Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B022305.698ON57457429550.0
ZYRO0G06688g5.698ON61356921010.0
CAGL0G02453g5.698ON59758720990.0
KNAG0C065705.698ON59056820770.0
TBLA0A091205.698ON63351520410.0
TPHA0N01960singletonON59157319960.0
SAKL0E14828g5.698ON59256519820.0
Kpol_529.285.698ON61057119820.0
YKR093W (PTR2)5.698ON60154519530.0
Smik_11.3565.698ON60254519490.0
Suva_11.3295.698ON60154519430.0
NCAS0A032205.698ON61155619380.0
TPHA0O02000singletonON62056119350.0
KAFR0H00230singletonON59656319130.0
TBLA0B04710singletonON61555719140.0
KAFR0H002405.698ON59156619100.0
KLLA0E12915g5.698ON65452019010.0
NDAI0E050205.698ON61957018930.0
TBLA0E01140singletonON61152018850.0
Skud_11.3315.698ON39936814540.0
Kwal_47.16930na 1ON6115515901e-67
KLTH0D16544gna 1ON6265905622e-63
AGL365Cna 2ON5995465602e-63
Ecym_2823na 2ON6135615384e-60
AFR228WsingletonON5765684803e-52
NDAI0E012108.665ON41456714.5
Kwal_27.127768.1ON53485689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02230
         (574 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...  1142   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   813   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   813   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   804   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   790   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   773   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   768   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   768   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   756   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   755   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   753   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   751   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   749   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      741   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            741   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   740   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   736   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   733   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   730   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   564   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   231   1e-67
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   221   2e-63
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   220   2e-63
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   211   4e-60
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   189   3e-52
NDAI0E01210 Chr5 complement(240179..241252,241254..241424) [1245...    32   4.5  
Kwal_27.12776 s27 complement(1370802..1372406) [1605 bp, 534 aa]...    31   9.7  

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/574 (96%), Positives = 556/574 (96%)

Query: 1   MKRTETSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAG 60
           MKRTETSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAG
Sbjct: 1   MKRTETSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAG 60

Query: 61  TIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFW 120
           TIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFW
Sbjct: 61  TIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFW 120

Query: 121 CYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXXXXXXXXXXX 180
           CYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQN            
Sbjct: 121 CYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATGGFIAAIIL 180

Query: 181 XXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSL 240
                 MIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSL
Sbjct: 181 IGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSL 240

Query: 241 SVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAI 300
           SVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAI
Sbjct: 241 SVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAI 300

Query: 301 KNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVG 360
           KNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVG
Sbjct: 301 KNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVG 360

Query: 361 GTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMV 420
           GTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMV
Sbjct: 361 GTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMV 420

Query: 421 WAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAP 480
           WAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAP
Sbjct: 421 WAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAP 480

Query: 481 VTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYN 540
           VTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYN
Sbjct: 481 VTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYN 540

Query: 541 DTEEAMNALDYDEDPTMLKHSKDGIEECADFSKA 574
           DTEEAMNALDYDEDPTMLKHSKDGIEECADFSKA
Sbjct: 541 DTEEAMNALDYDEDPTMLKHSKDGIEECADFSKA 574

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/569 (68%), Positives = 464/569 (81%), Gaps = 12/569 (2%)

Query: 6   TSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVE------SYDDEPTEEEMKTLKHVA 59
            S++  +   EK K +  ++DK +EV  SH   E++        DDEPTEEE+++L+HV 
Sbjct: 2   NSASPSITGPEKNKVI--IEDKSLEVSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVG 59

Query: 60  GTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQF 119
           G IPFRCWLIA+VELSERF+YYGLS PFQNYMQNG  D PAG+L+LKSQGATGL+YFFQF
Sbjct: 60  GHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQF 119

Query: 120 WCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXXXXXXXXXX 179
           WCYVTP+FGGWL+DTY GKY TIC GTGVYV+GI ILF+TS+PS+ ++N           
Sbjct: 120 WCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIV 179

Query: 180 XXXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGS 239
                  MIK+N+SVLIADQFPK++ R+ T K G RVIEDPNIT+QNVFM FYLMINIGS
Sbjct: 180 LIGIATGMIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMINIGS 239

Query: 240 LSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIA 299
           LSVIATTELE H GFWAAYLLPFCFFWIAVIVL VG+ SYV+PPVGDKVI+K F+V+G  
Sbjct: 240 LSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQL 299

Query: 300 IKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSV 359
           IK++F++EA KPSV P+R +PW D FV+EI R+L ACKVF+FYP+YWV YGQM +TFVSV
Sbjct: 300 IKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSV 359

Query: 360 GGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAM 419
           GG M+LHGLPNDFFQAIDSIALIVFIPICEY+LYP+IR++TPF+PITKIF+GFM+ +A+M
Sbjct: 360 GGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASM 419

Query: 420 VWAAVLQHFIYKSGPWYKYPM-AENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSK 478
           +WAAVLQHFIYK+GP Y +PM   N PN+IHI WQVPAYVLIAFSEIFASITGLEYAYSK
Sbjct: 420 IWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSK 479

Query: 479 APVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKH 538
           AP +MKSFIM+IFLLTNAFGSAIGCALSPV  DP Y+W++ GL VA F +G LFW  F H
Sbjct: 480 APTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHH 539

Query: 539 YNDTEEAMNALDYDEDPTMLKHSKDGIEE 567
            NDTEE MNA+DY+E+   +    DG+++
Sbjct: 540 LNDTEEEMNAMDYEENQEKI---DDGLQK 565

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/587 (66%), Positives = 448/587 (76%), Gaps = 19/587 (3%)

Query: 6   TSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDE------------------P 47
           +   D  ++VE QK V  +DD   + +      E+   D +                  P
Sbjct: 6   SKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDDFEAP 65

Query: 48  TEEEMKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKS 107
           TEEE+KTL+HVAG IP RCWLIA+VELSERF+YYGLS PFQNYMQNGP+D P GLL LKS
Sbjct: 66  TEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKS 125

Query: 108 QGATGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQ 167
           QGATGLSYFFQFWCYVTP+FGGW+SDTY GKYNTIC GT +YV GI ILF+TSIP +T  
Sbjct: 126 QGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNS 185

Query: 168 NXXXXXXXXXXXXXXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNV 227
           +                  MIKSN+SVLIADQ P ++ RV+  K G RVIEDPN+TLQNV
Sbjct: 186 DGALGGFIAAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNV 245

Query: 228 FMIFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDK 287
           FM FY  IN+GSLSV+ATTELE H GFWAAYLLPFCFFW+AV VL  G+N Y+KPPVGDK
Sbjct: 246 FMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDK 305

Query: 288 VISKCFKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWV 347
           VISK FKV+ I  KNKFN EAAKPS +PD+ FPW+DKFVDEI R+L ACKVF+FYPVYWV
Sbjct: 306 VISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWV 365

Query: 348 CYGQMLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITK 407
           CYG MLN FV+ GGTMELH LPNDF QA DSIALI+FIPI E F+YP+IR++TP RPITK
Sbjct: 366 CYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITK 425

Query: 408 IFWGFMFGAAAMVWAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFA 467
           IF+GFM G+ AMVWAAVLQHFIY  GPWY +P+  +TPNHIH+AWQ+PAYVLIA SEIFA
Sbjct: 426 IFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEIFA 485

Query: 468 SITGLEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFA 527
           SITGLEYAYSKAP +MKSFIM+IFLLTNAFGSAIGCALSPV+ DP +VW Y GL  ACF 
Sbjct: 486 SITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFI 545

Query: 528 AGWLFWFCFKHYNDTEEAMNALDYDEDPTMLKHSKDGIEECADFSKA 574
           AGW+FWF +   ND EEAMNALDY+ D  M KH  D  EE A+  ++
Sbjct: 546 AGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHSDD-EEAAEHVRS 591

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/568 (67%), Positives = 456/568 (80%), Gaps = 11/568 (1%)

Query: 1   MKRTETSSTDGVDSVEKQKAVEVV---------DDKLVEVISSHNGLEVESYDDEPTEEE 51
           +++  T S D  DS++K+  + +          D ++V+ ++S    ++    + PTEEE
Sbjct: 3   LRQVNTFSED--DSLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEE 60

Query: 52  MKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGAT 111
           ++TLKHV G IP RCWLIAVVELSERF+YYGLS PFQNYM NGP D P GLL L S GAT
Sbjct: 61  LRTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGAT 120

