Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B022105.700ON1095109546570.0
ZYRO0G06644g5.700ON116688625730.0
KLTH0E01100g5.700ON1177116425600.0
Suva_9.415.700ON121993023660.0
Kwal_55.197075.700ON114391322850.0
CAGL0H06567g5.700ON116987622850.0
SAKL0E14872g5.700ON114090622280.0
Kpol_2001.745.700ON111389222240.0
KLLA0A00638g5.700ON115592621900.0
TPHA0E002505.700ON106888519120.0
Kpol_1043.685.700ON104285818900.0
AFR284W5.700ON110390717960.0
YIL147C (SLN1)5.700ON122046613481e-166
Smik_9.225.700ON123046513431e-165
Skud_9.215.700ON122146413251e-162
NDAI0F003105.700ON125945212971e-158
TBLA0I016805.700ON121442712761e-155
TPHA0D045905.700ON112745212641e-154
NCAS0G002505.700ON118345712561e-153
KNAG0L021105.700ON120043512501e-152
KAFR0D022405.700ON118744212271e-149
Ecym_40205.700ON112542912201e-148
TBLA0E021005.700ON11404349331e-107
ADL388W4.385ON4821251843e-13
Ecym_74744.385ON4961251816e-13
KNAG0M001804.385ON6151331801e-12
CAGL0F09097g4.385ON6301321782e-12
KAFR0B069904.385ON5451251763e-12
SAKL0B12408g4.385ON4651251753e-12
NCAS0A064504.385ON6091331755e-12
TDEL0D003204.385ON5471331683e-11
KLTH0D17182g4.385ON4641251673e-11
KLLA0A10219g4.385ON4751251673e-11
Smik_8.2964.385ON6251331674e-11
YHR206W (SKN7)4.385ON6221331674e-11
ZYRO0G00484g4.385ON6471331674e-11
NDAI0D034304.385ON5971221674e-11
Suva_15.4124.385ON6171331665e-11
Skud_8.2734.385ON6231331665e-11
Kpol_265.24.385ON5491331631e-10
Kwal_47.167704.385ON4611251584e-10
TBLA0A107004.385ON5871251575e-10
TPHA0C001504.385ON5101251551e-09
Ecym_50775.230ON7951481496e-09
Suva_10.845.230ON6951471462e-08
KAFR0J007005.230ON6201261443e-08
KNAG0B051405.230ON6481271381e-07
YLR006C (SSK1)5.230ON7121471335e-07
Skud_12.725.230ON7021471301e-06
TDEL0E039805.230ON7301291301e-06
KLTH0B02684g5.230ON5951421291e-06
Smik_12.685.230ON7121471292e-06
NCAS0D029005.230ON7621391292e-06
Kpol_1004.45.230ON7141501254e-06
ADR343C5.230ON7491481245e-06
ZYRO0A11154g5.230ON7761461247e-06
CAGL0D02882g5.230ON6671471229e-06
Kwal_33.152885.230ON5871431201e-05
NDAI0I020005.230ON8901441211e-05
TPHA0N008505.230ON6701481192e-05
TBLA0D031705.230ON7651501174e-05
KLLA0E09505g5.230ON635721174e-05
SAKL0G12100g5.230ON738711040.001
KLLA0E04533g7.222ON42181890.062
TBLA0B015507.222ON39487830.33
TDEL0H022307.222ON430111820.45
SAKL0F08184g7.222ON41281800.71
TBLA0E049804.385ON79175781.5
Klac_YGOB_Anc_8.348.34ON157178781.6
TBLA0G034508.34ON197281781.7
CAGL0K12562g8.34ON1682128753.6
Ecym_43787.222ON44381743.9
Kpol_1037.206.31ON70452744.4
YFL033C (RIM15)8.34ON177090754.5
Ecym_74263.304ON76472745.3
NCAS0I014003.304ON75872745.3
KAFR0C002903.304ON76072745.5
NDAI0A076003.304ON76072736.3
Kpol_1023.266.31ON73954736.4
YMR001C (CDC5)6.31ON70564737.0
ZYRO0B07304g4.227ON34253727.1
KNAG0D017507.222ON40996727.3
Skud_13.1546.31ON70564727.4
KNAG0J023203.304ON75872727.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02210
         (1095 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...  1798   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...   995   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   990   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   915   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...   884   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   884   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...   862   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   861   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   848   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   741   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   732   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   696   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   523   e-166
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   521   e-165
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   514   e-162
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   504   e-158
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   496   e-155
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   491   e-154
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   488   e-153
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   486   e-152
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   477   e-149
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   474   e-148
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   363   e-107
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    75   3e-13
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    74   6e-13
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    74   1e-12
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    73   2e-12
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    72   3e-12
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    72   3e-12
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    72   5e-12
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    69   3e-11
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    69   3e-11
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    69   3e-11
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    69   4e-11
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    69   4e-11
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    69   4e-11
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     69   4e-11
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    69   5e-11
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    69   5e-11
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    67   1e-10
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    65   4e-10
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    65   5e-10
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    64   1e-09
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    62   6e-09
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    61   2e-08
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    60   3e-08
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    58   1e-07
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    56   5e-07
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    55   1e-06
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    55   1e-06
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    54   1e-06
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    54   2e-06
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    54   2e-06
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    53   4e-06
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    52   5e-06
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    52   7e-06
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    52   9e-06
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    51   1e-05
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    51   1e-05
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    50   2e-05
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    50   4e-05
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    50   4e-05
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    45   0.001
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    39   0.062
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    37   0.33 
TDEL0H02230 Chr8 complement(375714..377006) [1293 bp, 430 aa] {O...    36   0.45 
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    35   0.71 
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    35   1.5  
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    35   1.6  
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    35   1.7  
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    33   3.6  
Ecym_4378 Chr4 (798444..799775) [1332 bp, 443 aa] {ON} similar t...    33   3.9  
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    33   4.4  
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    33   4.5  
Ecym_7426 Chr7 complement(873420..875714) [2295 bp, 764 aa] {ON}...    33   5.3  
NCAS0I01400 Chr9 (256606..258882) [2277 bp, 758 aa] {ON} Anc_3.304     33   5.3  
KAFR0C00290 Chr3 (54829..57111) [2283 bp, 760 aa] {ON} Anc_3.304...    33   5.5  
NDAI0A07600 Chr1 complement(1741778..1744060) [2283 bp, 760 aa] ...    33   6.3  
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    33   6.4  
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    33   7.0  
ZYRO0B07304g Chr2 (574633..575661) [1029 bp, 342 aa] {ON} highly...    32   7.1  
KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {O...    32   7.3  
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    32   7.4  
KNAG0J02320 Chr10 complement(431036..433312) [2277 bp, 758 aa] {...    32   7.9  

