Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B022205.699ON48948923300.0
ZYRO0G06666g5.699ON50348711211e-149
Smik_9.235.699ON5275046513e-78
YIL146C (ATG32)5.699ON5295176243e-74
Skud_9.225.699ON5375066243e-74
Suva_9.435.699ON5133095683e-66
SAKL0E14850g5.699ON4704954842e-54
KLTH0E01122g5.699ON4724414352e-47
Kwal_55.197165.699ON4674904325e-47
CAGL0H06545g5.699ON4924264021e-42
KAFR0D022505.699ON5565464007e-42
Ecym_40215.699ON4594863913e-41
AFR283W5.699ON4524883721e-38
KNAG0L021005.699ON4444843693e-38
NCAS0G002605.699ON5105113283e-32
KLLA0A00660g5.699ON5244872956e-28
TBLA0E020905.699ON7491382622e-23
Kpol_2001.735.699ON4111271302e-07
TBLA0B08190singletonON37927741.6
TPHA0O01190singletonON70231722.9
TPHA0B03640singletonON102531723.0
TPHA0K02100singletonON163831723.1
TPHA0P01400singletonON164431723.1
TPHA0I02520singletonON150931723.2
TPHA0L01530singletonON152431723.2
TPHA0G01020singletonON142431723.3
TPHA0D045805.699ON470190713.5
SAKL0F13728g7.446ON394102695.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02220
         (489 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   902   0.0  
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   436   e-149
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   255   3e-78
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   244   3e-74
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   244   3e-74
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   223   3e-66
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   191   2e-54
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...   172   2e-47
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...   171   5e-47
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...   159   1e-42
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...   158   7e-42
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   155   3e-41
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...   147   1e-38
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....   146   3e-38
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...   130   3e-32
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...   118   6e-28
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...   105   2e-23
Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON} (1997...    55   2e-07
TBLA0B08190 Chr2 complement(1954681..1955820) [1140 bp, 379 aa] ...    33   1.6  
TPHA0O01190 Chr15 (230494..232602) [2109 bp, 702 aa] {ON}              32   2.9  
TPHA0B03640 Chr2 complement(851392..854469) [3078 bp, 1025 aa] {...    32   3.0  
TPHA0K02100 Chr11 (449107..454023) [4917 bp, 1638 aa] {ON}             32   3.1  
TPHA0P01400 Chr16 complement(285031..289965) [4935 bp, 1644 aa] ...    32   3.1  
TPHA0I02520 Chr9 (556711..561240) [4530 bp, 1509 aa] {ON}              32   3.2  
TPHA0L01530 Chr12 (320935..325509) [4575 bp, 1524 aa] {ON}             32   3.2  
TPHA0G01020 Chr7 complement(201378..205652) [4275 bp, 1424 aa] {...    32   3.3  
TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON}             32   3.5  
SAKL0F13728g Chr6 complement(1097746..1098930) [1185 bp, 394 aa]...    31   5.5  

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/489 (89%), Positives = 439/489 (89%)

Query: 1   MVSASESKIAKQDRVGEVSGVETTAFEKKSLLDPHLSVLELLERTGDTQRVGRGVEKADD 60
           MVSASESKIAKQDRVGEVSGVETTAFEKKSLLDPHLSVLELLERTGDTQRVGRGVEKADD
Sbjct: 1   MVSASESKIAKQDRVGEVSGVETTAFEKKSLLDPHLSVLELLERTGDTQRVGRGVEKADD 60

Query: 61  MANTTNSISSSWQAIHRNDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHF 120
           MANTTNSISSSWQAIHRNDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHF
Sbjct: 61  MANTTNSISSSWQAIHRNDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHF 120

Query: 121 TQFHQSQQPPRLPFKLDVPVILPARDQEPSGQTQTPDNDDERDDEXXXXXXXXXXXXFVM 180
           TQFHQSQQPPRLPFKLDVPVILPARDQEPSGQTQTPDNDDERDDE            FVM
Sbjct: 121 TQFHQSQQPPRLPFKLDVPVILPARDQEPSGQTQTPDNDDERDDETLTKSLSNSSNSFVM 180

Query: 181 PKLSLSQKSHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQEL 240
           PKLSLSQKSHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQEL
Sbjct: 181 PKLSLSQKSHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQEL 240

Query: 241 KEMVSLLNRVCQCAPTRPVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLN 300
           KEMVSLLNRVCQCAPTRPVIPVCQTGQHQQVRNV             YPPVVISNHSDLN
Sbjct: 241 KEMVSLLNRVCQCAPTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISNHSDLN 300

Query: 301 NMYRFLLDLSKTISDNSXXXXXXXXXXXXXXXXXXXXXXXXXRAGSYDKTDKPRKRRSKE 360
           NMYRFLLDLSKTISDNS                         RAGSYDKTDKPRKRRSKE
Sbjct: 301 NMYRFLLDLSKTISDNSEDDEDEEERELLDKKIKKSHQRKKKRAGSYDKTDKPRKRRSKE 360

Query: 361 TKINKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLG 420
           TKINKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLG
Sbjct: 361 TKINKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLG 420

Query: 421 MGEYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSNR 480
           MGEYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSNR
Sbjct: 421 MGEYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSNR 480

Query: 481 VLALGYILL 489
           VLALGYILL
Sbjct: 481 VLALGYILL 489

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  436 bits (1121), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 232/487 (47%), Positives = 300/487 (61%), Gaps = 27/487 (5%)

Query: 26  FEKKSLLDPHLSVLELLERTGDTQ----RVGRGVEKADDMANTTN----SISSSWQAIHR 77
            E++S+LDPHLSVLELL R  DT+      G   +   + A TT     SIS SWQ IHR
Sbjct: 21  IERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAGTTGTGNGSISQSWQTIHR 80

Query: 78  NDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPFK-- 135
           ND+ ++ VPERC SQA A GILSSSDTSE+E D  +SP+  H  Q H +  PP+   K  
Sbjct: 81  NDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVH-QQLHAT--PPQKHTKSL 137

Query: 136 -------LDVPVILP-----ARDQEPSGQTQTPDNDDERDDEXXXXXXXXXXXXFVMPKL 183
                  + +P++LP       +   +G T T  N +E D++            F+MPKL
Sbjct: 138 EDYRSLNVGIPLVLPEDSNNINNNNKNGST-TGSNGEEDDNDTITKSLNSSSNSFIMPKL 196

Query: 184 SLSQKSHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQELKEM 243
           SLSQK+ K RIL+LGRPGLKFY SIPK+YQH FEL R  DP+EF+Q+TGIL+VFQELKEM
Sbjct: 197 SLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELKEM 256

Query: 244 VSLLNRVCQCAPTRPVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLNNMY 303
           VSLLNRVCQC P RPVIPVCQ+GQ QQVRN+             YPPVV++N  DL  M+
Sbjct: 257 VSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLGMF 316