Query: 112 GLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXX 171
           GLSYFFQFWCYVTPIFGG+++DT+ GKYNTI  GTG+Y+ GI ILF+TSIPSITT+N   
Sbjct: 121 GLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGL 180

Query: 172 XXXXXXXXXXXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIF 231
                          MIKSN+SVLIADQ PK++  V TKK+G RVIED N+TLQNVFM F
Sbjct: 181 GGFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFF 240

Query: 232 YLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISK 291
           YLMINIGSLSVIAT+ELE H GFWAAYLLPFCFFWIAV+VL +GKN YVKPP+GDKVISK
Sbjct: 241 YLMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISK 300

Query: 292 CFKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQ 351
           CFKV+ I  KN+FNF+A KPS++P + +PW+DKFVDEI R+L ACKVFLFYP+YW CYGQ
Sbjct: 301 CFKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQ 360

Query: 352 MLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWG 411
           M++ FV+ G  MELHGLPNDFFQ IDSIA+IVFIP+CE+ LYP+IRK+TPFRPITKI++G
Sbjct: 361 MMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFG 420

Query: 412 FMFGAAAMVWAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITG 471
           FMF +  M+WAAVLQ +IYK+GP YK+P+  + PN IH+A QVPAYVL+AFSEIFASITG
Sbjct: 421 FMFASGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITG 480

Query: 472 LEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWL 531
           LEYAYSKAP +MKSFIM+IFL+TNAFGSAIGCALSPV+KDPD+ WLY GL VACF +G L
Sbjct: 481 LEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCL 540

Query: 532 FWFCFKHYNDTEEAMNALDYDEDPTMLK 559
           FW CF+ YND EE MNA+DY+ D TMLK
Sbjct: 541 FWVCFRKYNDIEEEMNAMDYEVDATMLK 568

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/515 (70%), Positives = 432/515 (83%), Gaps = 3/515 (0%)

Query: 52  MKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGAT 111
           ++TLKHV G IP RCWL+AV+EL+ERF+YYGLS PFQNYMQNGP+D+P G L+L S GAT
Sbjct: 88  LRTLKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGAT 147

Query: 112 GLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXX 171
           GLSYFFQFWCY+TP+F G+++DTY GK+ TIC GTG+Y++GI ILF+TS+PSIT+ N   
Sbjct: 148 GLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAM 207

Query: 172 XXXXXXXXXXXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIF 231
                          MIK+N+SV+IA+Q PK++ RVITKK+GTRVIEDP+IT+QNVFM F
Sbjct: 208 GGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTF 267

Query: 232 YLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISK 291
           Y MINIGSLSVIATTELEAH GFWAAYLLPFCFFW+AVIVL VG  +Y+K PVGDKVISK
Sbjct: 268 YFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISK 327

Query: 292 CFKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQ 351
           CFKV+ I ++N+FN ++AKP+ +PD+ +PW+DKFVDEI+R+L ACKVF+FYP+YWVCYGQ
Sbjct: 328 CFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQ 387

Query: 352 MLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWG 411
           MLN FVS GGTMELHGLPNDFFQAIDSIALIVFIPICE F+YP+IRK+TPF+PITKIFWG
Sbjct: 388 MLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWG 447

Query: 412 FMFGAAAMVWAAVLQHFIYKSGPWYKYP-MAENTPNHIHIAWQVPAYVLIAFSEIFASIT 470
           F FGA +M WA VLQHFIYK+ P Y +P   +N PNHIH+A QVPAY L+A SEIFASIT
Sbjct: 448 FTFGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASIT 507

Query: 471 GLEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGW 530
           GLEYAYSKAP +MK+FIM+IFL+TNAFG+AIGCALSPV+KDP YVWLY GL VACF  G 
Sbjct: 508 GLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGC 567

Query: 531 LFWFCFKHYNDTEEAMNALDYDEDPTML--KHSKD 563
           LFW  FK YND EE +N LD++E   ML  KH+ D
Sbjct: 568 LFWIIFKKYNDMEEELNNLDFEEGDDMLETKHAGD 602

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/573 (65%), Positives = 446/573 (77%), Gaps = 20/573 (3%)

Query: 1   MKRTETSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDD-----------EPTE 49
           + + ET S   + S+  Q  ++  D   V V+S+ N ++V S DD            PTE
Sbjct: 3   LTKLETHSNSDL-SLSSQ--LDNKDKIEVHVVSTENQIDVHSLDDEDYEEEDEDYVAPTE 59

Query: 50  EEMKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQG 109
           EE+KTL+HV+G IP RCWLIA+VEL+ERF+YYGLS PFQNYM NGP+DTP GLL L S G
Sbjct: 60  EELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQLNSSG 119

Query: 110 ATGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNX 169
           AT +SYFFQFWCYVTPIFGG+++DT+ GKYNTIC GTG+YV GI ILF+TSI SITTQN 
Sbjct: 120 ATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESITTQNA 179

Query: 170 XXXXXXXXXXXXXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFM 229
                            MIKSNISVLIA+Q PK++ RVIT   G RVIEDP +T+QN+FM
Sbjct: 180 ARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQNIFM 239

Query: 230 IFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVI 289
            FYLMINIGSLSVIATTELEAH GFWAAYLLPFCFFWIAV+VL VGK  YV+ PVGDKVI
Sbjct: 240 FFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVGDKVI 299

Query: 290 SKCFKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCY 349
           SKCF +  IA KNK +F++AKPS  P+  +PWTDKFV+E+ R++ ACKVFLFYP+YW  Y
Sbjct: 300 SKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIYWCVY 359

Query: 350 GQMLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIF 409
           GQMLN FV+  GTMELHGLPNDF QAIDSIA+IVFIPICE FLYP+IRKFTPFR ITKIF
Sbjct: 360 GQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSITKIF 419

Query: 410 WGFMFGAAAMVWAAVLQHFIYKSGPWYKYPMA-----ENTPNHIHIAWQVPAYVLIAFSE 464
           WGFMFG+AAM+WAAVLQ FIYK+GP +  P+A      +TPN +HIAWQVPAYVLIAFSE
Sbjct: 420 WGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLIAFSE 479

Query: 465 IFASITGLEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVA 524
           IFASITGLEYAYS AP +MKSFIM+IFLLT AFGSA+G A+SP + DP + W + GL V+
Sbjct: 480 IFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTGLAVS 539

Query: 525 CFAAGWLFWFCFKHYNDTEEAMNALDY-DEDPT 556
           CF AG LFW CF+ YN+TE++M+ +D+ DE  T
Sbjct: 540 CFIAGCLFWICFRKYNNTEDSMDEIDFIDEKVT 572

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/565 (67%), Positives = 453/565 (80%), Gaps = 13/565 (2%)

Query: 2   KRTETS---STDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVES-YDDEPTEEEMKTLKH 57
            +TET    ++   +SVEK    E      V+V+  +  +  +S +  EPT+EEMKTL+H
Sbjct: 9   NKTETEVVVTSSPENSVEKIARPE----SFVDVLDKNQYINADSDHGREPTDEEMKTLRH 64

Query: 58  VAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFF 117
           V+  IP RCWL+AVVEL+ERF+YYGLS PFQNYMQNGP+DTP G+LNLK+QGAT LSYFF
Sbjct: 65  VSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFF 124

Query: 118 QFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXXXXXXXX 177
           QFWCYV+P+ GG+++DTY GKY TIC GTG+YV+GI ILF+TS+PSIT  +         
Sbjct: 125 QFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITS 184

Query: 178 XXXXXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINI 237
                    MIK+NISVLIADQ PK R  V   K G RVIEDPNIT+QN+FM FYLMINI
Sbjct: 185 LILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINI 244

Query: 238 GSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVG 297
           GSLSVIATTE+EAH+GFWAAYLLPFCFF++AV VL +G+N YVK PVGDKVISK FKV  
Sbjct: 245 GSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCW 304

Query: 298 IAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFV 357
           I ++NKF F+AA+PS++P+  +PW+DKF+DEI R+++ACKVF+FYP+YWVCYGQML+ FV
Sbjct: 305 IVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFV 364

Query: 358 SVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAA 417
           S  G MELHGLPNDF QAIDSIALIVFIPICE FLYP+IR+FTPFRPITKIF+GF+FGA 
Sbjct: 365 SQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGAL 424