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score = 1798 bits (4657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 900/1095 (82%), Positives = 900/1095 (82%)

Query: 1    MRLGTIAKEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYV 60
            MRLGTIAKEKFSPPFRISIRTQ                   TGVYFTSNYKSLRSERLYV
Sbjct: 1    MRLGTIAKEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYV 60

Query: 61   AAQLKSSQIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXX 120
            AAQLKSSQIDQNLNYLYYQCYW           ANYVSGNKTDANWVD            
Sbjct: 61   AAQLKSSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSS 120

Query: 121  ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL 180
            ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL
Sbjct: 121  ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL 180

Query: 181  NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI 240
            NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI
Sbjct: 181  NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI 240

Query: 241  YKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSA 300
            YKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSA
Sbjct: 241  YKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSA 300

Query: 301  VGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQP 360
            VGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTK          AFVCIATFPLAHWAVQP
Sbjct: 301  VGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQP 360

Query: 361  IVRLQKATEIITEGRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLADEKGAVGRAS 420
            IVRLQKATEIITEGRGL                               LADEKGAVGRAS
Sbjct: 361  IVRLQKATEIITEGRGLRSGTPGSSSVSRNSSFIRRRFSGSSSVRSPSLADEKGAVGRAS 420

Query: 421  TEGSFNYDQAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTM 480
            TEGSFNYDQAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTM
Sbjct: 421  TEGSFNYDQAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTM 480

Query: 481  TNALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAI 540
            TNALDQHYALLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAI
Sbjct: 481  TNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANISHELRTPLNGILGMTAI 540

Query: 541  SMEERDIDKIQSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVAVQIKS 600
            SMEERDIDKIQSSLKLIFRSG            FSKNVLQRTKLEKRDFSITDVAVQIKS
Sbjct: 541  SMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFSITDVAVQIKS 600

Query: 601  IFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMR 660
            IFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMR
Sbjct: 601  IFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMR 660

Query: 661  LLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQEDLEKEKISEKHNEEEAS 720
            LLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQEDLEKEKISEKHNEEEAS
Sbjct: 661  LLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQEDLEKEKISEKHNEEEAS 720

Query: 721  TSDSEKTNLDDKTPDSKRSDADDQVXXXXXXXXXXXXXXFHTQFKKHTSSSGDENGHLLE 780
            TSDSEKTNLDDKTPDSKRSDADDQV              FHTQFKKHTSSSGDENGHLLE
Sbjct: 721  TSDSEKTNLDDKTPDSKRSDADDQVSLISISTSSYDDTIFHTQFKKHTSSSGDENGHLLE 780

Query: 781  HPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNG 840
            HPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNG
Sbjct: 781  HPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNG 840

Query: 841  TMKLDSKLGVGSKFTFTLPLTQTRXXXXXXXXXXXXXXXPLSXXXXXXXXXXXXXXXXXX 900
            TMKLDSKLGVGSKFTFTLPLTQTR               PLS                  
Sbjct: 841  TMKLDSKLGVGSKFTFTLPLTQTREIEFEDENAFEDEFNPLSKKNRKVKFKVAKSIKSRK 900

Query: 901  XXXXXXXXXXXXXXXXXXXXXXXXXESEFSVGNVSLDRPFLQSTGTAXXXXXXXXXXXXX 960
                                     ESEFSVGNVSLDRPFLQSTGTA             
Sbjct: 901  SKSSLSNSSGKGGSSDKSSKQLKGSESEFSVGNVSLDRPFLQSTGTASSSKNVTVVSNVN 960

Query: 961  XXYRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDV 1020
              YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDV
Sbjct: 961  KSYRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDV 1020

Query: 1021 QMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTI 1080
            QMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTI
Sbjct: 1021 QMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTI 1080