Query: 304 RFLLDLSKTISDNSXXXXXXXXXXXXXXXXXXXXXXXXXRAGSYDKTDKPRKRRSKETKI 363
           RFL +LSKT+SDNS                            S ++  +P K+R    K+
Sbjct: 317 RFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSAERNGRPHKKRHNNEKV 376

Query: 364 NKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMGE 423
           N+W++WG+SLT+GVGVGYC+S+  SS  IS++   +  ++    + ++ VFD   L +GE
Sbjct: 377 NRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELKLGE 436

Query: 424 YDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAED-NSNRVL 482
            D D ++PF HAL+L KQ LKQWN A+KQFL +HL   E     N  EW   D ++NRVL
Sbjct: 437 MDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHTNRVL 496

Query: 483 ALGYILL 489
           ALGY++L
Sbjct: 497 ALGYVML 503

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  255 bits (651), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 174/504 (34%), Positives = 252/504 (50%), Gaps = 50/504 (9%)

Query: 25  AFEKKSLLDPHLSVLELLERTGDTQR-VGRGVEKADDMA---NTTNSISSSWQAIHRNDA 80
           A E + LLDPHLSVLELL +TG +   +G+ +  + D++   N  +SIS SWQAI   D 
Sbjct: 35  AEEDRGLLDPHLSVLELLGKTGHSPSPMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDL 94

Query: 81  MITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRL-----PFK 135
             + +PERCSSQ     ILSSSDTSEEE +   +P         Q Q+   +     PF+
Sbjct: 95  GASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGTNVTSSSHPFR 154

Query: 136 LDVPVI---LPARDQEPSGQTQTPDNDD---ERDDEXXXXXXXXXXXXFVMPKLSLSQKS 189
               VI   +P+R++ P  +    D++D   E D              FVMPKLSLSQK+
Sbjct: 155 QLHKVISLPIPSREKTPYKEQDINDDEDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKN 214

Query: 190 HKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQELKEMVSLLNR 249
              R+LILGR G  FYQSIPK YQ  FEL +  D + F Q+TGI+I+FQEL+EMVSLLNR
Sbjct: 215 PVFRLLILGRTGSNFYQSIPKEYQSLFELPKYHDSATFPQYTGIIIIFQELREMVSLLNR 274

Query: 250 VCQCAPTRPVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLNNMYRFLLDL 309
           + Q +  +P+IP+CQ GQ  QV+NV             +PPVV++N  DL  M++ L DL
Sbjct: 275 IVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDL 334

Query: 310 SKTISDNSXXXXXXXXXXXXXXXXXXXXXXXXXRAGSYDKTDKPRKRRSKETKINKWIVW 369
           S   +++                          R          + ++ K+     W  W
Sbjct: 335 SLEYAEDENEEGDDDETTKSRSYYRYKKANNSKRKSPKSNK---KPKKKKQRFFTSWFTW 391

Query: 370 GISLTVGVGVGYCMSYFASSGLISMSAK--------------------SIASINGCRP-- 407
           GIS+T+G+  G C++YF ++     + K                    ++ +     P  
Sbjct: 392 GISITIGISFGCCVTYFVTAAYDHQTVKSLSLRSSLLTSMLSLDSSSDTVNTPATASPSS 451

Query: 408 NDNVVVFDDSSLGMGEYDHDLENPFAHALYLLKQTLKQWNWA-MKQFLMKHLHLPESS-S 465
           +++ + FD  +L   + +  L+     +L ++K+T     W  M  F++  L  P S   
Sbjct: 452 SEHFLWFDKGTL---QINFHLDGLIMKSLSVIKET-----WVKMNDFVLHALSRPLSFLE 503

Query: 466 STNYKEWGAEDNSNRVLALGYILL 489
           + N     + D SNR+LALGYILL
Sbjct: 504 NLNRSSDFSIDESNRILALGYILL 527

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  244 bits (624), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 179/517 (34%), Positives = 252/517 (48%), Gaps = 68/517 (13%)

Query: 22  ETTAFEKKSLLDPHLSVLELLERTGDTQR-VGRGVEKADDMA---NTTNSISSSWQAIHR 77
           E    E K LLDPHLSVLELL +TG +   +G+ +  + D++   N  +SIS SWQAI  
Sbjct: 32  EAQTGEDKGLLDPHLSVLELLSKTGHSPSPMGQNLVTSIDISGNHNVNDSISGSWQAIQP 91

Query: 78  NDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQ-----PPRL 132
            D   + +PERCSSQ     ILSSSDTSEEE +   +P         Q Q+      P  
Sbjct: 92  LDLGASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGANVVSPSH 151

Query: 133 PFKLDVPVI---LPARDQEPSGQTQTPDNDDERDDEXXXXXX---XXXXXXFVMPKLSLS 186
           PFK    +I   LP +++ P  +     ++DE  +E               FVMPKLSL+
Sbjct: 152 PFKQLQKIISLPLPGKEKTPFNEQDDDGDEDEAFEEDSVTITKSLTSSTNSFVMPKLSLT 211

Query: 187 QKSHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQELKEMVSL 246
           QK+   R+LILGR G  FYQSIPK YQ  FEL +  D + F Q+TGI+I+FQEL+EMVSL
Sbjct: 212 QKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSL 271

Query: 247 LNRVCQCAPTRPVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLNNMYRFL 306
           LNR+ Q +  +PVIP+CQ GQ  QV+NV             +PPVV++N  DL  M++ L
Sbjct: 272 LNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQRL 331

Query: 307 LDLSKTISDNSXXXXXXXXXXXXXXXXXXXXXXXXXRAGSYDKTDKPRKRRSKETK---- 362
            DLS    ++                          ++ SY +  K    + K  K    
Sbjct: 332 QDLSLEYGED-------------VNEEDNDDEAIHTKSRSYCRNKKAENSKKKSPKSNKK 378

Query: 363 --------INKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIA-------------- 400
                      W  WGIS+T+G+  G C++YF ++     + KS++              
Sbjct: 379 PKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTVKSLSLRPSILASLLSLDS 438

Query: 401 ---SIN---GCRPN--DNVVVFDDSSLGMGEYDHDLENPFAHALYLLKQTLKQWNWAMKQ 452
              +IN      P+  +  + FD  +L +  +          +L ++K+T  + N  +  
Sbjct: 439 SSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGF---IMKSLTIIKETWGKMNTFVLH 495

Query: 453 FLMKHLHLPESSSSTNYKEWGAEDNSNRVLALGYILL 489
            L K L   E   + N     + D SNR+LALGYILL
Sbjct: 496 ALSKPLKFLE---NLNKSSEFSIDESNRILALGYILL 529

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  244 bits (624), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 180/506 (35%), Positives = 251/506 (49%), Gaps = 38/506 (7%)

