Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B02240na 1ON58458429520.0
ZYRO0G06710gna 1ON58458423430.0
KLLA0F04257gsingletonON5013661322e-07
ZYRO0E00418gsingletonON5004041313e-07
KLLA0F04125gsingletonON4993691287e-07
TBLA0B05020singletonON5202121288e-07
Kwal_33.15600na 2ON4893481224e-06
KLTH0B00836gna 2ON4903491206e-06
TDEL0H00220singletonON4843481054e-04
TBLA0C030305.252ON523205699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02240
         (584 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02240 Chr2 complement(405511..407265) [1755 bp, 584 aa] {O...  1141   0.0  
ZYRO0G06710g Chr7 complement(537970..539724) [1755 bp, 584 aa] {...   907   0.0  
KLLA0F04257g Chr6 complement(404952..406457) [1506 bp, 501 aa] {...    55   2e-07
ZYRO0E00418g Chr5 (25673..27175) [1503 bp, 500 aa] {ON} conserve...    55   3e-07
KLLA0F04125g Chr6 (392229..393728) [1500 bp, 499 aa] {ON} conser...    54   7e-07
TBLA0B05020 Chr2 (1182196..1183758) [1563 bp, 520 aa] {ON}             54   8e-07
Kwal_33.15600 s33 complement(1179716..1181185) [1470 bp, 489 aa]...    52   4e-06
KLTH0B00836g Chr2 (73357..74829) [1473 bp, 490 aa] {ON} conserve...    51   6e-06
TDEL0H00220 Chr8 complement(27687..29141) [1455 bp, 484 aa] {ON}       45   4e-04
TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.2...    31   9.4  

>TDEL0B02240 Chr2 complement(405511..407265) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score = 1141 bits (2952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/584 (95%), Positives = 558/584 (95%)

Query: 1   MTSLIPIASPGLSANTERAYTEIKKDHIYQDSVEQEKGEFVDEFGREILANESEKFGHKL 60
           MTSLIPIASPGLSANTERAYTEIKKDHIYQDSVEQEKGEFVDEFGREILANESEKFGHKL
Sbjct: 1   MTSLIPIASPGLSANTERAYTEIKKDHIYQDSVEQEKGEFVDEFGREILANESEKFGHKL 60

Query: 61  PLQAYTYYADIQREYERSNDQDGLYAAQREQIYTDSFSNLSHSKLDSQRLLRITKAYSVF 120
           PLQAYTYYADIQREYERSNDQDGLYAAQREQIYTDSFSNLSHSKLDSQRLLRITKAYSVF
Sbjct: 61  PLQAYTYYADIQREYERSNDQDGLYAAQREQIYTDSFSNLSHSKLDSQRLLRITKAYSVF 120

Query: 121 FLITTDILGPSNAPYAVAQMGWVPGVILYVLFGVVAAFGGWLLNYCFCKVDSNNYPIRTY 180
           FLITTDILGPSNAPYAVAQMGWVPGVILYVLFGVVAAFGGWLLNYCFCKVDSNNYPIRTY
Sbjct: 121 FLITTDILGPSNAPYAVAQMGWVPGVILYVLFGVVAAFGGWLLNYCFCKVDSNNYPIRTY 180

Query: 181 SDLAGRVVAPWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDILV 240
           SDLAGRVVAPWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDILV
Sbjct: 181 SDLAGRVVAPWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDILV 240

Query: 241 WALLCMILGQIRSLGRFAHIANTAVWMNIAVCIITMVGVAVGGPYYGIFQQYGQGPPYFQ 300
           WALLCMILGQIRSLGRFAHIANTAVWMNIAVCIITMVGVAVGGPYYGIFQQYGQGPPYFQ
Sbjct: 241 WALLCMILGQIRSLGRFAHIANTAVWMNIAVCIITMVGVAVGGPYYGIFQQYGQGPPYFQ 300

Query: 301 SGTFNPLPITQHAITPGTISDKIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ 360
           SGTFNPLPITQHAITPGTISDKIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ
Sbjct: 301 SGTFNPLPITQHAITPGTISDKIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ 360