Query: 418 AMVWAAVLQHFIYKSGPWYKYPMA-----ENTPNHIHIAWQVPAYVLIAFSEIFASITGL 472
           AM WAAVLQHFIYK+GP Y YPMA     +NTPN IHIAWQVPAYVLIAFSEIFASITGL
Sbjct: 425 AMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGL 484

Query: 473 EYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLF 532
           EYAYSKAPV+M+SFIM+IFLLT AFGSA+G ALS V+ +P +VW + GL V+CF AG LF
Sbjct: 485 EYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLF 544

Query: 533 WFCFKHYNDTEEAMNALDYDEDPTM 557
           W  F  YNDTEEAMNA+DY+ED  +
Sbjct: 545 WAFFHKYNDTEEAMNAIDYEEDDVL 569

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/571 (63%), Positives = 435/571 (76%), Gaps = 36/571 (6%)

Query: 13  DSVEKQKAVEVVDDKLVEVISSHNGLEVE--------------------------SYDD- 45
           DS+ ++ + E+ DD     I S    EV+                           YDD 
Sbjct: 3   DSLTRRTSGELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDDN 62

Query: 46  ----EPTEEEMKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAG 101
               EPTEEEMKTLKHV+G IP RCWLIAVVELSERF+YYGL+ PFQNYM NGP+DTP G
Sbjct: 63  QDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKG 122

Query: 102 LLNLKSQGATGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSI 161
           +L L +QGA+ LSYFFQFWCY+TPIFGG+++DTY GKYNTIC GTG+YV+GI +LF+TS+
Sbjct: 123 VLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSL 182

Query: 162 PSITTQNXXXXXXXXXXXXXXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPN 221
           PSI T+                   MIK+NISVLIA+Q P+ + RVIT+K G RVIEDPN
Sbjct: 183 PSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPN 242

Query: 222 ITLQNVFMIFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVK 281
           IT QNVFM FY+MIN+GSLS++ATTELE+H GFWAAYLLPFCFFWIAV+VL +G+N Y+ 
Sbjct: 243 ITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIM 302

Query: 282 PPVGDKVISKCFKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLF 341
            PVGDK+ISK FKV+ I +KNK NF+AAKPS++P++ +PW DKFV+EI R+L ACKVF+F
Sbjct: 303 VPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVF 362

Query: 342 YPVYWVCYGQMLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTP 401
           YP+YW  YGQM+N FV+  GTMELH LPNDF QA DSIA+IVFIPI E F+YP++R+FTP
Sbjct: 363 YPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTP 422

Query: 402 FRPITKIFWGFMFGAAAMVWAAVLQHFIYKSGPWYKYPMA-----ENTPNHIHIAWQVPA 456
           FRPITKIFWGFMFG+ AM+WAAVLQ FIYK+GP Y  PM       NTPN +H+AWQVPA
Sbjct: 423 FRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPA 482

Query: 457 YVLIAFSEIFASITGLEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVW 516
           YVLIA SEI AS+TGLEYAYS AP +MKSFIM+IFL+TNAFGSAIG A+SP  +DP Y W
Sbjct: 483 YVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTW 542

Query: 517 LYVGLGVACFAAGWLFWFCFKHYNDTEEAMN 547
            + GL VACF AG LFW CF+ YN+TE+AMN
Sbjct: 543 TFTGLAVACFIAGCLFWICFRSYNNTEDAMN 573

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/545 (64%), Positives = 431/545 (79%), Gaps = 6/545 (1%)

Query: 16  EKQKAVEVVDDKLVEVISSHN---GLEVESYDDE---PTEEEMKTLKHVAGTIPFRCWLI 69
           EK +AV + D  + + +++      L     D++   PTEEEM+TL+HV G IP RCWLI
Sbjct: 26  EKTQAVTLKDSYVSDDVANSTERYNLSPSPEDEDFEGPTEEEMQTLRHVGGKIPMRCWLI 85

Query: 70  AVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFWCYVTPIFGG 129
           A+VELSERF+YYGLS PFQNYM+ GP+D+P G+L+L SQGATGLSYFFQFWCYVTP+FGG
Sbjct: 86  AIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFWCYVTPVFGG 145

Query: 130 WLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXXXXXXXXXXXXXXXXXMIK 189
           +++DT+ GKYNTIC GT +Y+ GI ILF+TSIPS+  ++                  MIK
Sbjct: 146 YVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATGMIK 205

Query: 190 SNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATTELE 249
           +N+SVLIADQ PK++  +   K G RVI D NITLQNVFM FY MIN+GSLS++ATTELE
Sbjct: 206 ANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATTELE 265

Query: 250 AHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNFEAA 309
            H GFWAAYLLPFCFFWIAV+ L  GK  Y++ P+GDKVI+K FKV  I  KNKF+F AA
Sbjct: 266 YHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNAA 325

Query: 310 KPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELHGLP 369
           KPSV P++ +PW DKFVDEI R+L+ACKVF+FYP+YW  YG M+++F++    MELHG+P
Sbjct: 326 KPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGIP 385

Query: 370 NDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVLQHFI 429
           NDF QA DSIALI+FIPI E F+YP+IR++TP +PITKIF+GFMFG+ AM WAAVLQ F+
Sbjct: 386 NDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQSFV 445

Query: 430 YKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVTMKSFIMA 489
           YK+GPWY  P+  NTPNH+H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP +MKSFIM+
Sbjct: 446 YKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIMS 505

Query: 490 IFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYNDTEEAMNAL 549
           IFLLTNAFGSAIGCALSPVT DP + WL+ GL VACF +G LFW CF+ YNDTEE MNA+
Sbjct: 506 IFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEMNAM 565

Query: 550 DYDED 554
           DY+E+
Sbjct: 566 DYEEE 570

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/545 (64%), Positives = 426/545 (78%), Gaps = 6/545 (1%)

Query: 16  EKQKAVEVVDDKLVEVISSHNGLEVESYDDE------PTEEEMKTLKHVAGTIPFRCWLI 69
           EK  AV + D  + + +++       S+  E      PTEEE KTL+HV G IP RCWLI
Sbjct: 26  EKTHAVTLKDSYVSDDVANSTEQYNLSHSPEDEDFEAPTEEETKTLRHVGGKIPMRCWLI 85

Query: 70  AVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFWCYVTPIFGG 129
           A+VELSERF+YYGLS PFQNYM+ GP+D+P G+L L SQGATGLSYFFQFWCYVTP+FGG
Sbjct: 86  AIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATGLSYFFQFWCYVTPVFGG 145

Query: 130 WLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXXXXXXXXXXXXXXXXXMIK 189
           +++DT+ GKYNTIC GT +Y+ GI ILF+TSIPS+  ++                  MIK
Sbjct: 146 YVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATGMIK 205

Query: 190 SNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATTELE 249
           +NISVLIADQ PK++  +   K G RVI D NITLQNVFM FY MIN+GSLS++ATTELE
Sbjct: 206 ANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATTELE 265

Query: 250 AHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNFEAA 309
            H GFWAAYLLPFCFFWIAV+ L  GK  Y++ P+GDKV++K F+V  I  KNKF+F AA
Sbjct: 266 YHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSFRVCWILTKNKFDFNAA 325

Query: 310 KPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELHGLP 369
           KPSV P+  +PW DKFVDEI R+L+ACKVF+FYP+YW  YG M+++F++    MELHG+P
Sbjct: 326 KPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGIP 385

Query: 370 NDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVLQHFI 429
           NDF QA DSIALIVFIPI E F+YP+IR++TP +PITKIF+GFMFG+ AM WAAVLQ F+
Sbjct: 386 NDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQSFV 445

Query: 430 YKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVTMKSFIMA 489
           YK+GPWY  P+  NTPNHIH+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP +MKSFIM+
Sbjct: 446 YKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIMS 505

Query: 490 IFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYNDTEEAMNAL 549
           IFLLTNAFGSAIGCALSPVT DP + WL+ GL VACF +G LFW CF+ YNDTEE MNA+
Sbjct: 506 IFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEMNAM 565

Query: 550 DYDED 554
           DY+ED
Sbjct: 566 DYEED 570

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/545 (64%), Positives = 428/545 (78%), Gaps = 6/545 (1%)