Query: 22  ETTAFEKKSLLDPHLSVLELLERTGDTQR-VGRGVEKADDMAN---TTNSISSSWQAIHR 77
           E  A E K LLDPHLSVLELL +TG +   +G  +  + D+++     +SIS SWQAIH 
Sbjct: 32  EVEAGEDKGLLDPHLSVLELLGKTGHSPSPMGHSLVTSIDISSHHYVNDSISGSWQAIHP 91

Query: 78  NDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQ-----PPRL 132
            D   + VPER SSQ     ILSSSDTSEEE +   +P         Q Q+      P  
Sbjct: 92  LDLGASFVPERSSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGASVTSPSR 151

Query: 133 PFKLDVPVI---LPARDQEPSGQTQTPDNDD---------ERDDEXXXXXXXXXXXXFVM 180
           PF+    VI   LPA+ +   G+    DN+          E D              FVM
Sbjct: 152 PFRQLHKVISLPLPAKGRTSYGEQDDDDNNVDDDYDDGAYEEDSGTITKSLTSSTNSFVM 211

Query: 181 PKLSLSQKSHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQEL 240
           PKLSLSQK+   R+LILGR G  FYQSIPK +Q  FEL +  D + F Q+TGI+I+FQEL
Sbjct: 212 PKLSLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTAFPQYTGIIIIFQEL 271

Query: 241 KEMVSLLNRVCQCAPTRPVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLN 300
           +EMVSLLNR+ Q +  +P+IP+CQ GQ  QV+NV             YPPVV++N  DL 
Sbjct: 272 REMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPPVVVTNRRDLK 331

Query: 301 NMYRFLLDLS-KTISDNSXXXXXXXXXXXXXXXXXXXXXXXXXRAGSYDKTDKPRKRRSK 359
            M++ L DLS +   D                            +         + ++ K
Sbjct: 332 KMFQRLQDLSLEYAEDGDNDDEDNDDEIIHTNSRSYYRNKKANSSKKKSFKSNKKPKKKK 391

Query: 360 ETKINKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRP--------NDNV 411
           +  + +W  WG+S+T+G+  G C++YFA++     + KS    +            +D V
Sbjct: 392 QRSLTRWFTWGVSITIGISFGCCVTYFATAAYDHQTGKSFNLRSSILTSLLSLDSYHDTV 451

Query: 412 VVFDDSSLGMGE----YDHD-LENPFAHALYLLKQ-TLKQWNWA-MKQFLMKHLHLPESS 464
                +S   GE    +D   L+  F    +++K  T+ +  W+ M  F++  L  P + 
Sbjct: 452 NTPATTSTSSGEQFLWFDKGTLQINFHSDGFIMKSLTVIKDTWSKMNVFVLNALSRPLNF 511

Query: 465 -SSTNYKEWGAEDNSNRVLALGYILL 489
             + N     + D SNR+LALGYILL
Sbjct: 512 LENLNKNSDFSLDESNRILALGYILL 537

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  223 bits (568), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 175/309 (56%), Gaps = 20/309 (6%)

Query: 22  ETTAFEKKSLLDPHLSVLELLERTGDTQR-VGRGVEKADDMANTTN---SISSSWQAIHR 77
           E  A E K LLDPHLSVLELL +TG +   +G+ +  + D++N  N   +IS SWQ I  
Sbjct: 32  EGQAEEDKGLLDPHLSVLELLGKTGSSPSPLGQSLVTSIDISNHHNVIDNISGSWQTIQP 91

Query: 78  NDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSP-----NVAHFTQFHQSQQPPRL 132
            D   + +PERCSSQ     ILSSSDTSEEE D   +P     N+    Q   S   P  
Sbjct: 92  LDLGASFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPSH 151

Query: 133 PFKLDVPVI---LPARDQEPSGQTQ---TPDNDD-----ERDDEXXXXXXXXXXXXFVMP 181
           PFK    VI   +P R++   G+ +     DNDD     E D              FVMP
Sbjct: 152 PFKQLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVMP 211

Query: 182 KLSLSQKSHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQELK 241
           KLSLS+K+   R+LILGR G  FYQS PK YQ  FEL +  D + F Q+TGI+IVFQEL+
Sbjct: 212 KLSLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFELPKSHDSTIFPQYTGIVIVFQELR 271

Query: 242 EMVSLLNRVCQCAPTRPVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLNN 301
           EMVSLLNR+ + A  +P+IP+CQ GQ  QV+NV             YPPVV +N  DL  
Sbjct: 272 EMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVATNRKDLKK 331

Query: 302 MYRFLLDLS 310
           M++ L DLS
Sbjct: 332 MFQRLQDLS 340

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  191 bits (484), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 149/495 (30%), Positives = 230/495 (46%), Gaps = 81/495 (16%)

Query: 26  FEKKSLLDPHLSVLELLERTGDTQRVGRGVEKAD-----DMANTTN-------------- 66
           F+K+S+LDPH SVL+LLER G  Q     V +A      ++ +  N              
Sbjct: 26  FQKRSILDPHFSVLQLLERNGCEQE--EDVNQASSQIPVELKSAFNRPLSPHKRYPEALN 83

Query: 67  -SISSSWQAIHRND-AMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFH 124
            SIS SWQ+I   D +++  + +  SSQA  VGILSSSDTSEEE+D  +SP+ +    F 
Sbjct: 84  QSISDSWQSIKMVDYSILNSLHDTSSSQA--VGILSSSDTSEEELDHLNSPSPSSQQVFP 141

Query: 125 QSQQPPRLPFKLDVPVILPARDQEPSGQTQTPDNDDERDDEXXXXXXXXXXXXFVMPKLS 184
                P + F+    V+        S     P   +E D+E            FVMP+LS
Sbjct: 142 NG---PPISFQTQAGVL------TASATLPNPGVLEEDDNETVTVSLAASSNSFVMPQLS 192

Query: 185 LSQKSHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPS--EFRQFTGILIVFQELKE 242
           LSQ+SH+  IL++G+P  KF+ ++PK YQ  F++   +  S  +   +T ++I+FQ+ KE
Sbjct: 193 LSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHYTAVMIIFQDTKE 252

Query: 243 MVSLLNRVCQCAPTRPVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLNNM 302
           +  +L+ +      + +IP+CQ GQ QQ+ ++             + P V+SNH +++ +
Sbjct: 253 VSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSNHQEIHKL 312

Query: 303 YRFLLDLSKTISDNSXXXXXXXXXXXXXXXXXXXXXXXXXRAGSYDKTDKPRKRRSKETK 362
            R+L  LS  I                                                 
Sbjct: 313 LRYLHRLSTEIDSGYETDETHLKVRKRKKTHKKKSKGTS--------------------- 351

Query: 363 INKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMG 422
            N+W++WG+SLTVGVG+G C+S+  SS   S+     AS +     + V    D + G G
Sbjct: 352 -NRWVIWGLSLTVGVGIGCCISFILSSYSSSVQIPH-ASRDDVVLVEEVPTLPDKAEGNG 409