Query: 1081 IAQYCHDDSKVVDKE 1095
            IAQYCHDDSKVVDKE
Sbjct: 1081 IAQYCHDDSKVVDKE 1095

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1166

 Score =  995 bits (2573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/886 (58%), Positives = 604/886 (68%), Gaps = 38/886 (4%)

Query: 10  KFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLKSSQI 69
           KF  P R+ IR Q                   TGVYFT NYK+LRSERLY+AAQLKS+QI
Sbjct: 10  KFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQI 69

Query: 70  DQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSVARVY 129
           DQNLNY+YYQCYW           ANYV+GNKT ANWVD             LFSVA +Y
Sbjct: 70  DQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIY 129

Query: 130 DADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSM 189
           DA F  VL+ATNNGTG+ + +  L +LMPLS N  LP+SL+SEG+LT+PVLNGTSYLMSM
Sbjct: 130 DATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSM 189

Query: 190 SLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGLGS 249
           SLPI+ANPSIILT S VYGY+TI+MSADSLK+V+DD TALEKS+V I+SA+Y +++ L S
Sbjct: 190 SLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSS 249

Query: 250 YRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFK 309
           Y FVFAP G    IL ET PI N +FLS+ALRQGK G+ +RT   Y +  AVGYSPCS  
Sbjct: 250 YNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVV 309

Query: 310 FVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVRLQKATE 369
           FVNW+A++ QSEAVFMEP+T+LTK           FVC+ TFPLAHWAV+PIVRLQKATE
Sbjct: 310 FVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATE 369

Query: 370 IITEGRGLXXXXXXXXXXXXXXXXX------------XXXXXXXXXXXXXXLADEKGAVG 417
           +ITEGRGL                                           L  E+   G
Sbjct: 370 LITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHDLHGEQIQHG 429

Query: 418 RASTEGSFNYDQAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTF 477
             +  GS N+  A    +S  E  SD+++   TS+NL+EARVPVYR FFSDE SELTDTF
Sbjct: 430 FFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTF 489

Query: 478 NTMTNALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGM 537
           NTMT+ALDQHYALLEDRVRART+QL             KTVFIANISHELRTPLNGILGM
Sbjct: 490 NTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAANEAKTVFIANISHELRTPLNGILGM 549

Query: 538 TAISMEERDIDKIQSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVAVQ 597
           TAISMEERDIDKIQ+SLKLIFRSG            FSKNVL+RTKLEKR+FS+TDVA+Q
Sbjct: 550 TAISMEERDIDKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFSVTDVALQ 609

Query: 598 IKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSV 657
           IKSIFGKVAKDQRV+ SITL+PN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDGKV+V
Sbjct: 610 IKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNV 669

Query: 658 RMRLLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQEDLEKEKISEKHNEE 717
            M LLGEYD +RSENE+ K VYVI GTEP+ +        + +K    EKE+ S ++   
Sbjct: 670 YMSLLGEYDAERSENENHKKVYVIPGTEPKGN-------DEKDKGGIEEKERFSIENTPN 722

Query: 718 EASTSDSEKTNLDDKTP-----DSKRSDAD-----------DQVXXXXXXXXXXXXXXFH 761
           + S++ S K +  + TP     D K++  D           D+V              FH
Sbjct: 723 DTSSNSSNKHSDTETTPGLNDTDEKQASDDMDGGEEDVEDADEVSSFSTSTSSYNDTVFH 782

Query: 762 TQFKKH---TSSSGDENGHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALS 818
           +QFKK       S +E G  ++  K W IS+ VEDTGPGID SLHESVFEPFVQGDQALS
Sbjct: 783 SQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALS 842

Query: 819 RQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTR 864
           RQYGGTGLGLSICRQLATMMNGTM L SKLGVGS+FTFT+PLTQTR
Sbjct: 843 RQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTR 888

 Score =  217 bits (552), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 104/154 (67%), Positives = 120/154 (77%), Gaps = 3/154 (1%)

Query: 934  VSLDRPFLQSTGTAXXXXXXXXXXXXXXXYRILVAEDNHVNQEVIKRMLTLEGIDRIDLA 993
            V LDRPFLQSTGTA                +ILVAEDN VNQEVIKRML LEG+  I+L 
Sbjct: 956  VRLDRPFLQSTGTASSNTNLGTTSTIN---KILVAEDNDVNQEVIKRMLNLEGVHNIELV 1012

Query: 994  ADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADD 1053
             DGQ+A DKVK L E GEHY LIFMDVQMPK+DGLL+TKMIR+DL+Y +PIVALTAFADD
Sbjct: 1013 CDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADD 1072

Query: 1054 SNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYCHD 1087
            SNIR CL+AGM+GFL+KPIKR +L+ II ++C D
Sbjct: 1073 SNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPD 1106

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1177

 Score =  990 bits (2560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/1164 (47%), Positives = 694/1164 (59%), Gaps = 94/1164 (8%)

Query: 3    LGTIAKEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAA 62
            LG  AK K  PPF ISIRTQ                   TGVYFTS++KS+R+ERLYVA+
Sbjct: 9    LGAYAKRKLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVAS 68

Query: 63   QLKSSQIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXAL 122
            QLK+SQIDQNL YLYYQCY+             Y++GN T  NW D             L
Sbjct: 69   QLKASQIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNL 128

