLAGA 258

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A++YN T GS+ W  R   +L  A S FF +SIMYE  CQ  G  TCN+DQRSFK+  +R
Sbjct: 259 AYLYNFT-GSTIWLNRTMDLL-DATSVFFNNSIMYEVACQPTG--TCNNDQRSFKSYLAR 314

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
            LGLT+ LV  TQS++ + L            GGTDGHTCGLNW     DGYYGLGEQMS
Sbjct: 315 FLGLTAQLVTITQSRIMNWLNTSAIAVAHSCSGGTDGHTCGLNWFDNGWDGYYGLGEQMS 374

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           AL+V+    +  + AP+    GGSS GD  AG   +  N+    L I    + GAA ITA
Sbjct: 375 ALDVLVNTRVLDRPAPYNSTNGGSSIGDGAAGTEATPTNLA--PLHITKGSKVGAAFITA 432

Query: 422 VILMVLVGGSIWMLF 436
            I + +V  SIW++ 
Sbjct: 433 AIGLSIVFTSIWIIL 447

>KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {ON}
           Anc_2.570 YKL046C
          Length = 448

 Score =  432 bits (1111), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 215/434 (49%), Positives = 281/434 (64%), Gaps = 6/434 (1%)

Query: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62
           L+LD  S +S+  ATAL+  G++DYY G + G TVGMF  PYYWW+AG A+G MID WY+
Sbjct: 21  LELDLDSFESLQNATALVAYGLMDYYTGNQYGKTVGMFSDPYYWWEAGGAWGSMIDFWYY 80

Query: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNGA 122
            +N T+   I   +L QTG  +DY+P NQ+  EGNDDQ  WG+ +M A ERNFTNP +  
Sbjct: 81  MDNNTYNDDIMAALLHQTGDDWDYIPLNQSTTEGNDDQAFWGIAVMTAAERNFTNPPDDQ 140

Query: 123 PGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYT 182
           P WL +AQA+FN +  RWD A CGGGLRWQIFTWN GY+YKNT+SN  LF +AARL RYT
Sbjct: 141 PQWLYLAQAVFNTMALRWDDATCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLARYT 200

Query: 183 GNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLA 242
           GN +Y++ AE V++W+ D   +       V+DGA + +NCT++ K +W+YN G++L G A
Sbjct: 201 GNTSYVDWAEKVYNWMEDTYLISNGTQMFVYDGASVTDNCTTVTKYQWTYNQGLLLSGSA 260

Query: 243 FMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSRM 302
           ++YN T  S  W  R    L  A   FF +SIMYE+ CQ  G  TCN+DQRSFKA FSR 
Sbjct: 261 YLYNFTE-SELWHERTKGFL-NASVVFFNNSIMYEAACQ--GPQTCNTDQRSFKAYFSRF 316

Query: 303 LGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMSA 362
           LG T+ LVP T+  V   +            GGTDGHTCG+NW     DGYYGLGEQMSA
Sbjct: 317 LGATAQLVPETRDTVMHWVNTSAVAAATSCSGGTDGHTCGINWFYGGWDGYYGLGEQMSA 376

Query: 363 LEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITAV 422
           LE+M       K  P+T + GGSS GD  AG   ++ N+  + L++    +A A IITAV
Sbjct: 377 LEIMVNTRALHKPGPYTSENGGSSMGDGAAGTQATATNL--SPLNVTPGSKAAAGIITAV 434

Query: 423 ILMVLVGGSIWMLF 436
           I + +    +W+++
Sbjct: 435 IGISIFACVLWLIY 448

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score =  432 bits (1111), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 215/435 (49%), Positives = 278/435 (63%), Gaps = 6/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            L LD +  +S+  AT+L+  G++DYY G + G TVGMF  PYYWWQAG A+G M+D WY
Sbjct: 25  ALTLDLNDTESLQNATSLVAYGLMDYYTGNQYGKTVGMFSDPYYWWQAGGAWGSMLDYWY 84

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           +  N T+   I   +L QTG   DY+P NQ+  EGNDDQ  WG+ +M A ERNFTNP   
Sbjct: 85  YMNNDTYNDDIMAALLHQTGDDNDYVPLNQSTTEGNDDQAFWGIAVMTAAERNFTNPPED 144

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WL +AQA+FN +  RWD+  CGGGLRWQIF WN GY+YKNT+SN  LF IA+RL RY
Sbjct: 145 QPQWLYLAQAVFNTMAMRWDSDTCGGGLRWQIFIWNSGYDYKNTVSNGALFHIASRLARY 204

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN +Y++ AE V+DW+ DV  +       V+DG  I +NCT++   +W+YN G++L G 
Sbjct: 205 TGNQSYVDWAEKVYDWMYDVHLISNGSYMYVYDGVNIGDNCTTVTPYQWTYNQGLLLSGC 264