Query: 423 EYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNY-----KEWGAEDN 477
                   P    + LL++T+KQ+N  +KQF+       E   S ++     KE  +ED+
Sbjct: 410 --------PIGQVITLLRKTVKQFNLVLKQFIY------EQVGSLSWIQRVGKELISEDS 455

Query: 478 S---NRVLALGYILL 489
                RV AL  +LL
Sbjct: 456 DGTVGRVAALDLVLL 470

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score =  172 bits (435), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 134/441 (30%), Positives = 203/441 (46%), Gaps = 54/441 (12%)

Query: 27  EKKSLLDPHLSVLELLERTGDTQRVGR---------GVEKADDMANTTNSISSSWQAIHR 77
           ++ S+LDPHLSVL+LL+R      +              +     +   SIS SWQ+I  
Sbjct: 36  QRNSILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKH 95

Query: 78  NDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQP--PRLPFK 135
            D  +       + Q A  GILSSSDTSE+E D   SP+  +F  F  S     P  P  
Sbjct: 96  TDCSMVNTQGDATHQHA--GILSSSDTSEDEPDAQLSPSPNNFA-FPNSATSIFPEAPHN 152

Query: 136 LDVPVILPARDQEPSGQTQTPDNDDERDDEXXXXXXXXXXXXFVMPKLSLSQKSHKLRIL 195
           L+   +   ++ E        +  +E D+E            FVMPKLSL Q+S K  IL
Sbjct: 153 LEASSLREYQNSE------IANPREENDNETVTMSLMNSSNSFVMPKLSLIQQSQKFCIL 206

Query: 196 ILGRPGLKFYQSIPKRYQHFFELSRLQ--DPSEFRQFTGILIVFQELKEMVSLLNRVCQC 253
           I+G+P  +FY+ IP+ Y   FE+  +    P E  +++ ++++F E KE   LL +V   
Sbjct: 207 IVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVMVIFGEPKEGKELLEKV--A 264

Query: 254 APTRPVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLNNMYRFLLDLSKTI 313
           A    +I VCQ GQ QQ+ N+             Y   V+S+H D++ + R+L  LS  +
Sbjct: 265 AHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLNTLSTEV 324

Query: 314 SDNSXXXXXXXXXXXXXXXXXXXXXXXXXRAGSYDKTDKPRKRRSKETKINKWIVWGISL 373
                                         +    K  K  K+RS +  +N+W++W ISL
Sbjct: 325 DSGYETEVG---------------------SRKIRKRRKSSKKRSPQITVNRWVIWSISL 363

Query: 374 TVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMGEYDHDLENPFA 433
           TVGVG+GYC+S   SS   ++S          R  D V + +D  +    ++   +N   
Sbjct: 364 TVGVGLGYCISCLLSSTSSTLSVTL-------RSGDEVTIMED--IHNSPHESPFDNYLR 414

Query: 434 HALYLLKQTLKQWNWAMKQFL 454
           H L  +K+ +KQ N + KQ+L
Sbjct: 415 HLLLAVKRAVKQVNSSFKQYL 435

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score =  171 bits (432), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 144/490 (29%), Positives = 217/490 (44%), Gaps = 78/490 (15%)

Query: 28  KKSLLDPHLSVLELLERT---GDTQRVGRGVEKADDMANTTNS------ISSSWQAIHRN 78
           + S+LDPHLSVL+LLER     + Q        +  + + ++S      IS SWQ+I   
Sbjct: 28  RNSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHT 87

Query: 79  DAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPFKLDV 138
           D  I  +    S Q A  GILSSSDTSE+E D   SP+            P    F    
Sbjct: 88  DYSILNLIGETSHQPA--GILSSSDTSEDEPDHFLSPS------------PNEYAFANGA 133

Query: 139 PVILPARDQEPSGQTQTPDND---------DERDDEXXXXXXXXXXXXFVMPKLSLSQKS 189
             + P     P G +     D         ++ D+E            FVMPKLSL+Q  
Sbjct: 134 KTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKLSLAQPL 193

Query: 190 HKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFR-----QFTGILIVFQELKEMV 244
            K  ILI+G+P  +FY+ IP+ YQ  FE+    D   F+     QF+ I+++F + K   
Sbjct: 194 RKFSILIVGKPAQRFYRDIPRAYQKMFEVC---DAESFKTRDVDQFSAIMVIFTDPKNGQ 250

Query: 245 SLLNRVCQCAPTRPVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLNNMYR 304
           SLL  V     +  +I VCQ GQ QQ+ N+             Y   V+S+H D++ + R
Sbjct: 251 SLLEMV--TGRSSNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLR 308

Query: 305 FLLDLSKTISDNSXXXXXXXXXXXXXXXXXXXXXXXXXRAGSYDKTDKPRKRRSKET--K 362
           +L  LS  I                               G      + +  + +ET   
Sbjct: 309 YLYTLSNEIDSE-----------------------YDTEVGPRKVRKRRKSYKKRETPAA 345

Query: 363 INKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMG 422
           +N+W++W ISLTVGVG+GYC+S   SS   +MS +   +      +D + + +++ +   
Sbjct: 346 VNRWVIWSISLTVGVGIGYCISCLLSS---TMSVR--GNTLTLHSSDEIALIEEAPI--S 398

Query: 423 EYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSNR-- 480
            ++  LEN F   +   K+ +KQ + + KQ L  H  LP        K+W +E +     
Sbjct: 399 PHETVLENYFRQLVLAFKKAVKQVSQSFKQCLHGH-SLPVLWMQRIGKDWMSEASDTTLP 457

Query: 481 -VLALGYILL 489
            V AL  +L+
Sbjct: 458 GVTALDLVLI 467

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score =  159 bits (402), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 117/426 (27%), Positives = 185/426 (43%), Gaps = 62/426 (14%)

Query: 4   ASESKIAKQDRVGEVSGVETTAFEKKSLLDPHLSVLELLERTGDTQRVGRGVEKADDMAN 63
           +S +K+A   R G  S          S+LDPH SV+ELL+R  +            ++ +
Sbjct: 12  SSSAKLASTSRNGPES----------SILDPHHSVMELLQRQME----------GSEVPS 51

Query: 64  TTNSISSSWQAIHRNDAMITG---VPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHF 120
            +  +  SWQ I  +D    G     ++ ++ A       +S+  + +I          +
Sbjct: 52  ESGVLGESWQQIRESDVGDGGDSNFDQQSNTSAILSSSSEASEDEDLDIQQQLLGGQQEY 111

Query: 121 TQFH-----------QSQQPPRLPFKLDVPVILPARDQEPSGQTQT-------PDNDDER 162
             FH           Q Q   R          L  +D   SG  +T         + DE 
Sbjct: 112 KNFHMTAEEQLQEQAQGQGFGRPSLLKGTQSRLSEQDSNRSGSVRTIVDKGSCSSSLDEH 171