Query: 16  EKQKAVEVVDDKLVEVISSHN---GLEVESYDDE---PTEEEMKTLKHVAGTIPFRCWLI 69
           EK + V + D  + +  ++      L     D+E   PT+EE+++L+HV G IP RCWLI
Sbjct: 26  EKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEFEAPTDEELRSLRHVGGKIPMRCWLI 85

Query: 70  AVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFWCYVTPIFGG 129
           A+VELSERF+YYGLS PFQNYM+ GP+DTP G+L+L S GATGLSYFFQFWCYVTP+FGG
Sbjct: 86  AIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATGLSYFFQFWCYVTPVFGG 145

Query: 130 WLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXXXXXXXXXXXXXXXXXMIK 189
           +++DT+ GKYNTIC GT +Y+ GI ILF+TSIPS+  ++                  MIK
Sbjct: 146 YIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALGGFIASIILIGIATGMIK 205

Query: 190 SNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATTELE 249
           +N+SVLIADQ PK++  +   K G RVIED NITLQNVFM FY MIN+GSLS++ATTELE
Sbjct: 206 ANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMATTELE 265

Query: 250 AHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNFEAA 309
            H GFWAAYLLPFCFFW+AV+ L  GK  Y++ P+GDKVI+K FKV  I  KNKF+F AA
Sbjct: 266 YHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNAA 325

Query: 310 KPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELHGLP 369
           KPSV P++ +PW DKFVDEI R+L+ACKVF+FYP+YW  YG M+++F++    MELHG+P
Sbjct: 326 KPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGIP 385

Query: 370 NDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVLQHFI 429
           NDF QA DSIALI+FIPI E F YP+IR++TPF+PITKIF+GFMFG+ AM WAAVLQ F+
Sbjct: 386 NDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQSFV 445

Query: 430 YKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVTMKSFIMA 489
           YK+GPWY  P+  NTPNH+H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP  MKSFIM+
Sbjct: 446 YKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPANMKSFIMS 505

Query: 490 IFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYNDTEEAMNAL 549
           IFLLTNAFGSAIGCALSPVT DP + WL+ GL VACF +G LFW CF+ YNDTEE MNA+
Sbjct: 506 IFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEMNAM 565

Query: 550 DYDED 554
           DY+E+
Sbjct: 566 DYEEE 570

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/556 (63%), Positives = 431/556 (77%), Gaps = 1/556 (0%)

Query: 9   TDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAGTIPFRCWL 68
           T  +   E   + E V D+L E    H+  E E   + PTEE+M+TL+HV+G IP RCWL
Sbjct: 31  TQEITLKETTGSSEEVHDEL-ETYHIHHDEECEPGYEIPTEEDMETLRHVSGKIPLRCWL 89

Query: 69  IAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFWCYVTPIFG 128
           IA+VEL+ERF+YYGLS PFQNYM+NGP+DTPAG+L L S GATGLSYFFQFWCYVTP+FG
Sbjct: 90  IALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSYFFQFWCYVTPVFG 149

Query: 129 GWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXXXXXXXXXXXXXXXXXMI 188
           G+++DTY GKYNTIC GTG+Y+ GI ILF+TSIPSI +++                  MI
Sbjct: 150 GFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLGGFIAAIILIGIATGMI 209

Query: 189 KSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATTEL 248
           K+N+SVLIADQ PK++ RV T K G RV+EDPNITLQNVFM FYLM+N+GSLSVIATTEL
Sbjct: 210 KANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATTEL 269

Query: 249 EAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNFEA 308
           E H  FWAA+LLPFCFFWIAV+VL  G+N YVK    +K I K FK++ I  KNKF+  +
Sbjct: 270 EEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNKFDLTS 329

Query: 309 AKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELHGL 368
           AKPS  P++ +PWTDKFVDE  R+LSACKVFLFYP+YWV YG M++TFV+ G  MELHGL
Sbjct: 330 AKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELHGL 389

Query: 369 PNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVLQHF 428
           PND FQAIDS ALI+FIPICE F+YP+IR+FTPF+PITKIF+GFMF   AMVW+ VLQ F
Sbjct: 390 PNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSCVLQSF 449

Query: 429 IYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVTMKSFIM 488
           IYK+GP+Y +P+    PN IH+ WQVPAYVLIAFSEI ASITGLEYAYSKAP++MKSFIM
Sbjct: 450 IYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPMSMKSFIM 509

Query: 489 AIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYNDTEEAMNA 548
           ++FL +NA GS +G ALSPV+ DP + WL+ GLGVACF  G +FW  F+ YNDTEE MNA
Sbjct: 510 SLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVACFIGGCIFWIIFRKYNDTEEEMNA 569

Query: 549 LDYDEDPTMLKHSKDG 564
           +DY+++  + +    G
Sbjct: 570 MDYEDEEDLREMESAG 585

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/561 (63%), Positives = 433/561 (77%), Gaps = 18/561 (3%)

Query: 13  DSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDE-----PTEEEMKTLKHVAGTIPFRCW 67
           D VE     E +D+  V+        E + Y+DE     PTEEEM TLKHVAG IP+RCW
Sbjct: 44  DKVENDTNEEELDEFAVDD-------EADPYNDEWGYVEPTEEEMATLKHVAGHIPYRCW 96

Query: 68  LIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFWCYVTPIF 127
           LIAVVELSERF+YYGLS PFQNYM NGP+DTP G+L L + GATGLSYFFQFWCY+TPIF
Sbjct: 97  LIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNGATGLSYFFQFWCYITPIF 156

Query: 128 GGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXXXXXXXXXXXXXXXXXM 187
           GG+++DTY  KYNTI  GT +Y+IGI ILF+T+IPSI T+                   M
Sbjct: 157 GGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKETATGGFVTAIILIGIGTGM 216

Query: 188 IKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATTE 247
           IK+N+SVL+A+Q PK++HRVIT K G RVIEDP+IT+QNVFM FYLMINIG+LSV+ATTE
Sbjct: 217 IKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFYLMINIGALSVLATTE 276

Query: 248 LEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNFE 307
           LE+H GFWAAYLLPFCFFWIAV++L +G+NSY+  PVGDKVISKCFKV  I  KNKFNF+
Sbjct: 277 LESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKCFKVTFIVCKNKFNFD 336

Query: 308 AAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELHG 367
           +AKPS++P+  +PW+DKFVDEI RS+ ACKVF+FYP+YW  YGQM+N F++  GTMELH 
Sbjct: 337 SAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQMINNFITQAGTMELHN 396

Query: 368 LPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVLQH 427
           +PNDF Q  DSI +IVFIPI E F+YP IR+FTP +PITKIF GFM G+ AMVWAAVLQ 
Sbjct: 397 IPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGFMCGSCAMVWAAVLQS 456

Query: 428 FIYKSGPWYKYPMA-----ENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVT 482
           FIYK+GP Y +PMA      N PN +H+AWQ+PAYV+IA+SEIFAS+TGLE+AYS AP +
Sbjct: 457 FIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFASVTGLEFAYSNAPDS 516

Query: 483 MKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYNDT 542
           MK+FIM+IFL TNA G+A+G A+SP + DP Y W++ GL V+CF AG LFW CF HYND 
Sbjct: 517 MKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFVAGCLFWICFHHYNDI 576

Query: 543 EEAMNALDYDEDPTMLKHSKD 563
           +  M A+D+ ED  M+  S D
Sbjct: 577 DADMKAIDFVED-DMINASGD 596

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/563 (63%), Positives = 430/563 (76%), Gaps = 7/563 (1%)

Query: 1   MKRTETSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAG 60
           +K+T  SS D +   E  K   + +D   E    H   + E Y+  PTEEE++TL+HV+G
Sbjct: 25  LKKTTVSSEDQILDTESYK---LQNDN--EFDPEHPDYQEEGYE-MPTEEELRTLRHVSG 78

Query: 61  TIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFW 120
            IPFRC+LIAVVELSERF+YYGLS PFQNYM N P D+P G+L L S GATGLSYFFQFW
Sbjct: 79  RIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQFW 138

Query: 121 CYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXXXXXXXXXXX 180
           CY+TP+ GG+L+DT  G+YNTI  GTG+Y++GI +LF+TS  SI  +N            
Sbjct: 139 CYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALIL 198

Query: 181 XXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSL 240
                  IK+N+SVLIADQ P +R RV T K G RVIED +IT+QNVFM FYLMINIGSL
Sbjct: 199 IGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSL 258