Query: 123  FSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNG 182
            FS+ARVYD+ FQ VLNA+NN +G+++ + VL +L PLS+N++LP+SLE +GMLTDPVLN 
Sbjct: 129  FSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLND 188

Query: 183  TSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYK 242
            T YLMSMSLPI+ANPSIIL+ S+VYGY+T+++SA+ LK+V++D TALE SSV +VS +Y 
Sbjct: 189  TGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYD 248

Query: 243  KDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVG 302
             ++ L  Y  VF PYG    I+D+ + I N+SFL  A +Q K GS + T   Y++  A+G
Sbjct: 249  -NRELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIG 307

Query: 303  YSPCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIV 362
            YSPCS   V WVAII+Q E+ F+ PSTRL +             C  TFPL+HWAVQPIV
Sbjct: 308  YSPCSSDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIV 367

Query: 363  RLQKATEIITEGRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLADEKGAVGRAS-- 420
            RLQKATEIIT GRGL                                    G+V R+S  
Sbjct: 368  RLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIR----RSGSVARSSKH 423

Query: 421  ------TEGSFNY---------------DQAVPSLNSN------AEISSDRTRKYMTSSN 453
                   +G+ N                D A+  ++S       +E  S R+ +Y+TS+N
Sbjct: 424  KYIPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYITSTN 483

Query: 454  LVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLXXXXXXXXXXX 513
            L+EARVP Y   FSDE SELT+TFNTMT+ LD+HYALLEDRVRART+QL           
Sbjct: 484  LIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGAN 543

Query: 514  XXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGXXXXXXXXXXXX 573
              KTVFIANISHELRTPLNGILGMTAI+M E D+ K++SSLKLIFRSG            
Sbjct: 544  EAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLT 603

Query: 574  FSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNR 633
            FSKNVL+RTKLE+RDF++ ++A+Q++SIFGK+AKDQ V  +I++ PN +R MVL+GDSNR
Sbjct: 604  FSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNR 663

Query: 634  IIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDF--KAVYVIDGTE------ 685
            I+QIVMNLVSNALKFTPVDG+V+V+  LLGEYD+ ++ N  F   AV  I  +E      
Sbjct: 664  IVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKESSTL 723

Query: 686  -PREDGLI--------------PPPVKQFEKQEDLEKEKISEK----------------- 713
             P E G I              PP     E     + E  S K                 
Sbjct: 724  GPTEKGGIKDVTESASSSNATWPPSPSTSETSNGSKAETTSGKLTESSEEDEKEEKLDHD 783

Query: 714  ------------HNEEEASTSDSEKTNLDDKTPDSKRSDADDQVXXXXXXXXXXXXXXFH 761
                            EA  S  + TN + +  DS  +  +D                FH
Sbjct: 784  DKDEGDEESEEEEYRGEAEVSGKDDTNNETQREDSNENQNEDARSIESENASSYDDAIFH 843

Query: 762  TQFKKHTSSSGDENGHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQY 821
            ++ +K  S   +E+G  LEHP+  AI++EV+DTGPGI+P+L ESVFEPFVQGDQ LSRQY
Sbjct: 844  SRLRKGNSGE-NEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQY 902

Query: 822  GGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTRXXXXXXXXXXXXXXXPL 881
            GGTGLGLSICRQLA MMNG+M LDSK  VG    FT  +  T+               P 
Sbjct: 903  GGTGLGLSICRQLAAMMNGSMSLDSK--VGVGSKFTFTVPLTQTKELCFEEDEN----PF 956

Query: 882  SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESEFSVGNVSLDRPFL 941
                                                        ESE SVG+V +DRPFL
Sbjct: 957  EDEFNPDSKKNRKVKFKVSKNNKRKKSHSSSSGQNSSVGTPTVSESEVSVGSVRVDRPFL 1016

Query: 942  QSTGTAXXXXXXXXXXXXXXXYRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFD 1001
            QSTGTA                ++LVAEDN+VNQEVIKRML LEG+D +DLA DGQDAFD
Sbjct: 1017 QSTGTALSTRSVTTTSVANKC-KVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFD 1075

Query: 1002 KVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLE 1061
            KVKA  E G+ Y+LIFMDVQMP+VDGL AT+MIR +L Y +PIVALTA+ADD NI+ C++
Sbjct: 1076 KVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECID 1135

Query: 1062 AGMNGFLSKPIKRPKLKTIIAQYC 1085
            AGMNGFL+KPI+RPK+K I+++YC
Sbjct: 1136 AGMNGFLAKPIRRPKIKEILSEYC 1159

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
           YIL147C (REAL)
          Length = 1219

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/930 (53%), Positives = 595/930 (63%), Gaps = 66/930 (7%)

Query: 1   MRLGTIAKEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYV 60
           MR    ++  F+PPFRISIR Q                   TGVYFTSNYK+LRS+RLY+
Sbjct: 1   MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61  AAQLKSSQIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXX 120
           AAQLKSSQIDQ LNYLYYQ Y+             YV+GNK+  NWVD            
Sbjct: 61  AAQLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120

Query: 121 ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL 180
            LF VA+VYD+ F TVLNATNNGTGD++  D+  +L PLS++MALP+SLE+ G+LTDP+L
Sbjct: 121 NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180