Query: 163 --------DDEXXXXXXXXXXXXFVMPKLSLSQK-SHKLRILILGRPGLKFYQSIPKRYQ 213
                   D              FVMPKLSL+ K S   ++L++GR   +F+Q IP+ Y+
Sbjct: 172 ELNSIFTSDSMSLTKSTGSSSTSFVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYR 231

Query: 214 HFFELSRLQDPSEFRQFTGILIVFQELKEMVSLLNRVCQCAPTRPVIPVCQTGQHQQVRN 273
            +F +S+  DPSEF+ + GI+IVFQELKE V++LNR+ Q    +P+IP+CQ GQ  +V+N
Sbjct: 232 QYFHISQSSDPSEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKN 291

Query: 274 VXXXXXXXXXXXXXYPPVVISNHSDLNNMYRFLLDLSKTISDNSXXXXXXXXXXXXXXXX 333
           +             YPPV I+N   +  +++  + L   + +                  
Sbjct: 292 ILKSFLKNDAITLWYPPVTIANEKSMEKLFKHTVKLVNKLENEE-----------DVLSL 340

Query: 334 XXXXXXXXXRAGSYDKTDKPRKRRSK-ETKINKWIVWGISLTVGVGVGYCMSYFASSGLI 392
                        Y K ++ +K   K  T  +KWI WGISLT+GV +GY  +Y  ++ L+
Sbjct: 341 STSDKSLSDETSGYRKNNRRKKHGGKPSTNYSKWITWGISLTIGVSIGYYATYMITTTLL 400

Query: 393 SMSAKS 398
              A+S
Sbjct: 401 YGKAES 406

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score =  158 bits (400), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 155/546 (28%), Positives = 235/546 (43%), Gaps = 90/546 (16%)

Query: 23  TTAFEKKSLLDPHLSVLELLER-----------TGDTQRVGRGVEKADDMANTTNS---- 67
            T     S+LDPHLSVLELLER              T      VE A    N+  S    
Sbjct: 22  VTTIITNSILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVST 81

Query: 68  ------ISSSWQAIHRND--AMITGVPERCSSQAAAVGILSSS---------DTSEEEID 110
                 IS SW  I R D    +     +   Q+A  GILSSS         D + ++  
Sbjct: 82  PSVGDIISQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDINGKKNS 141

Query: 111 PA-------SSPNVAHFTQFHQS--QQPPRLPFKLDVPVILPARD---QEPSGQTQTPDN 158
           P          P +      H +  ++    P K D   I    D   + PS    TPD 
Sbjct: 142 PLHLQPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDKICTVSDLNRRVPSNNAMTPDT 201

Query: 159 DDER---DDEXXXXXXXXXXXXFVMPKLSLSQK------SHKLRILILGRPGLKFYQSIP 209
           ++E    D              F+MP+LSL++K      +++ RILI+GR   K ++ IP
Sbjct: 202 EEEEEGEDYMTASKSLTSSSTSFIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIP 261

Query: 210 KRYQHFFELSRLQDPSEFRQFTGILIVFQELKEMVSLLNRVCQCAPT-RPVIPVCQTGQH 268
            ++Q+ F+L +  D +E+++FT IL+V QE +E++SLLNR+ +     RP+I +C+    
Sbjct: 262 HKFQNLFQLQKSYDINEYQKFTAILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAF 321

Query: 269 QQVRNVXXXXXXXXXXXXXYPPVVISNHSDLNNMYRFLLDLSKTISDNSXX-XXXXXXXX 327
            Q +NV             Y P VISN  +L+ M  FL + S    + +           
Sbjct: 322 LQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETSIKFYEQAYNPKIQIKEKV 381

Query: 328 XXXXXXXXXXXXXXXRAGSYDKTDKPRK----------------RRSKET-KINKWIVWG 370
                           +    K DK R                 R+ KE  + NKWI+WG
Sbjct: 382 PNDGNRNAPTSSDLTLSKDRVKNDKHRHTKGDGSGGSKKGNEHDRKPKENEEYNKWIIWG 441

Query: 371 ISLTVGVGVGYCMSYFAS---SGLISMSAKSIASINGCRP----NDNVVVFDDSSLGMGE 423
           ISL++GVG+GYC+SYF S   S L+        SI+   P    N++ V+  DS     +
Sbjct: 442 ISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATVPVPLSNESFVLLHDS-----D 496

Query: 424 YDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSNRVLA 483
            D + +  F  ++  LK ++ +    +K  + K L+      + +Y      D+++ +LA
Sbjct: 497 NDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLN------AFSYLNGLNTDDASSLLA 550

Query: 484 LGYILL 489
           LGYIL+
Sbjct: 551 LGYILI 556

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  155 bits (391), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 142/486 (29%), Positives = 214/486 (44%), Gaps = 74/486 (15%)

Query: 28  KKSLLDPHLSVLELLE------------RTGDTQRVGRGVEKADDMANTTNSISSSWQAI 75
           ++S+LDPHLSVLE+LE             +G ++  G+  E    + +   SIS SWQ+I
Sbjct: 24  QRSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHH---SISESWQSI 80

Query: 76  HRNDAMITGVPERCS-SQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPF 134
              D +        S  Q +AVGILSSSDTSEEE D             H S  PP    
Sbjct: 81  KSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQD------------IHPSPPPPNSAS 128

Query: 135 KLDVPVILPARDQEPSGQTQTPDNDDERDD-EXXXXXXXXXXXXFVMPKLSLSQKSHKLR 193
                 I+    Q  S       ++DE DD E             VMPKLSLS +  + +
Sbjct: 129 SAFDSRIINIAGQAFSATLSHLRSEDEDDDGETVTVSLPNTMTSLVMPKLSLSDRIIESK 188

Query: 194 ILILGRPGLKFYQSIPKRYQHFFE---LSRLQDPSEFRQFTGILIVFQELKEMVSLLNRV 250
           +LI+G+P  KF+ SIPK YQ  FE   LS L+D     +++ I+++F ++     LL+R+
Sbjct: 189 VLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGLAPELLDRI 248

Query: 251 CQCAPTRPVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLNNMYRFLLDLS 310
           C       +IP+CQ GQ Q + ++               P+V+SNH + + + + L  LS
Sbjct: 249 CNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNHHEKHRLLKHLHQLS 308

Query: 311 KTISDNSXXXXXXXXXXXXXXXXXXXXXXXXXRAGSYDKTDKPRKRRSKETKINKWIVWG 370
              SD+                                   K +KR SK +    W+VW 
Sbjct: 309 SG-SDSGYETEVTVEPVKKLPR-------------------KAKKRPSKPSTFRDWVVWT 348

Query: 371 ISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMGEYDHDLEN 430
            S+T+G+G+G C+S   S+    +  + +A        D++     S  G  +  H+L  
Sbjct: 349 ASITIGIGIGCCVSLMVSTRYAFLVPRQLAV-------DDITSSPLSPEGTDKSSHNL-- 399