Query: 241 SVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAI 300
           SVIATTELE HVGFWAAYLLPFCFFWIAVIVL +G+ SY   P  D+VI K FK      
Sbjct: 259 SVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALT 318

Query: 301 KNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVG 360
           KNKFN+ A  P+ +P+  F W DKFV+EI  +L+ACKVFLFYP+YW CYGQM N FV++G
Sbjct: 319 KNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMG 378

Query: 361 GTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMV 420
             ++LHGLPND FQAIDSIALIVFIPICE F YP+IR+FTPFRPITKI +GF   +A+MV
Sbjct: 379 SMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMV 438

Query: 421 WAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAP 480
           WA VLQ+FIYK+GP YK+P+A+  PN++H+AWQVPAYVLIAFSEIFASITGLEYAYSKAP
Sbjct: 439 WACVLQYFIYKTGPNYKHPLADG-PNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAP 497

Query: 481 VTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYN 540
            +MKSFIMA+FL  NAFGSAIGCALSPV+KDPDY WLY GL V  F  G  FWFCF+HYN
Sbjct: 498 ASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYN 557

Query: 541 DTEEAMNALDYDEDPTMLKHSKD 563
           D E+ MNAL+Y+++  + ++++D
Sbjct: 558 DIEDEMNALNYEDEDIITENNQD 580

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/557 (64%), Positives = 436/557 (78%), Gaps = 4/557 (0%)

Query: 13  DSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAGTIPFRCWLIAVV 72
           DS+E       ++ +L       +  + +    EPTEEE+KTL   AG IPF CWL+A++
Sbjct: 35  DSIENTSTTSTINKQLTNDSDYDDMDDGDDI--EPTEEELKTLPREAGHIPFNCWLLAII 92

Query: 73  ELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFWCYVTPIFGGWLS 132
           EL+ERF+YYGLS PFQNYMQN P D P G L+L S GATGLSYFFQFWCYVTPIF G+++
Sbjct: 93  ELAERFSYYGLSAPFQNYMQNNPSDNPPGALSLNSTGATGLSYFFQFWCYVTPIFAGFMA 152

Query: 133 DTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXXXXXXXXXXXXXXXXXMIKSNI 192
           DTY GK+NT+C GT +Y+IGI ILF+TS+P+IT+ N                  MIK+N+
Sbjct: 153 DTYWGKFNTLCIGTIIYIIGIFILFITSLPAITSYNTALGGFIVAIILIGIATGMIKANL 212

Query: 193 SVLIADQFPKQRHRVITKK-DGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATTELEAH 251
           SV+IADQ PK++ RV+TKK  G RVIEDP +T+QNVFM FY MIN+GSLSVIATTELE H
Sbjct: 213 SVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQNVFMAFYFMINVGSLSVIATTELELH 272

Query: 252 VGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNFEAAKP 311
           VGFWAAYLLPFCFFWIAV+VLA G   +VK P+GD+VISKCF ++GI IKN FNF+ AKP
Sbjct: 273 VGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIGDRVISKCFTIIGILIKNNFNFQKAKP 332

Query: 312 SVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELHGLPND 371
           + +P++ +PW+DKFVDEI RSL ACKVFLFYP+YWVCYGQMLN FV+ G TM+LHGLPND
Sbjct: 333 TYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIYWVCYGQMLNNFVTQGSTMQLHGLPND 392

Query: 372 FFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVLQHFIYK 431
           FFQAI+SIALIVFIPI E F+YP+IRKFTP +PITK+  GF+FG+ AMVWAAVLQHFIY+
Sbjct: 393 FFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPITKVTIGFVFGSLAMVWAAVLQHFIYQ 452

Query: 432 SGPWYKYPM-AENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVTMKSFIMAI 490
           +GP Y +P+   N PNH+H+AWQVPAY LI+ SEIFASITGLE AYSKAP +MKSFIM++
Sbjct: 453 AGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSEIFASITGLEIAYSKAPESMKSFIMSM 512

Query: 491 FLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYNDTEEAMNALD 550
           FL+TNAFG+AIGCALS V++DP YVWLY GL V CF AG  FWF FKHYND E+AMN +D
Sbjct: 513 FLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVTCFCAGIAFWFTFKHYNDEEDAMNNID 572

Query: 551 YDEDPTMLKHSKDGIEE 567
           ++ D    K+    IE 
Sbjct: 573 FESDNENEKNEYSQIEN 589

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/566 (62%), Positives = 429/566 (75%), Gaps = 10/566 (1%)

Query: 1   MKRTETSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAG 60
           +K T+ SS+DG     K      + D  +E    H   + E Y+  PT++EMKTL+ V G
Sbjct: 25  LKNTKVSSSDGE---HKDTEAYTLQDGSIE--PDHEDYQEEGYEI-PTQDEMKTLRRVGG 78

Query: 61  TIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFW 120
            IPFRC+L+A+VEL+ERF+YYGLS PFQNYMQNGP D+P G+L L S GATGLSYFFQFW
Sbjct: 79  RIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFW 138

Query: 121 CYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXXXXXXXXXXX 180
           CY+TPIFGG+L+DT  G+YNTI  GT +Y+IGI ILF+TS  ++  ++            
Sbjct: 139 CYITPIFGGYLADTKWGRYNTIGVGTVIYIIGIFILFITSFKTVAGRDGALAGFILALIL 198

Query: 181 XXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSL 240
                 +IKSN+SVLIADQ P +R RV T K G RVIED ++T+QNVFM FYLMINIGSL
Sbjct: 199 IGFATGLIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSL 258

Query: 241 SVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAI 300
           SVIATTELE +VGFWAAYLLPFCFFWIAVIV+  GK  Y+  P GD+VI+K FKV  I  
Sbjct: 259 SVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILC 318

Query: 301 KNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVG 360
           KNKF+  +AKPS  P+  FPW DKFVDEI R+L+ACKVFLFYP+YW CYGQM+N F+++G
Sbjct: 319 KNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMG 378

Query: 361 GTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMV 420
             M+LHGLPND FQAI+SI+LI+FIPICE FLYP+IR+FTP RP+T+IF GF+F A AMV
Sbjct: 379 SMMQLHGLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMV 438

Query: 421 WAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAP 480
           W+ VLQHFIY +GP Y  P+ E   N IH+ WQVPAYV IAFSEIFASITGLEYAYSKAP
Sbjct: 439 WSCVLQHFIYSTGPNYNRPL-ELGANDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAP 497

Query: 481 VTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYN 540
             MKSFIMA+FL  NAFGSAIGCALSPV+KDPDY WLY  L VACF +G +FW CF+ YN
Sbjct: 498 ANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYN 557

Query: 541 DTEEAMNALDY---DEDPTMLKHSKD 563
             E+ MNALD+   +ED  +++ ++D
Sbjct: 558 KIEDEMNALDFTDSEEDEILIRRAED 583

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/520 (66%), Positives = 410/520 (78%), Gaps = 7/520 (1%)

Query: 46  EPTEEEMKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNL 105
           EPTEEE+ TL+HV+  IPF CWLIA+VEL+ERF+YYGLS PFQNYMQNGP+DTP G+L L
Sbjct: 96  EPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQL 155

Query: 106 KSQGATGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSIT 165
           KSQGAT LSYFFQFWCYVTP+ GG+L+DT+ GKYNTIC G   YV+GILILF+T+IPSI 
Sbjct: 156 KSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSIN 215

Query: 166 TQNXXXXXXXXXXXXXXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQ 225
            +N                   IK+N+SVLIADQ PK R R+   K+G +VIEDPN+T+Q
Sbjct: 216 DKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQ 275

Query: 226 NVFMIFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVG 285
           NVFM FYLMINIGSLSV+ATT LEA  GFWAAYLL FCFFW+ ++VL  G+  YV+ P+G
Sbjct: 276 NVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIG 335

Query: 286 DKVISKCFKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVY 345
           D VI++CFK+  I + N FN   A PS++P++ +PW D F+DEI R+  ACKVF FYP+Y
Sbjct: 336 DHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIY 395

Query: 346 WVCYGQMLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPI 405
           WV YGQMLN FV+  GTMELHGLPNDF QAI+SIALIVFIPI E F+YP+IR+FTPFRP+
Sbjct: 396 WVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPV 455