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A++YN T G   W  R   +L  A   FF +SI+YE+ CQG   +TCN+DQRSFKA FSR
Sbjct: 265 AYLYNFT-GEELWHNRTKNLLTAA-GVFFNNSILYEAACQGH--NTCNTDQRSFKAYFSR 320

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
            LG T+ LVP T++++   +            GGTDGHTCG+NW     DG YGLGEQM+
Sbjct: 321 FLGTTAQLVPETRNQIMHWINTSAVAAAQSCSGGTDGHTCGINWFADGWDGMYGLGEQMA 380

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALE+M       KAAP+T   GGSS GD  AG      N+    L I    RAGA IITA
Sbjct: 381 ALEIMVNTKALSKAAPYTSSNGGSSVGDGAAGTEPHPTNLA--PLHITKGSRAGAGIITA 438

Query: 422 VILMVLVGGSIWMLF 436
           VI + +V  ++W++F
Sbjct: 439 VIGISIVTCALWLVF 453

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  432 bits (1110), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 213/435 (48%), Positives = 280/435 (64%), Gaps = 6/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            ++LD  + +S+  AT+L+  G++DYY G + G T+GMF  PYYWW+AG A+G M+D W+
Sbjct: 21  AVELDLDNYESLQNATSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGCMLDYWF 80

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           F +N T+   I   M+ Q G   DY+P NQ+  EGNDDQ  WG+  M A ERNFTNP   
Sbjct: 81  FMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPED 140

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WL +AQA+FN +  RWD  +CGGGLRWQIF WN GY+YKNT+SN  LF IAARL RY
Sbjct: 141 DPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARY 200

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN TY++ AE V++W+V V  +       V+DG  ID+NCT +   +W+YN G++L G 
Sbjct: 201 TGNQTYVDWAEKVYEWMVGVDLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLLAGS 260

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A++YN T GS  W TR  + L  A   FF D I+YE+ CQ  G ++CN+DQRSFKA F+R
Sbjct: 261 AYLYNFT-GSDLWHTRTKEFL-NASQVFFHDGIVYEAACQ--GPNSCNTDQRSFKAYFAR 316

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
            LG+T+ LVP T+ ++   L            GGTDGHTCGLNW     DG YGLGEQMS
Sbjct: 317 FLGVTAQLVPETRHQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQMS 376

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALEV+       + AP+T + GGSS GD  AG      N+    L+I    +AGA IITA
Sbjct: 377 ALEVLVNTRALDRPAPYTAENGGSSVGDGAAGTQARPTNLA--PLNITKGSKAGAGIITA 434

Query: 422 VILMVLVGGSIWMLF 436
           VI + +V  ++W++F
Sbjct: 435 VIGISIVACALWLVF 449

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  431 bits (1108), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 214/435 (49%), Positives = 283/435 (65%), Gaps = 6/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            ++LD  + +S+  AT+LI  G++DYY G + G T+GMF  PYYWW+AG A+G M+D W+
Sbjct: 21  AVELDLDNYESLENATSLIAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGCMLDYWF 80

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           F +N T+   I   M+ Q+G   DY+P NQ+  EGNDDQ  WG+  M A ERNFTNP   
Sbjct: 81  FMDNDTYNDEIIAAMVHQSGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPAD 140

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WL +AQA+FN +  RWD  +CGGGLRWQIF WN GY+YKNT+SN  LF IAARL RY
Sbjct: 141 EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARY 200

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN TY++ AE V++W+V V  +       V+DG  I +NCT +   +W+YN G++L G 
Sbjct: 201 TGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIGDNCTKVTSYQWTYNQGLLLAGS 260

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A++YN T GS  W TR  + L  ++  FF+D I+YE+ CQ  G ++CN+DQRSFKA F+R
Sbjct: 261 AYLYNFT-GSDLWHTRTKEFLNSSQV-FFQDGIVYEAACQ--GPNSCNTDQRSFKAYFAR 316

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
            LG+T+ LVP T++++   L            GGTDGHTCGLNW     DG YGLGEQM+
Sbjct: 317 FLGVTAQLVPETRNQIMTWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQMA 376

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALEVM       K AP+T   GGSSAGD  AG      N+    L+I    +AGA IITA
Sbjct: 377 ALEVMVNTRALDKPAPYTADEGGSSAGDGAAGTQAQPTNLA--PLNITKGSKAGAGIITA 434

Query: 422 VILMVLVGGSIWMLF 436
           VI + +V  ++W++F
Sbjct: 435 VIGISIVACALWLVF 449

>KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.570
           YKL046C
          Length = 449

 Score =  426 bits (1094), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 218/434 (50%), Positives = 291/434 (67%), Gaps = 6/434 (1%)

Query: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62
           L+LD     S+  ATAL+  G++DYYEGT+ GGTVGMF SPYYWW+AG AFG ++D WYF
Sbjct: 22  LELDLDDYQSLQNATALVAWGLMDYYEGTKYGGTVGMFSSPYYWWEAGGAFGTLLDFWYF 81