Query: 431 PFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAE---DNS----NRVLA 483
            F HA  L K +LK+   +++ F    L      S T     G E   D+S     R++ 
Sbjct: 400 -FLHAYSLCKTSLKKLASSLRPFFSDRLE-----SCTWIHTLGIELSYDDSLISMGRIMP 453

Query: 484 LGYILL 489
           L +I+L
Sbjct: 454 LDFIML 459

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score =  147 bits (372), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 128/488 (26%), Positives = 212/488 (43%), Gaps = 87/488 (17%)

Query: 27  EKKSLLDPHLSVLELLERT----------GDTQRVG-RGVEKADDMANTTNSISSSWQAI 75
           + K +LDPHLSVLE+L+R           G    VG R VE+     +  +SIS SWQAI
Sbjct: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVER-----SLHHSISESWQAI 81

Query: 76  HRNDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPFK 135
            R+D           +  ++VGILSSSDTSEEE +   S   AH T              
Sbjct: 82  KRSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEMRPS---AHGT-------------- 124

Query: 136 LDVPVILPARDQEPSGQTQTPDND---DERDDEXXXXXXXXXXXXFVMPKLSLSQKSHKL 192
               V L +    P  Q    +++   +E D +             VMPKLSLSQ+  + 
Sbjct: 125 ----VHLGSSLASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEP 180

Query: 193 RILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEF---RQFTGILIVFQELKEMVSLLNR 249
           ++L++G+P  KF+ +IPK YQ  F++  L   + +   +++  +++VF ++ +   LL+ 
Sbjct: 181 QLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDG 240

Query: 250 VCQCAPTRPVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLNNMYRFLLDL 309
           +C+ AP   VIPVCQ GQ   +  +               P+++SNH + + + + L +L
Sbjct: 241 LCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEKHRLLKHLHNL 300

Query: 310 SKTISDNSXXXXXXXXXXXXXXXXXXXXXXXXXRAGSYDKTDKPRKRRSKETKINKWIVW 369
                                               S  +  +PRK+ +    +  W +W
Sbjct: 301 CNESESGYETELT---------------------VKSKKQHRRPRKKDAGPVALRHWAIW 339

Query: 370 GISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFD-DSSLGMGEYDHDL 428
             S T+G+G+G C+S  A++     S+  +       P   V+     SS+   +  H L
Sbjct: 340 TASFTIGIGIGCCISLMATTRFTFFSSAPL-------PLTAVIPAQIPSSVASDKPPHRL 392

Query: 429 ENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSN-------RV 481
                H   L K T++Q   +++ F  +        S T    +G + +S+       R+
Sbjct: 393 ---VPHFYMLCKTTIRQLGTSLRLFFFEKF-----ESRTWVHIFGMDLHSDDPLASLGRL 444

Query: 482 LALGYILL 489
           + L +I+L
Sbjct: 445 MPLDFIML 452

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score =  146 bits (369), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 130/484 (26%), Positives = 210/484 (43%), Gaps = 70/484 (14%)

Query: 30  SLLDPHLSVLELLERTGDTQRVGRGVEKADDMANTTNSISSSWQAIHRNDAMITGVPERC 89
           S+LDPHLSVLELLE++ +          + +       +S SW  + R++       ER 
Sbjct: 7   SVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQLSESWCTVERDE---LSAMERS 63

Query: 90  SSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPFKLDVPVILPARDQEP 149
           +SQ    G+LSSSDTSEE  +P                         D  +  PA   + 
Sbjct: 64  ASQQTNNGVLSSSDTSEEG-EPEQGSPGDGEGGG-----------VADTRMARPAMSLQS 111

Query: 150 SGQTQTPDNDDERDDEXXXXXXXXXXXXFVMPKL-----------SLSQKSHKLRILILG 198
           +  T    +DD                 F+MPKL           S + ++   ++ +LG
Sbjct: 112 TSSTLDGVDDDS---ATVSKSLTSSSNSFIMPKLYTTVAGAPSTVSTALQTRCFKVAVLG 168

Query: 199 RPGLKFYQ-SIPKRYQHFFELSR-LQDPSEFRQFTGILIVFQELKEMVSLLNRV-CQCAP 255
           R  +KF Q ++P++++H FEL+  + D ++     GILIV QE++E++SLLNRV C C P
Sbjct: 169 RGAVKFCQETVPEQFRHRFELTAGVHDLAQCADRQGILIVVQEVRELISLLNRVHCAC-P 227

Query: 256 TRPVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLNNMYRFLLDLSKTISD 315
             PV+ V    +  QV+NV             +PPV +SN+  L+ M+ F+ +L++    
Sbjct: 228 EVPVVAVYDRDRQVQVKNVLRNFTRQRLVSLLHPPVPLSNNEALDKMFHFVDNLAR---- 283

Query: 316 NSXXXXXXXXXXXXXXXXXXXXXXXXXRAGSYDKTDKPRKRRSKETKINKWIVWGISLTV 375
                                      +   +++ D  R     E    +W++WG+S+++
Sbjct: 284 ----------QQEPAGVIHNDPQTTQEQHPDHNEDDPHRGPSKPEGTFKRWLLWGVSISL 333

Query: 376 GVGVG-YCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMG---------EYD 425
           G+G G YC+SY  SS +         S    R  D+ +    S+             ++D
Sbjct: 334 GIGAGYYCVSYVVSSSM-------CVSCFNFRHTDHTLAATTSTAAAAAAAATPSGIDHD 386

Query: 426 HDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSNRVLALG 485
            D      H L ++K +LK+    +KQ + K  H  + S     +EW   D  NR L LG
Sbjct: 387 ADSHTTLRHCLSIVKNSLKRATAFVKQAMHKPFHYIDRS-----QEWHLHD-PNRFLQLG 440

Query: 486 YILL 489
           Y ++
Sbjct: 441 YAVI 444

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score =  130 bits (328), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 147/511 (28%), Positives = 222/511 (43%), Gaps = 86/511 (16%)

Query: 29  KSLLDPHLSVLELLERTGDTQRVGRGVEKADDMANTTNSISSSWQAIHR---NDAMITGV 85
           KSLLDPHLSVLE+LER  +           D +   ++ IS SWQ I     +  +++  
Sbjct: 36  KSLLDPHLSVLEMLERKDN-----------DTVMEASSRISRSWQNIESPADSKQLLSAK 84

Query: 86  PERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPFKLDVPVILPAR 145
             + S+  + +   SSSDTS+EE+D  +S N A       S +    P  L  P+ LP  
Sbjct: 85  SSQVSNLVSILS--SSSDTSDEEVDRINSLNSAG----EGSSKNYNNPSPLQNPIYLPEF 138

Query: 146 DQEPSGQTQTPDNDD--ERDDEXXXXXXXXXXXXFVMP---KLSLSQKSHKLRILILGRP 200
               +G     DNDD                   FVMP     S   +  K +ILI GR 
Sbjct: 139 TDVTAG-----DNDDGIASTITKSLTSSSTISNSFVMPTLSLSSSQSQQRKFQILIFGRL 193