Query: 181 NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI 240
           N T YLMSMSLPI+ANPSIILT+SRVYGY+TIIMSA+ LKSV++D TALEKS+V I+SA+
Sbjct: 181 NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240

Query: 241 YKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSA 300
           Y       +Y FVF PYGT+  I    +PI NN+F+S+A + GK GS ++T+ F  +  A
Sbjct: 241 YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA 300

Query: 301 VGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQP 360
           +GYSPCSF+ VNWVA++SQ E+VF+ PST+L K           FV + T PLAHWAVQP
Sbjct: 301 LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361 IVRLQKATEIITEGRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLADEKGAVGRAS 420
           IVRLQKATE+ITEGRGL                                + E G+   AS
Sbjct: 361 IVRLQKATELITEGRGLRPSTPRTVSRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTSAS 420

Query: 421 TEGS----------------------------FNYDQAVPSLNSNAEISSDRTRKY---- 448
             G                                ++  P+ ++NA+IS D +  +    
Sbjct: 421 GHGCSGRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLA 480

Query: 449 -------------------MTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYA 489
                               TS+NL EAR+P YR  FSDE S+LT+TFNTMT+ALDQHYA
Sbjct: 481 PNALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 490 LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDK 549
           LLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEE D++K
Sbjct: 541 LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 550 IQSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQ 609
           I++SLKLIFRSG            FSKNVLQRTKLEKRDF ITDVA+QIKSIFGKVAKDQ
Sbjct: 601 IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 610 RVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQR 669
           RV+ SI+LFPN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDG V VRM+LLGEYDK+ 
Sbjct: 661 RVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKEL 720

Query: 670 SENEDFKAVYVIDGTEPRED-GLI----PPPVKQFEKQEDLEKEKISEKHN-------EE 717
           SE + FK V+V  GTE  ED G I        + F+K  D E    S   N       EE
Sbjct: 721 SEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQEE 780

Query: 718 EASTSDSEKTNLDDKTPDSKRSDADDQVXXXXXXXXXXXXXXFHTQFKKHTSSSGDENGH 777
               + +   N+  KT D ++S  DD                F++QF K   S  DE G 
Sbjct: 781 ITKRNTAANENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNKALGSDDDEGGD 840

Query: 778 L---LEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQL 834
           L   +E+PK WAIS+EVEDTGPGIDPSL ESVF PFVQGDQ LSRQYGGTGLGLSICRQL
Sbjct: 841 LGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 835 ATMMNGTMKLDSKLGVGSKFTFTLPLTQTR 864
           A MM+GTMKL+SK+GVGSKFTFTLPL QT+
Sbjct: 901 ANMMHGTMKLESKVGVGSKFTFTLPLHQTK 930

 Score =  234 bits (598), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 127/161 (78%), Gaps = 3/161 (1%)

Query: 928  EFSVGNVSLDRPFLQSTGTAXXXX---XXXXXXXXXXXYRILVAEDNHVNQEVIKRMLTL 984
            E SVG+V+LDRPFLQSTGTA                   +ILV EDNHVNQEVIKRML L
Sbjct: 1051 EESVGSVNLDRPFLQSTGTATSNRNIPTVSNSDKSDSSIKILVVEDNHVNQEVIKRMLNL 1110

Query: 985  EGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPI 1044
            EGI+ I+LA DGQDAFDKVK L  +GE Y +IFMDVQMPKVDGLL+TKMIR+DL Y  PI
Sbjct: 1111 EGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPI 1170

Query: 1045 VALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085
            VALTAFADDSNI+ CLE+GMNGFLSKPIKRPKLKTI+ ++C
Sbjct: 1171 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFC 1211

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
           YIL147C (SLN1) - histidine kinase osmosensor that
           regulates an osmosensing MAP kinase cascade and is
           similar to bacterial two-component regulators [contig
           159] FULL
          Length = 1143

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/913 (50%), Positives = 576/913 (63%), Gaps = 70/913 (7%)

Query: 3   LGTIAKEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAA 62
           LG   + +   P  +SIRTQ                   TGVYFTS++KSLR+ERL+VAA
Sbjct: 9   LGAFFQRRLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAA 68

Query: 63  QLKSSQIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXAL 122
           QLKSSQIDQNLNYLYYQCYW             Y++GN +  NW D             L
Sbjct: 69  QLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNL 128

Query: 123 FSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNG 182
           FS+ARVYD+ FQ VLN +NNG+G+++ +++L +L PLS+++ALP+SLE  GMLTDPVLNG
Sbjct: 129 FSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNG 188

Query: 183 TSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYK 242
           + YLMSMSLPI+ANPSIIL+ ++VYGY+T+++SA+ LKSVY+D TAL+ SSV IVS +Y 
Sbjct: 189 SVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYD 248

Query: 243 KDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVG 302
            D  L  Y  VF PY   P +++E + I N SFL  A++ GK GS + T  F N+  AVG
Sbjct: 249 -DHELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVG 307

Query: 303 YSPCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIV 362
           YSPC+     WVAII+Q EA+F+ PSTRL K             C+ TFPL+HWAVQPIV
Sbjct: 308 YSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIV 367

Query: 363 RLQKATEIITEGRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLADEKGAVGRASTE 422
           RLQKATEIIT GRGL                                    G+V RA  +
Sbjct: 368 RLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVR----RSGSVARAGRD 423