Query: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNGA 122
            +N T+   I   M+ Q G  +DY+P NQ+  EGNDDQ  WG+  M A ERNFTNP +  
Sbjct: 82  MDNDTYNDEILAAMVYQAGNDWDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPASDE 141

Query: 123 PGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYT 182
           P WL +AQA+FN +  RWDT +CGGGLRWQIFTWN GY+YKN++SN  LF +AARL RYT
Sbjct: 142 PQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFTWNSGYDYKNSVSNGALFHLAARLARYT 201

Query: 183 GNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLA 242
           GND+Y++ AE V++W+ D G++   +   V+DGA  ++NC+S+ K +W+YN G++L G A
Sbjct: 202 GNDSYVDWAEKVYNWMEDTGFITTGNTLYVYDGASTEDNCSSVTKYQWTYNQGLILSGAA 261

Query: 243 FMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSRM 302
           ++YN +  SS W  R    L  +   F  +SIM E+ CQ  G  TC++DQRSFKA F+R 
Sbjct: 262 YLYNYSE-SSLWYNRTMTAL-SSSGVFLNNSIMCEAACQPAG--TCDTDQRSFKAYFARF 317

Query: 303 LGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMSA 362
           LG+T+ LVPST++++   +            GGTDGHTCGLNW   + DGYYGLGEQMSA
Sbjct: 318 LGVTAQLVPSTRTQIMTWMNASAYAVAESCSGGTDGHTCGLNWFLGSWDGYYGLGEQMSA 377

Query: 363 LEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITAV 422
           LEV+       K  P+    GGSS GD  AG  T++ N+    L+I    +A AAIITAV
Sbjct: 378 LEVLVNTRALDKPGPYNSTNGGSSQGDGAAGTETTATNLA--PLNITGGSKAAAAIITAV 435

Query: 423 ILMVLVGGSIWMLF 436
           I + L+  ++W++F
Sbjct: 436 IGISLIACTLWIIF 449

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  418 bits (1075), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 209/435 (48%), Positives = 275/435 (63%), Gaps = 6/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            +DL+ +S  S+  AT+L+  G++DYY G + G TVGMF  PYYWW+AG A+G M+D WY
Sbjct: 19  AVDLNLNSLQSLQNATSLVAYGLMDYYTGDQYGQTVGMFSDPYYWWEAGGAWGTMLDYWY 78

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           F +N T+  +I   +L Q G   +Y+P NQ+  EGNDDQ  WG+T+M A ERNFTNP   
Sbjct: 79  FMQNDTYNDIITAALLHQVGTDNNYIPLNQSTTEGNDDQAFWGITVMTAAERNFTNPPED 138

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WL +AQA+FN +  RWD  +CGGGLRWQIF WN GY+YKN++SN  LF +AARL RY
Sbjct: 139 QPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNSVSNGALFHMAARLARY 198

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN +Y++ AE V+DW+ DVG +       V+DGA   +NCT +   +W+YN G++L G 
Sbjct: 199 TGNQSYVDWAERVYDWMSDVGLISNGSYKFVYDGASTTDNCTVLTTYQWTYNQGLLLSGA 258

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301
           A++YN T GS  W  R  Q+L  A S FF +SI+YE+ CQ  G  TCN+DQRSFKA F R
Sbjct: 259 AYLYNYT-GSDTWLLRTNQLL-NASSVFFNNSILYEAACQKSG--TCNNDQRSFKAYFLR 314

Query: 302 MLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMS 361
            LG T+ LV  TQ  +   L            GGTDGHTCGLNW     DG YGLGEQMS
Sbjct: 315 FLGQTAQLVSETQPTIMKWLNASAYAAAQSCSGGTDGHTCGLNWFSGGWDGMYGLGEQMS 374

Query: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421
           ALE +    +     P+    GGSS G++ AG    + N+    L I    +A AAIIT+
Sbjct: 375 ALEALVNTRVLHLPGPYNSTDGGSSIGNSAAGTEQEATNLA--PLHITDGSKAAAAIITS 432

Query: 422 VILMVLVGGSIWMLF 436
           V+ + +V   +W++ 
Sbjct: 433 VVGISIVAAGVWLII 447

>ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL046C
          Length = 451

 Score =  413 bits (1061), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 208/436 (47%), Positives = 275/436 (63%), Gaps = 8/436 (1%)

Query: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62
           L+LD     SI  AT+L+  G++DYY G   G TVG F  PYYWW+AG A+G ++D WY+
Sbjct: 22  LNLDVDDLQSIREATSLLATGLMDYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYY 81

Query: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNGA 122
            EN+T+  L+ D +L Q G    Y P N+T  EGNDDQ  WG+ +M A ER   NP    
Sbjct: 82  MENSTYNDLLTDSLLHQAGEDLSYTPWNETTTEGNDDQFFWGMAVMDAAERKNPNPPADQ 141

Query: 123 PGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYT 182
           P  LA+AQA+FN +  RWD   C GGLRWQIF WN GY+YKN++SN  LF +AARL RYT
Sbjct: 142 PQRLALAQAVFNTMALRWDMETCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRYT 201