Query: 201 GLKFYQSIPKRYQHFF----ELSRLQDPSEFRQFTGILIVFQELKEMVSLLNRVCQCAPT 256
           G  FY++IPK+YQ+ F    +L+ L   +E   FT  LI+F+ELKE+VSLLNR+ +    
Sbjct: 194 GPSFYRTIPKQYQYLFHVPNQLNTLTR-NEMDNFTAFLIIFEELKELVSLLNRISEELSF 252

Query: 257 RPVIPV----CQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISNHSDLNNMYRFLLDLSKT 312
           + V P     CQ GQ  +V+++              P ++I++        R LL + KT
Sbjct: 253 KKVPPPIIPICQPGQKIKVKSILKYFLKNNFVTLLSPIIIINDE-------RALLKMFKT 305

Query: 313 ISDNSXXXXXXXXXXXXXXXXXXXXXXXXXRAGSYD-KTDKPRKR--------------- 356
           +   S                              D KT K                   
Sbjct: 306 MQSISKTVISASSSTTSSDNEEEESSDPSMNDKVIDVKTIKESMMSSQKKKNKKKHHNNR 365

Query: 357 -----RSKETKI--NKWIVWGISLTVGVGVGYCMSY--FASSGLISMSAKS-------IA 400
                RS  T    NKW+VW ISLTVG G+GY +SY  F SS  + +   +       ++
Sbjct: 366 RKEHVRSSSTSFFKNKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTRPGPLS 425

Query: 401 SINGCRPNDNVVVFDDSSLGMGEYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHL 460
           S+   + N N++  + ++     + +     F +     K+T+ Q N   K+ + K   +
Sbjct: 426 SLIHLKSNKNLLYLERTTPNDYSWSY-----FQNTWEFCKETVNQLNSTFKKIIRKPFAM 480

Query: 461 PES--SSSTNYKEWGAEDNSNRVLALGYILL 489
            E+  +++ N K+W   D  +R+LAL Y+LL
Sbjct: 481 FENLITTTINSKDWKF-DEQDRILALCYLLL 510

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score =  118 bits (295), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 120/487 (24%), Positives = 197/487 (40%), Gaps = 87/487 (17%)

Query: 27  EKKSLLDPHLSVLELLERTGDTQRVGRGVEKAD--------------DMANTTNS--ISS 70
           ++ S+LDPH SV++LL          R ++  D              D+   T+S  ++ 
Sbjct: 37  QRHSILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTD 96

Query: 71  SWQAIHRNDAMITGVPERCSSQAAAVGILS-------SSDTSEEE--IDPASSPNVAHFT 121
           SWQAI R++          +    + G  +       SSDTSEEE  I+ A SPN++   
Sbjct: 97  SWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQ 156

Query: 122 QFHQSQQPPRLPFKL-----DVPVILPARDQEPSGQTQTPD--------NDDERDDEXXX 168
           Q +Q    P               +    D +P   T+T             E +     
Sbjct: 157 QHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVN 216

Query: 169 XXXXXXXXXFVMPKLSLSQKSHKLRILIL--GRPGLKFYQSIPKRYQHFFELSRLQDPS- 225
                    FVMPKLSLS+   + +ILIL  G     FY  + + ++  F++ +L + S 
Sbjct: 217 LGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASK 276

Query: 226 -EFRQFTGILIVFQELKEMVSLLNRVCQCAPTRPVIPVCQTGQHQQVRNVXXXXXXXXXX 284
            E  ++T  +I+F + K++ ++LNR+ +      +IP+CQ GQ Q V             
Sbjct: 277 EEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNKI 336

Query: 285 XXXYPPVVISNHSDLNNMYRFLLDLSKTISDNSXXXXXXXXXXXXXXXXXXXXXXXXXRA 344
                PVVIS+H +++ + R L  L   +  +                            
Sbjct: 337 KLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYET------------------------- 371

Query: 345 GSYDKTDKPRKRRSKETK---INKWIVWGISLTVGVGVGYCMSYF----------ASSGL 391
               K  KPRK   K+       +W  W IS+ +GVG+G C++++          +S G+
Sbjct: 372 -DIPKKTKPRKGAKKKPAPHLAKRWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGV 430

Query: 392 ISMSAKSIASINGCRPNDNVVVFDDSSLGMGEYDHDLENPFAHALYLLKQTLKQWNWAMK 451
           I  + K I +I      ++  + ++SS         + +       L+K T  Q N  +K
Sbjct: 431 IQTADKEIDAIVDAIEGNSPSILEESS------PQSISDFLGQVCKLVKDTAIQINELLK 484

Query: 452 QFLMKHL 458
           QFL  HL
Sbjct: 485 QFLSAHL 491

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score =  105 bits (262), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 78/138 (56%), Gaps = 2/138 (1%)

Query: 178 FVMPKLSLSQKSHKLRILILG-RPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIV 236
           F+MPKLS +    K RILILG    L FYQ+IP  Y++ FEL        F+ + GI IV
Sbjct: 336 FIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPNNFDYNFKHYAGIAIV 395

Query: 237 FQELKEMVSLLNRVCQCAPTR-PVIPVCQTGQHQQVRNVXXXXXXXXXXXXXYPPVVISN 295
             +L +  S+LN++ + +  + P+IP+C+ GQ  +V+N+             YPP+V +N
Sbjct: 396 IHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIKTKDLSLLYPPIVGTN 455

Query: 296 HSDLNNMYRFLLDLSKTI 313
              +N +Y  L DLSK +
Sbjct: 456 RDGMNTLYLHLNDLSKNV 473

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 70/145 (48%), Gaps = 21/145 (14%)

Query: 362 KINKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDD----- 416
           K+ K I W +SL+VGVG+G+C+SY+AS+   ++S      IN            D     
Sbjct: 609 KLKKIIYWTVSLSVGVGLGFCLSYYASTIFSNISESISKGINTLISESVTPTVSDTPIPS 668

Query: 417 -SSLGMGE--------YDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSST 467
            ++  M E            ++  F+++L+LLK TL+  NW  KQ      + P+  +  
Sbjct: 669 PTTYSMEENLSTTCHYVGEKVKETFSNSLFLLKTTLRNLNWTTKQI----WNSPQGLNGV 724

Query: 468 NY---KEWGAEDNSNRVLALGYILL 489
           +     ++   ++   +LALG++LL
Sbjct: 725 DQILPSKYNFYEDPAMILALGFVLL 749

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 48/123 (39%), Gaps = 35/123 (28%)

Query: 26  FEKKSLLDPHLSVLELLERT------GDTQRVGRGVEKADDMANTTNSI----------- 68
           ++K+  LDPH S++ELLE           +     V + D+  +  N I           
Sbjct: 22  YDKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQPDNPTSPLNEIRLELSGMNVDD 81