Query: 361 SLIMVVYLFYGLFVYAYNGQFSYVNANQAIGSKGLQNAGNVLTIITGIIATVLYGNIGIK 420
           SLIMVVYLFYGLFVYAYNGQFSYVNANQAIGSKGLQNAGNVLTIITGIIATVLYGNIGIK
Sbjct: 361 SLIMVVYLFYGLFVYAYNGQFSYVNANQAIGSKGLQNAGNVLTIITGIIATVLYGNIGIK 420

Query: 421 VLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIPSVSAIVGIIGSFCILN 480
           VLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIPSVSAIVGIIGSFCILN
Sbjct: 421 VLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIPSVSAIVGIIGSFCILN 480

Query: 481 FSYTFPXXXXXXXXXRQDAALNDTFDQKTLSVEKADSYWRNWSRWKRSIGHGGTFRXXXX 540
           FSYTFP         RQDAALNDTFDQKTLSVEKADSYWRNWSRWKRSIGHGGTFR    
Sbjct: 481 FSYTFPFLFCFCLLCRQDAALNDTFDQKTLSVEKADSYWRNWSRWKRSIGHGGTFRVTLK 540

Query: 541 XXXXXXXXXXXXXCGLCSYSAITGAIEVYQTNTAQPFTCNSPVG 584
                        CGLCSYSAITGAIEVYQTNTAQPFTCNSPVG
Sbjct: 541 VSLLLLFLASLATCGLCSYSAITGAIEVYQTNTAQPFTCNSPVG 584

>ZYRO0G06710g Chr7 complement(537970..539724) [1755 bp, 584 aa] {ON}
           conserved hypothetical protein
          Length = 584

 Score =  907 bits (2343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/584 (73%), Positives = 489/584 (83%)

Query: 1   MTSLIPIASPGLSANTERAYTEIKKDHIYQDSVEQEKGEFVDEFGREILANESEKFGHKL 60
           M+ L+PIAS  LS +T   Y E +K + YQ + + EKGE+VD  GREI+++E  K   +L
Sbjct: 1   MSKLVPIASHSLSPDTSGPYEEGEKGNAYQKTSDNEKGEYVDVSGREIISDEHRKQPRQL 60

Query: 61  PLQAYTYYADIQREYERSNDQDGLYAAQREQIYTDSFSNLSHSKLDSQRLLRITKAYSVF 120
           PLQAY++YADIQREYERS D DGLYA QREQ+YTD+ SNLS +KLDSQR++RI KAYSVF
Sbjct: 61  PLQAYSHYADIQREYERSKDYDGLYAVQREQMYTDANSNLSPTKLDSQRMMRIAKAYSVF 120

Query: 121 FLITTDILGPSNAPYAVAQMGWVPGVILYVLFGVVAAFGGWLLNYCFCKVDSNNYPIRTY 180
           FLITTDILGPSNAP A++QMG+VPGVILYV+FG+ AA GGWLLN+CFCKVDSNNYPIRT+
Sbjct: 121 FLITTDILGPSNAPNAISQMGYVPGVILYVVFGIAAACGGWLLNHCFCKVDSNNYPIRTF 180

Query: 181 SDLAGRVVAPWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDILV 240
           SDLA RVVAPWFRYPF +LQFIQMILNCG +LLSTAQAVSQMLIVN+G+D FCFTVDILV
Sbjct: 181 SDLASRVVAPWFRYPFGLLQFIQMILNCGLLLLSTAQAVSQMLIVNRGKDNFCFTVDILV 240

Query: 241 WALLCMILGQIRSLGRFAHIANTAVWMNIAVCIITMVGVAVGGPYYGIFQQYGQGPPYFQ 300
           WALLCMI GQI SLG+FAHIAN+AVWMNIA+CI TMVGVAVGGPYYGIFQQYG+GPPY+ 
Sbjct: 241 WALLCMIAGQISSLGKFAHIANSAVWMNIAICICTMVGVAVGGPYYGIFQQYGKGPPYYY 300

Query: 301 SGTFNPLPITQHAITPGTISDKIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ 360
             TFNPLPI +HAI PG++ D+IAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ
Sbjct: 301 PDTFNPLPIVKHAIAPGSLGDRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ 360