Query: 183 GNDTYLEVAENVFDWLVDVGY--VVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           GN TYLE AE V+DW+  VG   +V  +   V+DG +I++NCT++NKL+W+YNHG+++ G
Sbjct: 202 GNATYLEWAERVYDWMYGVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMAG 261

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
            AF+YN T     W  R  + L  A   F  +  +YE+ CQG     CN DQRSFKA FS
Sbjct: 262 CAFIYNHTQ-DELWHQRTLRFLDSAR-IFLSNDTLYEAGCQGG--DNCNIDQRSFKAYFS 317

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           R LGLT+ LVP ++  +   ++           GG DGHTCGLNW     DG +GLGEQM
Sbjct: 318 RFLGLTAQLVPESRETIVRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQM 377

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIIT 420
           +ALE++Q L   ++ AP+T   GG+S GD  AG  T + N+    LDI+  DRAGA IIT
Sbjct: 378 AALEIIQNLRCLERPAPYTAMNGGTSPGDPAAGTKTKAENL--PPLDIKAGDRAGAGIIT 435

Query: 421 AVILMVLVGGSIWMLF 436
           A+I    +  ++W++ 
Sbjct: 436 ALIGSSFLACTLWLII 451

>TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score =  409 bits (1051), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 203/434 (46%), Positives = 275/434 (63%), Gaps = 7/434 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            + L+ +   S+  A +L+  G++DYY G + G T+GMF +PYYWW+AG A+G MID WY
Sbjct: 20  AVHLNLNVTSSLQNAASLVAVGLMDYYNGDQYGQTIGMFSNPYYWWEAGGAWGCMIDYWY 79

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           F +N T+  +I   +L QTG   DY+P NQ+  EGNDDQ  WG+T+M A ERNFTNP   
Sbjct: 80  FMQNDTYNDIISQALLYQTGDRNDYIPLNQSTTEGNDDQAFWGITVMSAAERNFTNPPPD 139

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WL +AQA+FN +  RWD + C GGLRWQIF WN GY+YKN++SN  LF +AARL RY
Sbjct: 140 KPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSVSNGALFHMAARLARY 199

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGN-VFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           TGN +Y++ A  V+DW+   G +        V+DGA I+ NCT I + +W+YN G++L G
Sbjct: 200 TGNQSYVDWAVKVYDWMEKTGLISNDTYFKFVYDGASIETNCTDITQFQWTYNQGLILSG 259

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
            A++YN T   S+W TR  Q + G+ + FF +SI+YE+ CQ  G+  C++DQRSF+A F+
Sbjct: 260 CAYLYNHTE-DSKWLTRTEQFVNGS-AVFFNNSIVYEAACQ--GSKRCDNDQRSFRAYFA 315

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           R LG+T+ LVP+T+  + D +            GGTDGHTCGLNW     DGYYGLGEQM
Sbjct: 316 RFLGVTAQLVPTTKDIIMDWINTSAYAAAQACSGGTDGHTCGLNWFNIGWDGYYGLGEQM 375

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIIT 420
            ALE +         AP+T   GGSS G+  AG      N+    L I    +AGA IIT
Sbjct: 376 GALEFLVNTRALDMPAPYTSSNGGSSTGNGAAGTEKPPTNL--GPLHITDGSKAGAGIIT 433

Query: 421 AVILMVLVGGSIWM 434
            VI + ++  + W+
Sbjct: 434 CVIGLSILLCTTWL 447

>TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score =  409 bits (1051), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 201/437 (45%), Positives = 277/437 (63%), Gaps = 10/437 (2%)

Query: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60
           + +DLD  S  S+  AT+LI  GM+DYY G   G  +GMF  PYYWW+AG A+G ++D W
Sbjct: 21  LKIDLDDFS--SLQNATSLIAYGMMDYYNGHDYGQVIGMFAKPYYWWEAGGAWGCLLDYW 78

Query: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN 120
           Y+ +N T+  LI + +L QTG   DY+P NQ+  EGNDDQ  WG+  + A ERNFTNP  
Sbjct: 79  YYMQNDTYNDLITEALLYQTGDRNDYVPLNQSTTEGNDDQAFWGIAAITAAERNFTNPPP 138

Query: 121 GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180
             P WL +AQA+FN +  RWD + C GGLRWQIF WN GY+YKN++SN  LF IAARL R
Sbjct: 139 DKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSVSNGALFHIAARLAR 198

Query: 181 YTGNDTYLEVAENVFDWLVDVGYVV--LKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVL 238
           YTGN +Y+E A+ ++DW+   G +    +    V+DGA I+ NCT I + +W+YN G+VL
Sbjct: 199 YTGNQSYVEWADKIYDWMFGTGIISDEYETYKFVYDGANIETNCTDITRYQWTYNQGLVL 258