Query: 423 GSF-NYDQAVPSLNSNAEI----------------------------SSDRTRKYMTSSN 453
               +  + VP  NS+  I                             + ++ +Y+TS+N
Sbjct: 424 KYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYITSTN 483

Query: 454 LVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLXXXXXXXXXXX 513
           L+EARVPVY+  FSDE SELT+TFNTMT+ LD+HYALLEDRVRART+QL           
Sbjct: 484 LIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGAN 543

Query: 514 XXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGXXXXXXXXXXXX 573
             KTVFIANISHELRTPLNGILGMTAI+M E D  K++SSLKLIFRSG            
Sbjct: 544 EAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLT 603

Query: 574 FSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNR 633
           FSKNVL+RTKLE+RDF I D+A+Q++SIFGK+AKDQ V  +I++ PN +R MVL+GDSNR
Sbjct: 604 FSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNR 663

Query: 634 IIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPREDGLIP 693
           I+QIVMNLVSNALKFTPVDGKV V+ RLLGEYD+++S+  ++K V+V+  TE R      
Sbjct: 664 IVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTEA 723

Query: 694 PPVKQFE----------------KQEDLEKEKISEKHNEEEASTSDSEKTNLDDKTPDSK 737
              K  E                +  D +  KI ++   E   +   E ++ DD+  D+K
Sbjct: 724 KDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIESSDEDDENEDTK 783

Query: 738 R------SDADDQVXXXXXXXXXXXXXXFHTQFKKHTSSSGDENGHLLEHPKNWAISVEV 791
                  S  DD +              F T+ +K +S+  +E G  LE PK W IS+EV
Sbjct: 784 SIGSGNTSSYDDAI--------------FQTRLRKDSSNEENEEGRALESPKKWVISMEV 829

Query: 792 EDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVG 851
            DTGPGIDP+LHESVFEPFVQGDQ LSRQYGGTGLGLSICRQLATMM+GTMKLDS++GVG
Sbjct: 830 HDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVG 889

Query: 852 SKFTFTLPLTQTR 864
           SKF+FT+PLTQT+
Sbjct: 890 SKFSFTVPLTQTK 902

 Score =  230 bits (587), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 109/159 (68%), Positives = 128/159 (80%), Gaps = 1/159 (0%)

Query: 927  SEFSVGNVSLDRPFLQSTGTAXXXXXXXXXXXXXXXYRILVAEDNHVNQEVIKRMLTLEG 986
            SE SVG+V +DRPFLQSTGTA                +ILVAEDN+VNQEVIKRML LEG
Sbjct: 969  SEVSVGSVRVDRPFLQSTGTALSTTLVTTSSLADRR-KILVAEDNNVNQEVIKRMLNLEG 1027

Query: 987  IDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVA 1046
            ++ ++LA DGQDAFDKVKA    G+HY+LIFMDVQMP+VDGL AT+MIRK+L Y +PIVA
Sbjct: 1028 LEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVA 1087

Query: 1047 LTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085
            LTAFADDSNI+ CL+AGMNGFLSKPIKRPK+K I+ +YC
Sbjct: 1088 LTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYC 1126

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar
           to uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/876 (54%), Positives = 580/876 (66%), Gaps = 30/876 (3%)

Query: 11  FSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLKSSQID 70
             PPFRI IR Q                   TGVYFTSNYK+LRS+RLY+AAQLKSSQ+D
Sbjct: 14  LKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLD 73

Query: 71  QNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSVARVYD 130
           QNLNYLYYQCYW           A+YV+GNKT+ NW +             LF ++RVYD
Sbjct: 74  QNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSRVYD 133

Query: 131 ADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSMS 190
            DF+ VLN TNNGTGD + + +  +L PLS+++ LP+SL + GMLTDPVLNGT YLMSMS
Sbjct: 134 YDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMS 193

Query: 191 LPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGLGSY 250
           LPI+ANPSII ++ +VYGY+T++MSA+ L+SV++D TALEKS+V IVSA Y     + SY
Sbjct: 194 LPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSY 253

Query: 251 RFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFKF 310
           RFVF PYG +P IL+ T+ ++++SFL+ A +Q K GS ++T  FY +  A+GY PCSF F
Sbjct: 254 RFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNF 313

Query: 311 VNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVRLQKATEI 370
           VNWVA++SQ+E+VF+ PST+LTK           FV + TFPLA WAV+PIVRLQKATE+
Sbjct: 314 VNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATEL 373

Query: 371 ITEGRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLADEKG---AVGRAS-----TE 422
           I EGRGL                                  EK    A   AS     T+
Sbjct: 374 IAEGRGLRPAGAGSGSRSGSRTSSMKKDINDLNFISRLSLSEKNHRPAYDSASDSNYATD 433

Query: 423 GSFNYD-QAVPSLN--SNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNT 479
           GS ++D Q   + N  S+ + SS R+R   TS+NL EAR+P YR  FSDE S+LT+TFN 
Sbjct: 434 GSLSHDLQTSQASNRPSDNDRSSSRSRFLTTSTNLNEARLPDYRRLFSDELSDLTNTFNA 493

Query: 480 MTNALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTA 539
           MT+ALDQHYALLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTA
Sbjct: 494 MTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTA 553