Query: 361 SLIMVVYLFYGLFVYAYNGQFSYVNANQAIGSKGLQNAGNVLTIITGIIATVLYGNIGIK 420
           SLI+VVYLFYGLFVY YNGQF YV ANQAI S GLQNAGNVLTI++G+IA VLYGN+ IK
Sbjct: 361 SLILVVYLFYGLFVYTYNGQFCYVTANQAIASVGLQNAGNVLTIVSGLIAMVLYGNVAIK 420

Query: 421 VLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIPSVSAIVGIIGSFCILN 480
           V+YQGFL+ D  FP L++RKG +AWG FVI +WA+AYILGTAIPS+SA+V I+G+FCILN
Sbjct: 421 VIYQGFLVADLGFPHLTTRKGTIAWGLFVIAYWAVAYILGTAIPSISALVQIVGAFCILN 480

Query: 481 FSYTFPXXXXXXXXXRQDAALNDTFDQKTLSVEKADSYWRNWSRWKRSIGHGGTFRXXXX 540
           FSYTFP         RQDA+L D FD KTL+VEKADSY RN SRWKR+I HGGT R    
Sbjct: 481 FSYTFPFLFGFCLLCRQDASLADKFDLKTLTVEKADSYLRNLSRWKRAIAHGGTRRILIK 540

Query: 541 XXXXXXXXXXXXXCGLCSYSAITGAIEVYQTNTAQPFTCNSPVG 584
                        CGLCSYSAITGAI+ YQTNTA  FTC SPVG
Sbjct: 541 CSLFLLFLASLATCGLCSYSAITGAIQAYQTNTAHAFTCTSPVG 584

>KLLA0F04257g Chr6 complement(404952..406457) [1506 bp, 501 aa] {ON}
           conserved hypothetical protein
          Length = 501

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 78/366 (21%), Positives = 150/366 (40%), Gaps = 36/366 (9%)

Query: 127 ILGPSNAPYAVAQMGWVPGVILYVLF-GVVAAFGGWLLNYCFCKVDSNNYP-IRTYSDLA 184
           IL   + P++ + +G +PG+IL V   GVV      +L+YC        +P ++   D+ 
Sbjct: 90  ILAMMSFPWSYSVLGLIPGLILTVFVAGVVLYTSFIILDYC------EKFPHLKNACDIG 143

Query: 185 GRVV--APWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDILVWA 242
             +   + +  Y  A+       L  G  +L   + ++   I N       F V   + +
Sbjct: 144 QHLFWGSNFAWYATAVCYVANNTLIQGVHVLVGGKYLNT--ITNHSTCTVAFGVITAIIS 201

Query: 243 LLCMILGQIRSLGRFAHIANTAVWMNIAVCIITMVGVA---VGGPYYGIFQQYGQGPPYF 299
            +  I     S+ + A+ +   +++++ + II  VG+    VG  Y G    +   P   
Sbjct: 202 FVFSIPRTFASMSKVAYFSAITMFISVILAII-FVGIQDHPVG--YDGTHLTFSLWP--- 255

Query: 300 QSGTFNPLPITQHAITPGTISDKIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCA 359
           Q GT              +  D +    N+V+ +     + + ++EMKRP DF K  L  
Sbjct: 256 QKGT--------------SYVDAMGAFLNIVYVFAAQVTYPQFISEMKRPRDFKKVFLLV 301

Query: 360 QSLIMVVYLFYGLFVYAYNGQFSYVNANQAIGSKGLQNAGNVLTIITGIIATVLYGNIGI 419
            ++ +V+Y   G  +Y Y G            ++  +       + T I    LY NI  
Sbjct: 302 TAIEVVIYSITGAVMYYYIGNEYMTTPAYGSLTRKYKIIAYSFAVPTIIFVGSLYSNITT 361

Query: 420 KVLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIPSVSAIVGIIGSFCIL 479
           + ++        +  S  +  G ++W G +++ W +A+I+   IP  S ++ ++ S    
Sbjct: 362 RFIFFKVFKNSEHMHS-HTTIGWLSWIGIIVLTWIVAFIVAEVIPFFSDLLSLMCSLFAC 420