Query: 239 GGLAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAI 298
            G A++YN T    +W  R  Q L G+   FF+D+++YE+ CQ +    CN+DQRSFKA 
Sbjct: 259 AGCAYLYNHTQ-DEKWLIRTEQFLNGS-VVFFRDNVIYEAACQPN--KNCNNDQRSFKAY 314

Query: 299 FSRMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGE 358
           F+R LG+T+ L+PST+  +   +            GGTDGHTCG++W  +  DGYYGLGE
Sbjct: 315 FARFLGVTAQLIPSTRDTIMRWINTSAYAAAQACSGGTDGHTCGMDWVWKGWDGYYGLGE 374

Query: 359 QMSALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAI 418
           QM+ALE M          P+T   GGSS G   AG      N+  + L I    +AGA+I
Sbjct: 375 QMAALEFMVNTRALDMPPPYTSFNGGSSTGSGAAGTERDPTNL--SPLHITAGSKAGASI 432

Query: 419 ITAVILMVLVGGSIWML 435
           IT ++ + ++ G++W++
Sbjct: 433 ITCIVSISILTGAMWLV 449

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score =  408 bits (1048), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 203/435 (46%), Positives = 280/435 (64%), Gaps = 7/435 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            L+LD     S+  AT+LI  G+LDYY G   G T+GMF SPYYWW+AG A+G +ID W+
Sbjct: 21  ALELDVDDFSSMQSATSLISTGVLDYYTGLDPGNTIGMFSSPYYWWEAGAAWGALIDYWF 80

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           + EN T+  +I   +L Q G + DY+P NQ+  EGNDDQ  WG+ +M A E+ F NP   
Sbjct: 81  YMENDTYNDIIKQALLYQVGKYEDYVPLNQSTTEGNDDQAFWGIAVMSAAEKGFPNPDPD 140

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WLA+AQA+FN +  RWD+++C GGLRWQIFTWN GY+YKN++SN  LF +AARL RY
Sbjct: 141 QPQWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGYDYKNSVSNGALFHLAARLARY 200

Query: 182 TGNDTYLEVAENVFDWLVDVGYV-VLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           TGN +Y + AE V+DW+  V  +    D   V+DGA I +NC+  + L+WSYNHG++LGG
Sbjct: 201 TGNQSYADWAEKVYDWMASVQLINQTGDWTFVYDGAFIHDNCSRPSVLQWSYNHGLILGG 260

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
            A++ + T GS  W  R  ++L  A S FF + ++ E  CQ  G  TCN+DQRSFKA F 
Sbjct: 261 CAYLTDFT-GSDVWHNRTLRLLRSA-SIFFPNGVVTEVACQEAG--TCNTDQRSFKAYFM 316

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           R LGLT+ L+P ++      ++           GG DGHTCG+N+++ + D  YGLGEQ+
Sbjct: 317 RFLGLTAQLIPESREIAMKWIRDSAKGAALSCSGGRDGHTCGMNYSRGSYDESYGLGEQL 376

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIIT 420
           +ALE +Q L   +K +P T   GG+S G+  AG N +   +  + LDI   DRAGA IIT
Sbjct: 377 AALETIQNLRCLEKGSPLTASEGGTSIGNPGAGGNRNLGTL--SPLDISNADRAGAGIIT 434

Query: 421 AVILMVLVGGSIWML 435
           A++   L+   +W++
Sbjct: 435 ALVGFSLISCIVWLV 449

>CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa]
           {ON} highly similar to uniprot|P36091 Saccharomyces
           cerevisiae YKL046c
          Length = 446

 Score =  407 bits (1047), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 200/401 (49%), Positives = 258/401 (64%), Gaps = 4/401 (0%)

Query: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60
            GL+LD     S+  ATAL+  G++DYY G + G TVGMF  PYYWWQAG A+G M+D W
Sbjct: 17  FGLELDLDDYASLQNATALVAYGLMDYYTGDQYGKTVGMFSDPYYWWQAGGAWGCMLDYW 76

Query: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN 120
           YF +N T+   I   +L QTG + DY+P NQ+  EGNDDQ  WG+ +M A ER F NP +
Sbjct: 77  YFMQNDTYNDKIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWGIAVMQAAERKFPNPPD 136

Query: 121 GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180
             P WL + QA+FN +  RWD+  CGGGLRWQIF WN GY+YKNT+SN  LF IAARL R
Sbjct: 137 DKPQWLYLTQAVFNTMALRWDSETCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLAR 196

Query: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240
           YTGN +Y++ AE V+DW+ DV  +       V+DG  I++NCT++ K +W+YN G++L G
Sbjct: 197 YTGNQSYVDWAERVYDWMEDVHLIDNGTYRYVYDGVSINDNCTTVTKYQWTYNQGLMLSG 256

Query: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300
            A+++N T GS  W  R    L  A   FF +SI+YE+ CQ  G +TCN+DQRSFKA F+
Sbjct: 257 SAYLFNMT-GSDLWHERTHAFL-NASRVFFNNSILYEAACQ--GPNTCNTDQRSFKAYFA 312