Query: 540 ISMEERDIDKIQSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVAVQIK 599
           ISMEE DI KI++SLKLIFRSG            FSKNVL+RT LEKR+F ITDVA+QIK
Sbjct: 554 ISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTALEKRNFCITDVALQIK 613

Query: 600 SIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRM 659
           SIFGKVAKDQ V+ SI+L PN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDGKV+VR+
Sbjct: 614 SIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVNVRI 673

Query: 660 RLLGEYDKQRSENEDFKAVYVI-DGTEPREDGLIPPPVKQFEKQ-----EDLEKEKISEK 713
           +LLGEYD++ ++ ++FK ++ I D    ++  +   P     K      +       S+K
Sbjct: 674 KLLGEYDEEATKADNFKQIHTIADSDAHQQHPVSSSPNGVLVKHLSTSSDSNSNLSDSDK 733

Query: 714 HNEEEASTSDSEK--TNLDDKTPDSKRSDADDQVXXXXXXXXXXXXXXFHTQFKKHTSSS 771
           +NE+     D E   TN+ D + D     +                  F+TQFKK     
Sbjct: 734 YNEKTYDEDDDEHSITNISDHSDDLSSLVS--------SSTSSYDNALFNTQFKKTPDLY 785

Query: 772 GDEN---GHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGL 828
            D N   G  L   K W  ++EVEDTGPGIDP LHESVFEPFVQGDQ LSRQYGGTGLGL
Sbjct: 786 EDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGL 845

Query: 829 SICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTR 864
           SICRQLATMM+GTMKL+SK+GVGSKFTFT+PL QTR
Sbjct: 846 SICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTR 881

 Score =  231 bits (588), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 125/152 (82%)

Query: 934  VSLDRPFLQSTGTAXXXXXXXXXXXXXXXYRILVAEDNHVNQEVIKRMLTLEGIDRIDLA 993
            V LDRPFLQSTGTA               ++ILVAEDNHVNQEVIKRML LEGI+ IDLA
Sbjct: 991  VHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLA 1050

Query: 994  ADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADD 1053
             DGQDAFDKV++L E+ + Y++IFMD+QMPKVDGLL+TKMIR+DL+Y+  IVALTAFADD
Sbjct: 1051 CDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADD 1110

Query: 1054 SNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085
            SNI+ C+EAGMNGFLSKPIKRPKLK I+ +YC
Sbjct: 1111 SNIKECIEAGMNGFLSKPIKRPKLKMILEEYC 1142

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON}
           similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1140

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/906 (50%), Positives = 565/906 (62%), Gaps = 55/906 (6%)

Query: 8   KEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLKSS 67
           + K  PPF++ IRTQ                   TGVYFT+NYKSLR++RL+VAAQLKSS
Sbjct: 8   RSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSS 67

Query: 68  QIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSVAR 127
           QIDQNLNYLYYQCYW             Y +GN T  NW +             LFSVAR
Sbjct: 68  QIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVAR 127

Query: 128 VYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLM 187
           +YD+ F+TVLNATNNG+G+++ + VL  L PLS++  L +SL++ G+LTDPVLN T Y+M
Sbjct: 128 IYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVM 187

Query: 188 SMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGL 247
           SMSLPI+A+PSI+LT S + GY+T++MSA+SLK V++D TAL+KS V I+SA Y      
Sbjct: 188 SMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLP 247

Query: 248 GSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCS 307
            SY FVF P+G    I+D ++ I N SF+ +A    K+GS +RT  FY +  AVGYSPC 
Sbjct: 248 VSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCL 307

Query: 308 FKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVRLQKA 367
           FK V WVA+ISQ E VF+ PSTRLT            F+C+ TFPLAHWAV+PIVRLQKA
Sbjct: 308 FKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKA 367

Query: 368 TEIITEGRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLADE--------------- 412
           TEIIT  RGL                               + D                
Sbjct: 368 TEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGHSNFELHH 427

Query: 413 --KGAVGRASTEGSFNYDQAVPSLNSNAEIS------SDRTRKYMTSSNLVEARVPVYRI 464
               +V             A+P  N     S      S ++  ++ S+NL++ARVPVY  
Sbjct: 428 RTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDARVPVYGR 487

Query: 465 FFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANIS 524
            FSDE SELTDTFNTMT+ LD+HYALLEDRVRARTKQL             KTVFIANIS
Sbjct: 488 LFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANIS 547

Query: 525 HELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKL 584
           HELRTPLNGILGMTAISM E+D+ K+Q+SLKLIFRSG            FSKNVLQRTKL
Sbjct: 548 HELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTFSKNVLQRTKL 607

Query: 585 EKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSN 644
           E+R+F+I DVA+Q+KSIFGK+AKDQ V  SI L PN IR M+L+GDSNRIIQIVMNLVSN
Sbjct: 608 EERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQIVMNLVSN 667

Query: 645 ALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQED 704
           ALKF+PVDGKV VR++LLGEYD ++S++ ++  V++  GTE      IP           
Sbjct: 668 ALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTE------IPDASASKSSLST 721