Query: 406 TKIFWGFMFGAAAMVWAAVLQHFIYKSGPWYKYPMA-----ENTPNHIHIAWQVPAYVLI 460
           TKIF GF FG++AMV+AAVLQHFIYK+GP Y +PM+      NTPN +HI WQVPAYVLI
Sbjct: 456 TKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLI 515

Query: 461 AFSEIFASITGLEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVG 520
           + SEIFASITGLEYAYSKAP TMK+FIM+IFL+TNA GSA+G ALSP  ++P YVW + G
Sbjct: 516 SLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSG 575

Query: 521 LGVACFAAGWLFWFCFKHYNDTEEAMNALDY--DEDPTML 558
           L VACF AG LFW CF HYN  EEA+NALDY  +E   ML
Sbjct: 576 LAVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQML 615

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/570 (61%), Positives = 432/570 (75%), Gaps = 5/570 (0%)

Query: 3   RTETSSTDGVDSVEKQKAVEV--VDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAG 60
           + ET++T    + EK   VE   + +   +  +  +  E+E   +EPT+EE+ TLK V G
Sbjct: 30  KKETNATTS-STEEKLHDVETYNLSNSANDSTNDFDDDEMEEGYEEPTDEELNTLKRVGG 88

Query: 61  TIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFW 120
            IP RCWLI VVEL+ERF+YYGLS PFQNYMQNGP+D+P G+L L S GATGLSYFFQFW
Sbjct: 89  KIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFW 148

Query: 121 CYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXXXXXXXXXXXX 180
           CYVTP+FGG+++DTY GKYN+I  GTG Y++GI ILF+T+IPSI +QN            
Sbjct: 149 CYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIIL 208

Query: 181 XXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSL 240
                  IK+N+SVLIADQ PK++ RV   K G RVIEDPNITLQNVFM+FYLMINIGS+
Sbjct: 209 IGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSM 268

Query: 241 SVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAI 300
           SV+ATTELE+H GFWAAYLLPFCFFWIAV++L  G+  YVK  +GD V+ K FKV  I  
Sbjct: 269 SVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVA 328

Query: 301 KNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVG 360
           KNK ++ AAKPS  P+R +PW D+FVDE+ R+++ACKVF+FYP+YWV YG M++TFV+ G
Sbjct: 329 KNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQG 388

Query: 361 GTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMV 420
            TMELHG+PNDF Q  DSIALI+FIPI E F+YP+IR+FTP RPITKI  GF  G  AM 
Sbjct: 389 STMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMT 448

Query: 421 WAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAP 480
           WAAVLQHFIY +GP Y +P++ +TPN IH+AWQ+PAYVLIAFSEIFASITGLEYAYSKAP
Sbjct: 449 WAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAP 508

Query: 481 VTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYN 540
            +MKSF+M+IFLLTNAFGS +G ALS VT DP +VWL+ GL V+C   G LFW CF+  N
Sbjct: 509 PSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLN 568

Query: 541 DTEEAMNALDYDEDPTMLKHSKDGIEECAD 570
            TEE MNA+DYD +  + + SK  +   AD
Sbjct: 569 ATEEEMNAMDYDAE--IDEQSKRHLSSGAD 596

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/520 (65%), Positives = 410/520 (78%), Gaps = 3/520 (0%)

Query: 46  EPTEEEMKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNL 105
           EPTEEEM+TLK V G IP RCWL+AV+ELSERF+YYGLS PFQNYMQNGP DTP G L+L
Sbjct: 70  EPTEEEMRTLKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSL 129

Query: 106 KSQGATGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSIT 165
            +QGATGLSYFFQFWCY+TPIFGG+++DTY GKYNTI  G   Y+ GI ILF+TS+P +T
Sbjct: 130 NTQGATGLSYFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLT 189

Query: 166 TQNXXXXXXXXXXXXXXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQ 225
           + +                  MIK+N+SV+IA+Q PK++ R+IT+KDGTRVIEDP+ITLQ
Sbjct: 190 SYSAAMGGFIVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQ 249

Query: 226 NVFMIFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVG 285
           NVFM FY MIN+GSLSV+ATTELEA  GFWAAYLLPFCFFW+AV+VL +G   ++K P+G
Sbjct: 250 NVFMAFYFMINVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIG 309

Query: 286 DKVISKCFKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVY 345
           DK ISK FKVVGI IKNKFN+E+AKPS+ P+  +PWTDKFV+EI R++ AC VF FYP+Y
Sbjct: 310 DKTISKSFKVVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIY 369

Query: 346 WVCYGQMLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPI 405
           WVCYGQMLN FV+ GG MELH LPNDF Q IDSIALIVFIPICE  +YP++R+FTP RPI
Sbjct: 370 WVCYGQMLNNFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPI 429

Query: 406 TKIFWGFMFGAAAMVWAAVLQHFIYKSGPWYKYPM-AENTPNHIHIAWQVPAYVLIAFSE 464
           TKI  GF FG+ +MVWAAVLQ F+Y+  P Y +P    N PNHIH+ WQVPAY LIA SE
Sbjct: 430 TKITIGFFFGSFSMVWAAVLQWFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSE 489

Query: 465 IFASITGLEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVA 524
           IFASITGLEYAYSKAP +MKSFIM+IFL T A GSA+G ALSPV+ DP + W YVGL V+
Sbjct: 490 IFASITGLEYAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVS 549

Query: 525 CFAAGWLFWFCFKHYNDTEEAMNALDYDEDPTMLKHSKDG 564
           CF AG  FW CF  YND E+ +N +  D+ P +++ S + 
Sbjct: 550 CFIAGIAFWLCFSRYNDEEDELNNI--DDQPDVIQISSEN 587

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/368 (69%), Positives = 309/368 (83%)

Query: 187 MIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATT 246
           MIK+N+SVLIADQ PK++  +   K G RV+ DPNITLQNVFM FY MIN+GSLS++ATT
Sbjct: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60

Query: 247 ELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNF 306
           ELE H GFWAAYLLPFCFFWIAV+ L +GK  Y++ P+GDKVI+K F+V  I  KNKF+F
Sbjct: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120

Query: 307 EAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELH 366
            AAKPS+ P+R +PW DKFVDEI R+L+ACKVF+FYP+YW  YG M+++F++    MELH
Sbjct: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180

Query: 367 GLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVLQ 426
           G+PNDF QA DSIALI+FIPI E F+YP+IR++TPF+PITKIF+GFMFG+ AM WAAVLQ
Sbjct: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240

Query: 427 HFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVTMKSF 486
            FIYK+GPWY  P+  NTPN +H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP +MKSF
Sbjct: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300

Query: 487 IMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYNDTEEAM 546
           IM+IFLLT AFGSAIGCALSPVT DP + WL+ GL VACF +G LFWFCF+ YNDTEE M
Sbjct: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEEM 360

Query: 547 NALDYDED 554
           NA+DY+E+
Sbjct: 361 NAMDYEEE 368

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  231 bits (590), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 162/551 (29%), Positives = 254/551 (46%), Gaps = 40/551 (7%)

Query: 46  EPTEEEMKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQN------------ 93
           EPTE E   L+ V G   +  + I ++E SER +YYG      N++Q             
Sbjct: 31  EPTERERSELRRVLGHPKWYVYFICLIEFSERASYYGTGDRLNNFIQKPLPAGGNGAGAP 90

Query: 94  -GPDDTPAGLLNLKSQGATGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIG 152
               +  AG L +  Q AT L+    F  Y  P+  G+++D Y G+   +  G  V ++ 
Sbjct: 91  APGSEATAGALGMGLQVATALNLLLTFLAYCFPLITGYVADRYWGRMRMLWIGVFVGIVS 150

Query: 153 ILILFVTSIPSITTQNXXXXX-XXXXXXXXXXXXXMIKSNISVLIADQFPKQRHRVITKK 211
            ++  + S+P +                        +K  +   +  Q+P     V T  
Sbjct: 151 HVVFIIGSLPVVLGHGSAALAPCIIGIITLAIATAFVKPILLPTLLSQYPHATDVVKTLP 210

Query: 212 DGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIV 271
            G RVI D + +LQ + M FY  IN+GS   +AT+     VG+W A+L+P   F I   V
Sbjct: 211 SGERVIIDRDASLQRMTMTFYWSINVGSFLSVATSYSARDVGYWLAFLIPLALFMIMPAV 270