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           R LG T+ LVP T+ ++   L            GGTDGHTCGLNW +   DG YGLGEQM
Sbjct: 313 RFLGSTAELVPETRQQIMTWLNTSALAAAKSCSGGTDGHTCGLNWFRDDWDGMYGLGEQM 372

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANV 401
           +ALEVM      ++A P+    GG+S GD  AG      N+
Sbjct: 373 AALEVMVNTQALKRAPPYNATNGGNSTGDGAAGTKPHPTNL 413

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score =  405 bits (1042), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 198/432 (45%), Positives = 273/432 (63%), Gaps = 6/432 (1%)

Query: 5   LDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYFCE 64
           +D ++ +SI  A++L+  G++DYY G + G T+GMF  PYYWW+AG A+G M+D W++ +
Sbjct: 22  IDLNNTESIHNASSLVAVGLMDYYTGLQYGETIGMFSDPYYWWEAGGAWGCMLDYWWYMQ 81

Query: 65  NTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNGAPG 124
           N T+  +I   +L Q G H DY+P NQ+  EGNDDQ  WG+  M A ERNFTNP +  P 
Sbjct: 82  NDTYNDIIMQALLYQVGTHNDYVPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPSDQPQ 141

Query: 125 WLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYTGN 184
           WL +AQA+FN +  RWDT +C GGLRWQIF WN GY+YKNT+SN  LF +AARL RYTGN
Sbjct: 142 WLYLAQAVFNTMALRWDTTSCNGGLRWQIFMWNTGYDYKNTVSNGALFNLAARLARYTGN 201

Query: 185 DTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLAFM 244
            +Y++ A+ V+DW+  VG +   +   V+DG  I +NC +I   +WSYNHG++L G A++
Sbjct: 202 QSYVDWADKVYDWMYGVGLISNGNSRFVYDGVNIAHNCANITGYQWSYNHGLMLSGCAYL 261

Query: 245 YNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSRMLG 304
           YN T    +W  R  + L  A S F+ +S++YE  CQ    + CN+DQRSFKA F+R LG
Sbjct: 262 YNMTK-DEKWGNRTFEYLNSA-SIFYNNSVLYEVACQ--TVNKCNTDQRSFKAYFTRFLG 317

Query: 305 LTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQMSALE 364
           +T+ L+P  + +    +            GG DGHTCG+NW     DG YGLGEQMSALE
Sbjct: 318 VTAELIPQARDQAMKWINASALGAAQSCSGGYDGHTCGINWFYDGWDGMYGLGEQMSALE 377

Query: 365 VMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITAVIL 424
            +       +  P+    GGSS GD  AG   S  N+  + LDI    RAGA IIT VI 
Sbjct: 378 ALVNTQALNRPPPYNSTNGGSSTGDGAAGTEESPTNL--SPLDITAGSRAGAGIITCVIG 435

Query: 425 MVLVGGSIWMLF 436
           + ++  ++W++ 
Sbjct: 436 ISILSCALWLIL 447

>KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON} 
          Length = 463

 Score =  405 bits (1042), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 197/391 (50%), Positives = 260/391 (66%), Gaps = 4/391 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            LD+D  + DSI  AT+LI  G++DYY G + G TVGMF  PYYWW+AG A+G M+D  +
Sbjct: 28  ALDIDLDNLDSIRNATSLIAYGLMDYYTGEQYGKTVGMFADPYYWWEAGGAWGSMLDYSW 87

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           F +N T++S I   ML QTG H +Y+P NQ+  EGNDDQ  WG+  M A ERNFTNP   
Sbjct: 88  FMDNDTYDSQIMSAMLHQTGEHNNYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPED 147

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WL +AQA+FN +  RWDT +CGGGLRWQIF WN GY+YKNT+SN  LF +A+RL RY
Sbjct: 148 KPQWLYLAQAVFNTMALRWDTESCGGGLRWQIFNWNSGYDYKNTVSNGALFHMASRLARY 207

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241
           TGN +Y++ AE V+DW+ DV  +       V+DG + ++NC+++ + +W+YNHG++L G 
Sbjct: 208 TGNQSYVDWAEKVYDWMWDVHVISNSTYMFVYDGVDANDNCSTVTQYQWTYNHGLLLAGS 267

Query: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDS-IMYESLCQGDGTSTCNSDQRSFKAIFS 300
           A++YN T G   W  R  +++  A+ +F   + IMYE+ CQ     TCN+DQRSFKA FS
Sbjct: 268 AYLYNFT-GDEVWHNRTKKLVTAAQVFFNSTTGIMYEAACQ--AALTCNNDQRSFKAYFS 324

Query: 301 RMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQM 360
           R LGLT+ LVP T++++   L            GG DGHTCGLNW K   DG YGLGEQM
Sbjct: 325 RFLGLTAQLVPETRTQIMGWLNTSAVAAGKSCSGGYDGHTCGLNWFKDGWDGMYGLGEQM 384