Query: 480 NFSYTF 485
            F + F
Sbjct: 421 WFGFVF 426

>ZYRO0E00418g Chr5 (25673..27175) [1503 bp, 500 aa] {ON} conserved
           hypothetical protein
          Length = 500

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 89/404 (22%), Positives = 164/404 (40%), Gaps = 39/404 (9%)

Query: 69  ADIQREYERSNDQDGLYAAQREQIYTDSFSNLSHSKLDSQRLLRITKAYSVFFLITTD-- 126
           AD+    +R  D++   A   +++     S L           R         LI ++  
Sbjct: 32  ADLVSLSKREGDKENFEAKDLDEVS----STLDDDGKAYGEQYRTCSWLHTTGLILSEYI 87

Query: 127 ILGPSNAPYAVAQMGWVPGVILYVLFGVVAAFGGWLLNYCFCKVDSNNYP-IRTYSDLAG 185
           +L   + P++ + +G  PG++L V   +   + G L+   FC+     +P +R   D+ G
Sbjct: 88  VLAIMSFPWSYSVLGLFPGLLLTVFVALTTLYTG-LIIAEFCE----KFPHLRNICDI-G 141

Query: 186 RVV---APWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDILVWA 242
           +V+     W  Y  AI   +   L  G  +L  A+ ++   I N       F     + +
Sbjct: 142 QVLFGGYRWAWYATAICFLLNNALIQGLHVLVGAKYLNT--ITNHSVCTVGFAGITAIIS 199

Query: 243 LLCMILGQIRSLGRFAHIANTAVWMNIAVCIITMVGVAVGGPYYGIFQQYGQGPPYFQSG 302
           L+  +  +  S+    + A   +++++   I+ MV   V            Q  PY   G
Sbjct: 200 LVFSLPRKFISMSFLGYFATITMFVSV---ILAMVFAGV------------QSHPYGYDG 244

Query: 303 TFNPLPITQHAITPGTISDKIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQSL 362
           T  P+      +   T    +    N+++ + G   + + +AEMK P DF K +      
Sbjct: 245 T--PVVYKAFPVKGTTYVSGMGAFLNIIYTFVGQVTYPQFIAEMKNPKDFKKVLWVVCIS 302

Query: 363 IMVVYLFYGLFVYAYNGQFSYVNANQAIGS--KGLQNAGNVLTIITGIIATVLYGNIGIK 420
            +V+Y   G  VY Y G+  Y++A  A GS  +  +       + T + A  LY N+  K
Sbjct: 303 QIVLYGLVGSIVYVYVGE-KYMSA-PAYGSLIRAFKIISFSFCVPTIVYAGALYANVSAK 360

Query: 421 VLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIP 464
            L+  F      +    S K  + W   +++ WA+A+++   IP
Sbjct: 361 FLFFTFFENKPGYVYSYSLKSWLVWFVILVVLWAVAFVIAEVIP 404

>KLLA0F04125g Chr6 (392229..393728) [1500 bp, 499 aa] {ON} conserved
           hypothetical protein
          Length = 499

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 82/369 (22%), Positives = 152/369 (41%), Gaps = 42/369 (11%)

Query: 127 ILGPSNAPYAVAQMGWVPGVILYVLFGVVAAFGGWL-LNYCFCKVDSNNYP-IRTYSDLA 184
           +L   + P++ + +G +PG+IL     +   + G + L+YC        +P ++   D+ 
Sbjct: 88  VLAIMSFPWSYSVLGLIPGLILTAFVAITVLYTGLIVLDYC------ERFPHLKNVCDIG 141

Query: 185 GRVV----APWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDILV 240
             +     A W  Y  A+       L  G  +L  A+ ++   + N       F   + V
Sbjct: 142 QHLFWGSKAAW--YATAVCFIANNTLIQGLHVLVGAKYLNT--VTNHSVCSVGFAAIVAV 197

Query: 241 WALLCMILGQIRSLGRFAHIANTAVWMNIAVCIITMVGVAVGGP--YYGIFQQYGQGPPY 298
            + +  I     SL + A+   +A+ M I+V +  +       P  Y G    Y   P  
Sbjct: 198 ISFVFSIPRTFSSLSKVAYF--SAITMFISVILAMIFAGIQDHPAGYDGTAVTYQLWP-- 253