Query: 272 LAVGKNSYVK--PPVGDKVISKCFKVVGIAIKNKF--NFEA------AKPSVSPD----- 316
           L V +  Y+K  PP G  +I+ C KV+ +  +  +   + A      AKPS         
Sbjct: 271 LLVLRR-YIKDEPPSGRSLIADCLKVLKVCFERNWWSRYRAGTFWDYAKPSNLRSLGRQG 329

Query: 317 --RAFP--WTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELHGLPNDF 372
             ++ P  + +  V +   ++SAC +FL+Y +Y +  G + +   S   ++   G+PND 
Sbjct: 330 WRKSKPGFYPESLVQDARVTISACTIFLYYVIYNINDGGIGSIMNSQTASLTSKGVPNDL 389

Query: 373 FQAIDSIALIVFIPICEYFLYPYIRKFT-PFRPITKIFWGFMFGAAAMVWAAVLQHFIYK 431
               + + +IVF+PI +  +YP +RK    FRP+ +IF GFM  A A    A++QH IY+
Sbjct: 390 MSNFNPLCIIVFMPILDRVVYPLLRKLRWNFRPVFRIFAGFMVAALASAVGAIIQHAIYQ 449

Query: 432 SGPWYKYPM-AENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVTMKSFIMAI 490
           + P   Y    E   + I +      Y L  FSE  A  TG E A+ ++P  MK+F+MA+
Sbjct: 450 TSPCGNYATECEKGVSPISMWVVAIEYALTGFSECLAMTTGYEIAFERSPPHMKTFVMAL 509

Query: 491 FLLTNAFGSAIGCALSPVTKDPDYV---WLYVGLGVA-CFAAGWLFWFCFKHYNDTEEAM 546
           FL  +A  +A+G  ++P   DP  V    +  GLG A  FA  W +W             
Sbjct: 510 FLFMSALSAALGEIVTPSLVDPHLVIPFGVLAGLGAAVAFAFLWRYWNLHHVMEQERIER 569

Query: 547 NALDYDEDPTM 557
            AL   E+P +
Sbjct: 570 EALAKQEEPAL 580

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  221 bits (562), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 161/590 (27%), Positives = 258/590 (43%), Gaps = 49/590 (8%)

Query: 7   SSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAGTIPFRC 66
           S  + + SVEK +   +  D       S  G        EPTE E  TL+ V     +  
Sbjct: 2   SDHEKLSSVEKSQVAVLETDTY-----SEGGSGTPLSLPEPTEHERTTLRRVLEHPKWYV 56

Query: 67  WLIAVVELSERFAYYGLSTPFQNYMQN----------------GPDDTPAGLLNLKSQGA 110
           + I ++E SER +YYG      N++Q                   D   AG L +  Q A
Sbjct: 57  YFICLIEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAPAHGAAGDSATAGALGMGLQTA 116

Query: 111 TGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNXX 170
           T L+    F  Y  P+  G+++D Y  +   +  G  V +I  +I  + ++P +      
Sbjct: 117 TALNLLLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVGIISHVIFIIGALPPVLGNGQA 176

Query: 171 XXX-XXXXXXXXXXXXXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFM 229
                             +K  +   +  Q+P +   V T   G RV+ D + +LQ + M
Sbjct: 177 ALAPCVIGIITLAIATSFVKPVLLPTLLSQYPHETDVVRTLASGERVLVDRDASLQRMTM 236

Query: 230 IFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIA-VIVLAVGKNSYVKPPVGDKV 288
            FY  INIGS   +AT+     +G+W A+L+P   + I   ++L +G+    +PP G  +
Sbjct: 237 TFYWSINIGSFLSVATSYAARDIGYWLAFLIPLILYLIMPAVLLVLGRYLRDEPPSGRSM 296

Query: 289 ISKCFKVVGIAIKNK----------FNFEAAKPSVSPDRAFPWTDK---------FVDEI 329
           ++ C KV+ +  +            +N+          RA  W  K          V + 
Sbjct: 297 LADCCKVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGRA-GWRRKGAGGFYAESLVQDT 355

Query: 330 VRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICE 389
             +LSA  +FL+Y +Y +  G + +   S   ++  +G+PND     + + +IVF+P+ +
Sbjct: 356 RVTLSASAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVPNDLISNFNPLCIIVFMPVLD 415

Query: 390 YFLYPYIRKFT-PFRPITKIFWGFMFGAAAMVWAAVLQHFIYKSGPWYKYPMAENTPNHI 448
           + LYP +RK    F+P+ +IF GFM  A A    A++Q  IY + P  +Y    +     
Sbjct: 416 HVLYPVLRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTVIYNTSPCGRYATECDKGVSP 475

Query: 449 HIAWQVPA-YVLIAFSEIFASITGLEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSP 507
              W V   Y L   SE  A  TG E A+ ++P  MKSF+MA+FL T+A  +A+G  ++P
Sbjct: 476 VSMWVVAVEYALTGLSECLAMTTGYEIAFERSPAHMKSFVMALFLFTSALSAALGEIVTP 535

Query: 508 VTKDPDYV---WLYVGLGV-ACFAAGWLFWFCFKHYNDTEEAMNALDYDE 553
              DP  V    +  GLG    F   W +W   K          AL+ +E
Sbjct: 536 SLVDPHLVIPFGVLAGLGAFMAFVFLWRYWSLDKTMELERAERRALEAEE 585

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  220 bits (560), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 154/546 (28%), Positives = 257/546 (47%), Gaps = 39/546 (7%)

Query: 53  KTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQ-----------NGPDDTPAG 101
           K L+HV     +  ++I ++EL+ER +YYG      N+ Q            GPDD   G
Sbjct: 44  KRLRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPG 103

Query: 102 LLNLKSQGATGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSI 161
            L    Q AT L+   +F  Y  P+  G+++D Y+G+   +  G    V+  +I  + ++
Sbjct: 104 ALGRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAAL 163

Query: 162 PSITTQNXXXXXXXXXXXXXXXX-XXMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDP 220
           P++   N                    +K  +  ++  Q+P + + V T   G RVI + 
Sbjct: 164 PAVIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNR 223

Query: 221 NITLQNVFMIFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYV 280
           + +LQ + M FY  IN+GS   +AT      VG+W ++L+P   F I   +L   KN  V
Sbjct: 224 DASLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKV 283

Query: 281 KPPVGDKVISKCFKVVGIAI--------KNKFNFEAAKPSVSPDRAFPWT---------- 322
            PP+G+ + ++C KV+ +          ++   +  AKP  S  RA   T          
Sbjct: 284 TPPLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYAKP--SNLRALGRTGWRRSKEGFY 341

Query: 323 -DKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELHGLPNDFFQAIDSIAL 381
            +  V++   +L+AC +FL+Y +Y +   Q+ +   +  G+M   G+PND     + +A+
Sbjct: 342 KESLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAI 401

Query: 382 IVFIPICEYFLYPYIRKFT-PFRPITKIFWGFMFGAAAMVWAAVLQHFIYKSGPWYKY-P 439
           I+ +PI +Y L P +R+    F+P+ +IF+GFM    A V  A++Q  IY + P  K+  
Sbjct: 402 IITMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHAS 461

Query: 440 MAENTPNHIH--IAWQVPA-YVLIAFSEIFASITGLEYAYSKAPVTMKSFIMAIFLLTNA 496
               T   +     W V   YVL   SE FA  TG E A+ ++P  MK+F+M++FL+T A
Sbjct: 462 TCSETIRQVSPLSRWLVGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTTA 521

Query: 497 FGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYNDTEEAMNALDYDEDP- 555
             S +    + +  DP  V  ++   V       LF + + + +   EA        DP 
Sbjct: 522 LSSILTQIFNGIMTDPYLVIPFILFAVLGTLFAILFLYRYWNLDKVMEAERRERAILDPL 581

Query: 556 TMLKHS 561
            +L H+
Sbjct: 582 EILAHN 587

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  211 bits (538), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 162/561 (28%), Positives = 261/561 (46%), Gaps = 51/561 (9%)

Query: 47  PTEEEMKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQ-------NGPDDTP 99
           PTEEE +TL+ +     +  +LI  +EL+ER +YYG      NY         NG   T 
Sbjct: 44  PTEEEERTLRRIVVHPSWYVYLICFIELAERASYYGTGDRLNNYYTYPLPEGGNGAGATA 103