Query: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDAN 391
           SALE +       K AP+T   GGSS G+++
Sbjct: 385 SALECILNTRALMKPAPYTATNGGSSKGESS 415

>ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046C DCW1
           Mannosidase GPI-anchored membrane protein required for
           cell wall biosynthesis homologous to Dfg5p
          Length = 453

 Score =  402 bits (1032), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 195/437 (44%), Positives = 276/437 (63%), Gaps = 8/437 (1%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            LD+D +   ++  A+AL+ KG++DYY G + G T+GMF  PYYWW+AG A+  +ID W+
Sbjct: 21  ALDIDLNDFKTLQNASALVAKGLMDYYTGDQYGQTIGMFSWPYYWWEAGGAWNTLIDYWF 80

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           + +N T+   + + +L Q+G ++DY+P NQ+ VEGNDDQ  WG+ ++ A ER F NP + 
Sbjct: 81  YMKNDTYNDKVTEALLYQSGDNHDYVPLNQSTVEGNDDQAFWGIAVLNAAERKFPNPPDD 140

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WL + QA+FN +  RWDTA CGGGLRWQIFTWN GY+YKNT+SN  LF IAARL  +
Sbjct: 141 QPQWLYLGQAVFNTMALRWDTATCGGGLRWQIFTWNTGYDYKNTVSNGALFHIAARLAYF 200

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGN--VFDGAEIDNNCT-SINKLEWSYNHGVVL 238
           TGN +Y++ AE V+DW+ DV  +  ++  N  V+DG ++ NNC+  + ++ W+YNHG+VL
Sbjct: 201 TGNSSYVDWAERVYDWMHDVKLIEPENDDNKYVYDGVDVSNNCSGPVTRIVWTYNHGLVL 260

Query: 239 GGLAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAI 298
            G A++Y  T G   W  R    L  A   F+ DSI+YE  CQ   + TCN DQRSFK+ 
Sbjct: 261 SGCAYLYKET-GDKIWYNRSKAFLETAAKLFYNDSILYEYSCQ--QSKTCNVDQRSFKSY 317

Query: 299 FSRMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGE 358
           +S  L  T+ L+P  + ++  ++            GG DGHTCG+NWN++  DG YGLGE
Sbjct: 318 YSTFLAATAQLIPDFREQIMKVVNATAYAAAQACVGGYDGHTCGINWNQKGWDGQYGLGE 377

Query: 359 QMSALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAI 418
           QM+ALE +       K AP+    GG+S GD  AG  T+  N+    L I    RAGA I
Sbjct: 378 QMAALEALVVTQAMNKPAPYNSTNGGNSTGDGAAGTQTAPTNL--KPLHITAGSRAGAGI 435

Query: 419 ITAVILMVLVGGSIWML 435
           IT V+   ++   +W++
Sbjct: 436 ITCVVGFSIIASFLWLV 452

>Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON}
           complement(6537..7889) [1353 nt, 451 aa]
          Length = 450

 Score =  396 bits (1017), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 197/415 (47%), Positives = 263/415 (63%), Gaps = 11/415 (2%)

Query: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61
            ++LD ++ DS+  AT+L+  G++DYY G + G T+GMF +PYYWW+AG A+G MID WY
Sbjct: 21  AVELDLNNLDSLRNATSLVAYGLMDYYNGLQYGQTIGMFSNPYYWWEAGGAWGTMIDYWY 80

Query: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121
           + +N T+  +I   +  QTG + DY+P NQ+  EGNDDQ  WG+ +M A ERNFTNP   
Sbjct: 81  YMQNDTYNDIIMQALQYQTGVNNDYVPLNQSTTEGNDDQAFWGIAVMSAAERNFTNPPAD 140

Query: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181
            P WL +AQA+FN +  RWD   C GGLRWQIF WN GY+YKN++SN  LF I ARL R+
Sbjct: 141 RPQWLYLAQAVFNTMALRWDDQTCNGGLRWQIFVWNSGYDYKNSVSNGALFHIGARLARF 200

Query: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGN---VFDGAEIDNNCTSINKLEWSYNHGVVL 238
           TGND+Y+E AE V+DW+  V   +++D G    V+DG  I +NCT +  L+W+YNHG++L
Sbjct: 201 TGNDSYVEWAEKVYDWMESVN--LIEDDGKGAFVYDGVNIGDNCTKVTNLQWTYNHGLIL 258

Query: 239 GGLAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAI 298
            G A++YN T G ++W  R  + L  A   FF  ++M+E+ CQ  G  TC +DQR+FKA 
Sbjct: 259 SGCAYLYNYT-GDAKWYNRTERFLEYAYV-FFNRTVMFEAACQ--GVHTCTTDQRTFKAY 314

Query: 299 FSRMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGE 358
           FSR LG+T+ LVP TQ  +   +            GG DGHTCG+NW     DGYYGLGE
Sbjct: 315 FSRFLGMTAQLVPDTQHTIMTYMNASAYGAAQSCSGGYDGHTCGINWFYGGWDGYYGLGE 374