Query: 299 FQSGTFNPLPITQHAITPGTISDKIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLC 358
            + GT              T  D +    N+V+ + G   + + ++EMKRP +F K +  
Sbjct: 254 -KKGT--------------TYVDAMGAFLNIVYTFVGQITYPQFISEMKRPREFKKVLWI 298

Query: 359 AQSLIMVVYLFYGLFVYAYNGQFSYVNANQAIGS--KGLQNAGNVLTIITGIIATVLYGN 416
             +L ++++   G  +Y Y G   Y+ A  A GS  K  +       I T +    LY N
Sbjct: 299 VTALELIIFSLAGALIYVYVGN-EYMTA-PAYGSLTKTYKIISFSFAIPTIVFVGSLYSN 356

Query: 417 IGIKVLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIPSVSAIVGIIGSF 476
           I  + ++        +  S  ++ G +AW G +++ W  A+++   IP  S ++ ++ S 
Sbjct: 357 ISSRFVFFNVFRNSEHLYS-HTKVGWLAWIGLLLLTWVGAFVIAEVIPFFSDLLSLMCSL 415

Query: 477 CILNFSYTF 485
               F Y F
Sbjct: 416 FDCWFGYVF 424

>TBLA0B05020 Chr2 (1182196..1183758) [1563 bp, 520 aa] {ON} 
          Length = 520

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 92/212 (43%), Gaps = 12/212 (5%)

Query: 277 VGVAVGGPYYGIFQQYGQGPPYFQSGTFNPLPITQHAITPGTISDKIAGMNNMVFAWGGA 336
           +GV +   + GI     Q  PY  +GT  P+  T       T  D +    N+V+++ G 
Sbjct: 240 IGVVLAMIFSGI-----QSHPYKYNGT--PVKYTLFPEKGTTYVDAMCACLNIVYSFVGQ 292

Query: 337 TIFCEVMAEMKRPMDFWKGMLCAQSLIMVVYLFYGLFVYAYNGQFSYVNANQAIGS--KG 394
             + + ++EM+ P +F K +    +  ++V+   G  +Y Y G   Y+ A  A GS  + 
Sbjct: 293 ITYPQFISEMRNPKEFRKVLWLVTACEVIVFSLAGSIIYVYVGN-QYMTA-PAFGSLERT 350

Query: 395 LQNAGNVLTIITGIIATVLYGNIGIK-VLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFW 453
            +       + T + A  LY N+  K V +  F   +       +    + W   V++ W
Sbjct: 351 YKIIAFTFAVPTMVFAGALYSNVSAKLVFFTIFQNKNEKMLQFKTASSWIYWSLLVLLTW 410

Query: 454 AIAYILGTAIPSVSAIVGIIGSFCILNFSYTF 485
            +A+I+   IP  S +V ++ +     F + F
Sbjct: 411 ILAFIIAEVIPFFSDLVSLLSALFDCWFGFIF 442

>Kwal_33.15600 s33 complement(1179716..1181185) [1470 bp, 489 aa]
           {ON} [contig 290] FULL
          Length = 489

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 79/348 (22%), Positives = 146/348 (41%), Gaps = 42/348 (12%)

Query: 127 ILGPSNAPYAVAQMGWVPGVILYVLFGVVAAFGGWLL-NYCFCKVDSNNYP-IRTYSDLA 184
           +L   + P++ + +G VPG+IL +       + G ++ +YC        +P ++   D+ 
Sbjct: 78  VLAIMSFPWSYSVLGIVPGIILTLFVASTVLYTGLIIIDYC------ERFPHLKNVCDIG 131

Query: 185 GRVV--APWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDILVWA 242
             +     W  Y           L  G  +L  A+ ++ +     G         ++V A
Sbjct: 132 QHLFWGKKWAWYATLACFLANNTLIQGLHVLVGAKYLNTV----TGHSLCTVKFGVIV-A 186