Query: 100 ------AGLLNLKSQGATGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGI 153
                 +G L      AT L    +F  Y  P+  G+L D Y+G   T+ +G    V   
Sbjct: 104 HGSEANSGALGKGLATATSLGLLLKFTSYFFPLVTGYLCDMYMGHVRTLWYGIWTGVASH 163

Query: 154 LILFVTSIPSITTQ-NXXXXXXXXXXXXXXXXXXMIKSNISVLIADQFPKQRHRVITKKD 212
           +I  ++++P +    +                   +K  +  L+  Q+P + + V T + 
Sbjct: 164 IIFILSALPVVLKHPDAAMALSLIGLITLSVCTAFVKPVLLPLLLQQYPHETNVVKTLET 223

Query: 213 GTRVIEDPNITLQNVFMIFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVL 272
           G RVI D + +LQ + M FY  INIG+   +AT+     VGFW A+L+P   +    +V 
Sbjct: 224 GERVIIDRDASLQRMTMTFYWAINIGAFMSLATSYAAKEVGFWLAFLIPLIIYMAMPVVF 283

Query: 273 A-VGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNFEAAKPSVSPDRAFP----------W 321
           + V  +   + P G  +++ C KV+ +A    +N    K  V  D A P          W
Sbjct: 284 SLVQPHIKDRAPSGYSLLADCMKVLYVAFGKGWNAR-RKEGVFWDYALPSNQRQMGKVGW 342

Query: 322 TDK-------FVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELHGLPNDFFQ 374
             K        V +   +LSAC +F +Y +Y +   Q+     S  G+M  +G+PND   
Sbjct: 343 RKKSPFYKESLVQDTKITLSACFIFCYYIIYNMNDNQLTTIINSQTGSMTKNGVPNDVIS 402

Query: 375 AIDSIALIVFIPICEYFLYPYIRKFT-PFRPITKIFWGFMFGAAAMVWAAVLQHFIYKSG 433
             + +++IV IPI +Y LYP +R+    F+P+ +IF GFM   A+ V  A++Q  IY++ 
Sbjct: 403 NFNPLSIIVLIPILDYGLYPLLRRLRINFKPVYRIFTGFMLAVASSVAGALIQWRIYETS 462

Query: 434 PWYKYPMAENTPNHIHI----AWQVPA-YVLIAFSEIFASITGLEYAYSKAPVTMKSFIM 488
               Y     +   + +    +W V   Y L   SE  A  T  E AY ++P  MKSF++
Sbjct: 463 SC-GYHATTCSEKGLGVSPLSSWIVAVEYTLSGASECLAMTTAYEIAYDRSPEHMKSFVL 521

Query: 489 AIFLLTNAFGSAIGCALSPVTKDPDYV---WLYVGLGVACFAAGWLFWFCFKHYNDTEEA 545
           A+FL T+A  +AI   ++P+ KDP  +    L+ G+G   F +G  F + F++ +     
Sbjct: 522 ALFLFTSAVSAAITQIVNPILKDPLLIVPFALFAGIG---FISGCHFLWKFRNLDK---- 574

Query: 546 MNALDYDEDPTMLKHSKDGIE 566
              L    +  +L+ S +  E
Sbjct: 575 -EMLQEKRERELLQESSESDE 594

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  189 bits (480), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 157/568 (27%), Positives = 260/568 (45%), Gaps = 51/568 (8%)

Query: 25  DDKLVEVISSHNGLEVESYDDE------PTEEEMKTLKHVAGTIPFRCWLIAVVELSERF 78
           ++K    ++    LE E Y  E      PTE E  TL+ +  +     + I ++E +ER 
Sbjct: 3   EEKETAKVNFVQDLEKEKYITETETLQIPTEHEELTLRRIVTSPKIHLYFICLIEFAERG 62

Query: 79  AYYGLSTPFQNYMQ------------NGPDDTPAGLLNLKSQGATGLSYFFQFWCYVTPI 126
           ++YG      N+ Q             GP +   G L      AT +    +F  Y   I
Sbjct: 63  SFYGTGNRMGNFYQYPLPIGGNGAGAPGPGEQDPGALGKGLAVATAMGLLLKFTSYTFSI 122

Query: 127 FGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQ-NXXXXXXXXXXXXXXXXX 185
             G++SD YIG+   +  G  + V   ++  + ++PS+    N                 
Sbjct: 123 ITGYISDVYIGQIKMLWIGVWLGVGSHILFIIAALPSVLAHTNVAYALSVVALLSLSLCT 182

Query: 186 XMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIAT 245
             +K  +  L+  Q+P + + V T   G RVI D + +LQ + M+FY  IN+G+   +AT
Sbjct: 183 SFVKPVLLPLLLQQYPYKTNIVKTLLSGERVIVDRDASLQRMTMVFYWAINVGAFLSLAT 242

Query: 246 TELEAHVGFWAAYLLPFCFFWIAVIVL-AVGKNSYVKPPVGDKVISKCFKVVGIA----- 299
                 VG+W A+ +P   + +  IVL  + ++     P  + V+++  KV+ +      
Sbjct: 243 AYSAQRVGYWLAFTVPLIIYLLMPIVLWKLQEDIKTNEPSRESVLAESLKVLKVCYEWGW 302

Query: 300 IKNKFN---FEAAKPSV---------SPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWV 347
           IK  ++   ++ AKP+             +A  + +K+V +   ++SAC +FL+Y +Y +
Sbjct: 303 IKRYWSGQFWDYAKPTNLIQQGRIGWRKKKAGFYDEKYVYDTKLTISACTIFLYYVIYQM 362

Query: 348 CYGQMLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFT-PFRPIT 406
            +  +     S  G+ME  G+PND F   + I++IV +PI +Y LYP +R++   F+P+ 
Sbjct: 363 -HSNLDEPMRSQAGSMEGEGVPNDLFSNFNPISIIVVMPILDYVLYPLLRRYRINFKPVY 421

Query: 407 KIFWGFMFGAAAMVWAAVLQHFIYKSGPWYKYPMAENTPNHIHIA-----WQVP-AYVLI 460
           +IF GFM G       A++Q  +Y + P   Y  A   P   H       W V   Y L 
Sbjct: 422 RIFCGFMIGCLGSTVGAIIQWRVYNTSP-CGYMGATTCPELHHKKSPLSRWLVAIEYALG 480

Query: 461 AFSEIFASITGLEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLY-V 519
             SE  A  TG E A+ ++P  MK F++A+F+ T A  SAI   ++P  KDP  +  + V
Sbjct: 481 GTSECLAMTTGYEIAFERSPKKMKGFVLALFMFTVAISSAIILPITPFFKDPYLIQPFAV 540

Query: 520 GLGVACFAAGWLFWFCFKHYNDTEEAMN 547
             GV    A    W     Y D ++ M 
Sbjct: 541 CAGVGALTAIIFLW----RYWDLDKQMK 564

>NDAI0E01210 Chr5 complement(240179..241252,241254..241424) [1245
          bp, 414 aa] {ON} Anc_8.665 YOR239W ribosomal
          frameshifting
          Length = 414

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 10 DGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAGTIPFR 65
          D  + V+  KA+E VD   + + +SHN  E+E+   +  EE ++TL H A   P +
Sbjct: 38 DNSNIVDDVKALEAVDPVTLGISNSHNKEELEALTQDVKEETLETLAHNAIPEPVK 93

>Kwal_27.12776 s27 complement(1370802..1372406) [1605 bp, 534 aa]
           {ON} YFL049W - Hypothetical ORF [contig 260] FULL
          Length = 534

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 7/85 (8%)

Query: 21  VEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAGTIPFRCWLIAVVELS--ERF 78
           VE+ D+   ++IS  +  E++    +    E+   +H++  IP +  +   +ELS   R 
Sbjct: 251 VEIPDEMPYQIISEQSSWELK----QDYARELSQGEHLSVIIPGQN-ITGSLELSAQHRL 305

Query: 79  AYYGLSTPFQNYMQNGPDDTPAGLL 103
             Y   T  Q  +Q G +DTP GLL
Sbjct: 306 PKYYSKTSIQAAIQAGTEDTPIGLL 330

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.448 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,156,991
Number of extensions: 2586954
Number of successful extensions: 8614
Number of sequences better than 10.0: 28
Number of HSP's gapped: 8752
Number of HSP's successfully gapped: 28
Length of query: 574
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 459
Effective length of database: 40,294,809
Effective search space: 18495317331
Effective search space used: 18495317331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)