Query: 359 QMSALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDR 413
           QM ALEVM          P+    GGSS GD  AG      N+  + L+I +  R
Sbjct: 375 QMCALEVMINTRALHVPGPYNSTNGGSSTGDGAAGTEQHPTNL--SPLNITSGSR 427

>TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {ON}
           Anc_2.570 YKL046C
          Length = 449

 Score =  383 bits (984), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 200/436 (45%), Positives = 273/436 (62%), Gaps = 9/436 (2%)

Query: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60
           + L+L+ SS  S+  A AL+  G++DYY G + G T+GMF  PYYWW+AG A+G M+D W
Sbjct: 21  VSLNLNDSS--SLDNAAALVAYGLMDYYNGNQYGQTIGMFSDPYYWWEAGGAWGCMLDYW 78

Query: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN 120
           Y+ +N T+  +IY+ +  QTG   DY+P NQ+  EGNDDQ  WG+  + A ERNFTNP  
Sbjct: 79  YYMQNDTYNDVIYEALQYQTGDDNDYIPLNQSTTEGNDDQAFWGIAAITAAERNFTNPPP 138

Query: 121 GAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180
             P WL +AQA+FN +  RWD+  C GGLRWQIF WN GY+YKN++SN  LF IAARL R
Sbjct: 139 DKPQWLYLAQAVFNTMALRWDSDTCNGGLRWQIFVWNSGYSYKNSVSNGALFHIAARLAR 198

Query: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDVGN-VFDGAEIDNNCTSINKLEWSYNHGVVLG 239
           YTGN +Y++ +E V+DW++  G +        V DG  I+ NCT I   +W+YN G++L 
Sbjct: 199 YTGNQSYVDWSEKVYDWMLGTGLISNGTTYKFVHDGVNIETNCTDITPYQWTYNQGLLLA 258

Query: 240 GLAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIF 299
           G A++YN T    +W  R  Q L G+   FF +S++YE+ CQ +    CN+DQRSFKA F
Sbjct: 259 GCAYLYNFTQ-DEKWLIRTNQFLNGS-GVFFNNSVIYEAACQPN--KNCNNDQRSFKAYF 314

Query: 300 SRMLGLTSVLVPSTQSKVDDLLKQXXXXXXXXXXGGTDGHTCGLNWNKQANDGYYGLGEQ 359
           +R LG+T+ L+PST+  +   +            GGTDGHTCG++WN    DGYYGLGEQ
Sbjct: 315 ARFLGVTAQLLPSTRDTIMQWIDTSAYAAAQACSGGTDGHTCGMDWNWNGWDGYYGLGEQ 374

Query: 360 MSALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAII 419
           M+ALE M          P+T   GGSS G   AG      N+    L+I    +AGA II
Sbjct: 375 MAALEFMVNTRALDLPPPYTSSNGGSSTGSGAAGTEQKPTNL--GPLNITAGSKAGAGII 432

Query: 420 TAVILMVLVGGSIWML 435
           T V+ + ++  S+W++
Sbjct: 433 TCVVGISILACSMWLV 448

>CAGL0H04455g Chr8 (419033..421033) [2001 bp, 666 aa] {ON} weakly
           similar to uniprot|Q03824 Saccharomyces cerevisiae
           YMR163c
          Length = 666

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 14/84 (16%)

Query: 212 VFDGAEIDNNCTSINKLEWSYNHGVVLG---GLAFMYNATNGSSEW--------ETRVTQ 260
           +F G   DNNC S+   +WS    V++     L+F+Y+  N + E         E+   +
Sbjct: 341 LFPGYTEDNNCKSLFSSQWSVLSTVIVKFNQDLSFLYSVLNENKELIYSTETREESETDE 400

Query: 261 ILGGAESYFFKD---SIMYESLCQ 281
           +L     + +KD   S+M ++L Q
Sbjct: 401 MLKERYKFRYKDKNQSLMLKALSQ 424

>Smik_9.160 Chr9 complement(270288..274244) [3957 bp, 1318 aa] {ON}
           YIL030C (REAL)
          Length = 1318

 Score = 31.6 bits (70), Expect = 4.6,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 19  LIQKGMLDYYEGTRIGGTVGM------FQSPYYWWQAGEAFGGMIDNWYFCENTTFESLI 72
           LI K +L ++E TR+  T+G+         P  W   G+ +  M+D  Y       +SLI
Sbjct: 116 LISKSILAFFEKTRLALTIGLAAVLYIIGVPLVWNMFGKLYTMMLDGSYPYPGDFVKSLI 175

Query: 73  Y 73
           Y
Sbjct: 176 Y 176

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,034,991
Number of extensions: 2003107
Number of successful extensions: 4067
Number of sequences better than 10.0: 57
Number of HSP's gapped: 3999
Number of HSP's successfully gapped: 57
Length of query: 436
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 323
Effective length of database: 40,524,141
Effective search space: 13089297543
Effective search space used: 13089297543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)