Query: 243 LLCMILGQIRSLGRFAHIAN-TAVWMNIAVCIITMVGVAVGGPYYGIFQQYGQGPPYFQS 301
            +  +    R+    + +A  +AV M IAV ++ M+ V V            Q  P+   
Sbjct: 187 CISFVFSVPRTFSSLSKVAYFSAVTMFIAV-VLAMIFVGV------------QDHPFGWD 233

Query: 302 GTFNPLPITQHAITPGTISDKIAGMN---NMVFAWGGATIFCEVMAEMKRPMDFWKGMLC 358
           GT    P+T  A  P   +  + GM    N+V+ + G   + + ++EMKRP +F K +  
Sbjct: 234 GT----PVTFRAF-PQKGTTFVQGMGAFLNIVYTFVGQITYPQFISEMKRPREFRKVLYI 288

Query: 359 AQSLIMVVYLFYGLFVYAYNGQFSYVNANQAIGSKG--LQNAGNVLTIITGIIATVLYGN 416
                ++++   G+ +Y Y G   Y+ A  A GS G   +       + T I A  LY N
Sbjct: 289 VTLCQVIIFTLAGVIIYVYVGN-EYMTA-PAFGSLGRTFKIISFTFAVPTIIFAGSLYSN 346

Query: 417 IGIKVLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIP 464
           +  ++L+  F     +  S  +  G + W G + + W  A+I+   +P
Sbjct: 347 VSGRLLFFTFFKRSKHLYS-HTTIGWLTWTGILFLTWVGAFIIAEVVP 393

>KLTH0B00836g Chr2 (73357..74829) [1473 bp, 490 aa] {ON} conserved
           hypothetical protein
          Length = 490

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 79/349 (22%), Positives = 148/349 (42%), Gaps = 44/349 (12%)

Query: 127 ILGPSNAPYAVAQMGWVPGVILYVLFGVVAAFGGW-LLNYCFCKVDSNNYP-IRTYSDLA 184
           +L   + P++ + +G VPG+IL +       + G  +++YC        +P ++   D+ 
Sbjct: 79  VLAIMSFPWSYSVLGIVPGIILTLFVASTVLYTGLTIIDYC------ERFPHLKNVCDIG 132

Query: 185 GRVV--APWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDI-LVW 241
             +     W  Y   +       L  G  +L  A+       +N   D    TV   ++ 
Sbjct: 133 QHLFWGQKWAWYATLVCFLANNTLIQGLHVLVGAK------YLNTVTDHSLCTVKFGVIV 186

Query: 242 ALLCMILGQIRSLGRFAHIAN-TAVWMNIAVCIITMVGVAVGGPYYGIFQQYGQGPPYFQ 300
           A +  ++   R+    + +A  +A  M IAV ++ M+   V            Q  PY  
Sbjct: 187 ACISFVVSVPRTFSSLSKVAYFSAATMFIAV-VLAMIFAGV------------QDHPYGY 233

Query: 301 SGTFNPLPITQHAITPGTISDKIAGMN---NMVFAWGGATIFCEVMAEMKRPMDFWKGML 357
            GT    P+T  A  P   +  + GM    N+V+ + G   + + ++EM+RP +F K + 
Sbjct: 234 DGT----PVTFRAF-PEKGTTFVQGMGAFLNIVYTFVGQITYPQFISEMQRPAEFRKVLY 288

Query: 358 CAQSLIMVVYLFYGLFVYAYNGQFSYVNANQAIGS--KGLQNAGNVLTIITGIIATVLYG 415
              +  +V++   G+ +Y Y G   Y++A  A GS  +  +       + T I A  LY 
Sbjct: 289 IVTTCEIVIFTLAGVIIYVYVGN-EYMSA-PAFGSLTRTFKIIAFSFAVPTIIFAGSLYS 346

Query: 416 NIGIKVLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIP 464
           N+  ++L+  F     +  S  +  G + W G + + W  A+I+   +P
Sbjct: 347 NVSGRLLFFTFFKRSKHLYS-HTTVGWLTWIGILALTWVGAFIIAEVVP 394

>TDEL0H00220 Chr8 complement(27687..29141) [1455 bp, 484 aa] {ON} 
          Length = 484

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 146/348 (41%), Gaps = 42/348 (12%)