Query: 69  ---------------SSSWQAIHRNDAMITGVPERCSSQAA---AVGILSSSDTSEEEID 110
                          S+SWQ I   D     V +  S        VGILSS+D+SEEE D
Sbjct: 82  INSENQESSELSQSLSNSWQRIQTPDYSPLDVKDSNSINNINNNTVGILSSTDSSEEEQD 141

Query: 111 PAS 113
             S
Sbjct: 142 NIS 144

>Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON}
           (199741..200976) [1236 nt, 412 aa]
          Length = 411

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 67/127 (52%), Gaps = 22/127 (17%)

Query: 365 KW--IVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMG 422
           KW  + +GIS+T+GVGVGYC+    SS ++S ++  I SI    PN++++  +   L   
Sbjct: 305 KWLFVYYGISITLGVGVGYCI----SSLVVSQNSNDIQSIVPSTPNNDIIALESQDLNSH 360

Query: 423 EYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSNRVL 482
             D        +    LK ++K     +K+F+         ++S N  E+   ++SN+++
Sbjct: 361 NGDD-------YNWNFLKLSIKNVYSILKRFI---------TTSINLLEYKTLNDSNKII 404

Query: 483 ALGYILL 489
           A+ Y+LL
Sbjct: 405 AMSYVLL 411

>TBLA0B08190 Chr2 complement(1954681..1955820) [1140 bp, 379 aa]
           {ON}  frameshift location uncertain
          Length = 379

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 431 PFAHALYLLKQTLKQWNWAMKQFLMKH 457
           P   ALY LKQ+ K WN  +++F+  H
Sbjct: 350 PLKKALYGLKQSPKNWNGTLREFMNSH 376

>TPHA0O01190 Chr15 (230494..232602) [2109 bp, 702 aa] {ON} 
          Length = 702

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 424 YDHDLENPFAHALYLLKQTLKQWNWAMKQFL 454
           +D     P   ALY LKQ+ K+WN  +K+FL
Sbjct: 289 HDRRFVTPLKKALYGLKQSPKEWNEHLKKFL 319

>TPHA0B03640 Chr2 complement(851392..854469) [3078 bp, 1025 aa] {ON}
           
          Length = 1025

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 424 YDHDLENPFAHALYLLKQTLKQWNWAMKQFL 454
           +D     P   ALY LKQ+ K+WN  +K+FL
Sbjct: 612 HDRRFVTPLKKALYGLKQSPKEWNEHLKKFL 642

>TPHA0K02100 Chr11 (449107..454023) [4917 bp, 1638 aa] {ON} 
          Length = 1638

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 424  YDHDLENPFAHALYLLKQTLKQWNWAMKQFL 454
            +D     P   ALY LKQ+ K+WN  +K+FL
Sbjct: 1225 HDRRFVTPLKKALYGLKQSPKEWNEHLKKFL 1255

>TPHA0P01400 Chr16 complement(285031..289965) [4935 bp, 1644 aa] {ON} 
          Length = 1644

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 424  YDHDLENPFAHALYLLKQTLKQWNWAMKQFL 454
            +D     P   ALY LKQ+ K+WN  +K+FL
Sbjct: 1247 HDRRFVTPLKKALYGLKQSPKEWNEHLKKFL 1277

>TPHA0I02520 Chr9 (556711..561240) [4530 bp, 1509 aa] {ON} 
          Length = 1509

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 424  YDHDLENPFAHALYLLKQTLKQWNWAMKQFL 454
            +D     P   ALY LKQ+ K+WN  +K+FL
Sbjct: 1192 HDRRFVTPLKKALYGLKQSPKEWNEHLKKFL 1222

>TPHA0L01530 Chr12 (320935..325509) [4575 bp, 1524 aa] {ON} 
          Length = 1524

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 424  YDHDLENPFAHALYLLKQTLKQWNWAMKQFL 454
            +D     P   ALY LKQ+ K+WN  +K+FL
Sbjct: 1225 HDRRFVTPLKKALYGLKQSPKEWNEHLKKFL 1255

>TPHA0G01020 Chr7 complement(201378..205652) [4275 bp, 1424 aa] {ON} 
          Length = 1424

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 424  YDHDLENPFAHALYLLKQTLKQWNWAMKQFL 454
            +D     P   ALY LKQ+ K+WN  +K+FL
Sbjct: 1145 HDRRFVTPLKKALYGLKQSPKEWNEHLKKFL 1175

>TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON} 
          Length = 470

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 72/190 (37%), Gaps = 63/190 (33%)

Query: 27  EKKSLLDPHLSVLELLERTGDTQRVGRGVEKADDMANTTNS---------ISSSWQAIHR 77
           E++S+++PH SVL+LLE       +G     A+ ++N+TN+         +S SWQ +  
Sbjct: 13  ERRSVIEPHYSVLDLLE-----ANMGGPPPSANVISNSTNTQNDWNAIIDLSDSWQILSS 67

Query: 78  NDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPFKLD 137
           +            +     G L  S  +   I  +++   +H + F QS           
Sbjct: 68  SSENSEEEDIEVRN-----GTLGRSRNANMSIHASTTSAYSH-SYFDQS----------- 110

Query: 138 VPVILPARDQEPSGQTQTPDNDDERDDEXXXXXXXXXXXXFVMPKLSLSQKSHKLR-ILI 196
                 A D   S Q                         FVMP+LS S+K   L+ I +
Sbjct: 111 ------ASDTSSSNQ-------------------------FVMPRLSYSKKEGSLKAISV 139

Query: 197 LGRPGLKFYQ 206
           +G     FYQ
Sbjct: 140 VGSHADSFYQ 149

>SAKL0F13728g Chr6 complement(1097746..1098930) [1185 bp, 394 aa]
           {ON} similar to uniprot|P47127 Saccharomyces cerevisiae
           YJR080C FMP26 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 394

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 40/102 (39%), Gaps = 9/102 (8%)

Query: 32  LDPHLSVLELLERTGDTQRVGRGVEKADDMANTTNSISSSWQAI-HRNDAMITGVPERCS 90
           L P L    + +   D + V    +  + +A TTNSI  SW  + HR  A I G  +   
Sbjct: 254 LTPPLEKKSVKDEKKDEENVSGEFDFKEFVAITTNSIVKSWNFLKHRYTAFINGPTKHLK 313

Query: 91  SQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRL 132
            +     ++ SS        P S P        H SQ PP +
Sbjct: 314 IKGPRTLLVQSSHNVYLPATPFSRP--------HVSQSPPLI 347

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,479,544
Number of extensions: 1883174
Number of successful extensions: 6530
Number of sequences better than 10.0: 40
Number of HSP's gapped: 6631
Number of HSP's successfully gapped: 53
Length of query: 489
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 375
Effective length of database: 40,409,475
Effective search space: 15153553125
Effective search space used: 15153553125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)