Query: 127 ILGPSNAPYAVAQMGWVPGVILYVLFGVVAAFGGWLLNYCFCKVDSNNYP-IRTYSDLAG 185
           +L   + P++ + +G VPG+IL V   V   + G ++   FC+     +P +R   D+  
Sbjct: 76  VLAIMSFPWSYSVLGLVPGLILTVFVAVTVLYTGLIIT-DFCE----RFPHLRNVCDIGQ 130

Query: 186 RVVA--PWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDILVWAL 243
            ++    W  Y  A        L  G  +L  A+ ++   + N       FT  +   A 
Sbjct: 131 YLLGGGRWAWYATAFCFLANNTLIQGLHVLVGAKYLNT--VTNHSICSVGFTAIV---AG 185

Query: 244 LCMILGQIRSLGRFAHIAN-TAVWMNIAVCIITMVGVAVGGPYYGIFQQYGQGPPYFQSG 302
           + MI    R+    + +   +A  M IAV ++ MV   V            QG P     
Sbjct: 186 ISMIFSLPRTFSAMSWVGYFSAATMFIAV-VLAMVFAGV------------QGHP----D 228

Query: 303 TFNPLPITQHAITPGTISDKIAGMN---NMVFAWGGATIFCEVMAEMKRPMDFWKGMLCA 359
            F+  P+   A  P   +  + GM+   N+V+ + G   + + ++EMK P +F K +   
Sbjct: 229 KFDGTPVVFRAF-PAEGTSFVDGMSAFLNIVYTFVGQITYPQFISEMKNPREFKKVLWIV 287

Query: 360 QSLIMVVYLFYGLFVYAYNGQFSYVNANQAIGS--KGLQNAGNVLTIITGIIATVLYGNI 417
            +  ++++   G  +Y Y G  +Y+    A GS  +  +       I T I    LY NI
Sbjct: 288 TTCEVIIFALAGSIMYVYVGN-AYMTG-PAFGSLIRKYKIISFSFAIPTIIFVGALYANI 345

Query: 418 GIKVLY-QGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIP 464
             K++Y Q F  T   +   S+    + W   + + W +A+I+   IP
Sbjct: 346 SAKLVYDQIFKNTRHRYSWTSTSW--IFWTLVLFMTWVMAFIIAEVIP 391

>TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.252
           YKL146W
          Length = 523

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 40/205 (19%), Positives = 76/205 (37%), Gaps = 17/205 (8%)

Query: 312 HAITPGTISDKIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQSLIMVVYLFYG 371
             +TP    D    +   +F + G  +   +   MK P  F K ++    +I +V++  G
Sbjct: 303 QTMTPFNTKDWSLFIGTAIFTYEGIGLLIPIQESMKSPHHFKKSLILVLVIITLVFITIG 362

Query: 372 LFVY-AYNGQFSYVNANQAIGSKGLQNAGNVLTIITGIIATVLYGNIGIKVLYQGFLITD 430
           L  Y A+      V            +   +L  +  +++T L     IK+L       D
Sbjct: 363 LLGYSAFGSNVDTVLLQNFPQDNPCTSLVQLLYSLAILLSTPLQLFPAIKILENWIFSKD 422

Query: 431 FNFPSLSSRKGAVAWG-----GFVIIFWAIAYILGTAIPSVSAIVGIIGSFCILNFSYTF 485
            +         ++ W        ++I  ++   LG     ++  V ++GSF  +   Y +
Sbjct: 423 AS----GKYNHSIKWAKNYFRSTIVILTSLISYLGAN--DLNKFVALVGSFACIPLIYVY 476

Query: 486 PXXXXXXXXXRQDAALNDTFDQKTL 510
           P          +   L++TF  KTL
Sbjct: 477 PPLLHY-----KATQLDNTFTWKTL 496

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,378,542
Number of extensions: 2361576
Number of successful extensions: 7154
Number of sequences better than 10.0: 23
Number of HSP's gapped: 7333
Number of HSP's successfully gapped: 23
Length of query: 584
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 469
Effective length of database: 40,294,809
Effective search space: 18898265421
Effective search space used: 18898265421
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)