Query: 705 LEKEKI-------------SEKHNEEEASTSD------SEKTNLDDKTPDSKRSDAD--D 743
           LE  K+             S+K  EE  ++SD       +++  D  T   KRS+++  D
Sbjct: 722 LEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEADTDTDTDKRSNSEISD 781

Query: 744 QVXXXXXXXXXXXXXXFHTQFKKHTSS-----SGDENGHLLEHPKNWAISVEVEDTGPGI 798
            +               H Q +K  S      SGD  G  LE  K W I++EVEDTGPGI
Sbjct: 782 SLSLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGI 841

Query: 799 DPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTL 858
           +P+LHESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTMKL+SK+GVGSKFTFT+
Sbjct: 842 EPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTV 901

Query: 859 PLTQTR 864
           PLTQTR
Sbjct: 902 PLTQTR 907

 Score =  244 bits (623), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 111/162 (68%), Positives = 135/162 (83%)

Query: 926  ESEFSVGNVSLDRPFLQSTGTAXXXXXXXXXXXXXXXYRILVAEDNHVNQEVIKRMLTLE 985
            ESE SVG+V +DRPFLQSTGTA               ++ILVAEDN+VNQEV+KRML LE
Sbjct: 968  ESEVSVGSVRVDRPFLQSTGTATSTRSITTVKSLERPFKILVAEDNNVNQEVVKRMLNLE 1027

Query: 986  GIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIV 1045
            G+  IDLA DGQ+AFDKVKALQE  +HY +IFMDVQMP+VDGLL+TKMIR++L Y +PIV
Sbjct: 1028 GLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIV 1087

Query: 1046 ALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYCHD 1087
            ALTAFADDSNI+VCL++GMNGFLSKPIKRPKLK++++++C D
Sbjct: 1088 ALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPD 1129

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
           (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/892 (52%), Positives = 571/892 (64%), Gaps = 53/892 (5%)

Query: 8   KEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLKSS 67
           ++ F PP+RI+IR Q                   TGVYFT NYK LRS RL +AA+LKSS
Sbjct: 6   RKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSS 65

Query: 68  QIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSVAR 127
           QIDQ LNYL+YQC +            NY +GNKT  NW++             LF VAR
Sbjct: 66  QIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVAR 125

Query: 128 VYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLM 187
           +YD +F+ V+NATNNGTGD++ ++VL++L PLS+N +LP+SL ++G+LTDPVLNG+ YLM
Sbjct: 126 LYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLM 185

Query: 188 SMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGL 247
           SMSLPI  NPSIIL+ SRVYGY+TI+MSAD LK+VY + TALE S+VT++SAIY     +
Sbjct: 186 SMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKV 245

Query: 248 GSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCS 307
             + FVF         L E +PI N ++LS+AL +GK+GS ++T   +NR  A+GYSPCS
Sbjct: 246 DGFHFVFEVENDDFSTLIE-YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCS 304

Query: 308 FKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVRLQKA 367
           F   NWVA+++Q EAVF+ PST+L K           FVC+ TFPL+HWAV+PIVRLQKA
Sbjct: 305 FSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKA 364

Query: 368 TEIITEGRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLADEKGAVGRASTEGSFNY 427
           TE+I++GRGL                               L   K      S E   N 
Sbjct: 365 TELISQGRGLKPTSNFSNGDSSSTSDNWRESVESHVRAS--LGIFKSLRNNGSNELQSND 422

Query: 428 D-QAVPSLNSNAEISSDRTR----------KYMTSSNLVEARVPVYRIFFSDEFSELTDT 476
           D   +   +S    + D  +          +  T+SNLV+ARVPVY  F  DE SELTDT
Sbjct: 423 DMNEINERSSKNNSTGDNIKSSDNDSSSSFQRYTTSNLVQARVPVYGRFLQDELSELTDT 482

Query: 477 FNTMTNALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILG 536
           FN MTNALDQHY LLEDRVRARTKQL             KTVFIANISHELRTPLNGILG
Sbjct: 483 FNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILG 542

Query: 537 MTAISMEERDIDKIQSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVAV 596
           MTAISMEE D DKI+ +LKLIFRSG            FSKNVL+RT LEKRDF IT++A+
Sbjct: 543 MTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFSKNVLKRTNLEKRDFCITEIAL 602

Query: 597 QIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVS 656
           QIKSIFGKVA+DQ VK  I L PN+IR MVL+GDSNRIIQIVMNLVSNALKFTP+DGKV 
Sbjct: 603 QIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNALKFTPIDGKVD 662

Query: 657 VRMRLLGEYDKQRSENEDFKAVYVIDGTE-PREDG----LIPPPVKQFEKQEDLEKE--- 708
           VR++LLGEYD++RS N+D+K VY+  GTE P  +G    ++   +++  +++ +E +   
Sbjct: 663 VRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQELSEKDCIEGDTAS 722

Query: 709 ---------KISEK-HNEEEASTSDSEKTNLD----DKTPDSKRSDADDQVXXXXXXXXX 754
                    KI +   +EE+ S SD+E TN D      T  S RS  D            
Sbjct: 723 SGSHMSGSSKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRSYDD------------ 770

Query: 755 XXXXXFHTQFKKHTSSSGDEN--GHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQ 812
                   QFKK       E   G  L  PK W ISVEVEDTGPGI+P L E+VFEPFVQ
Sbjct: 771 ---AALQRQFKKTPDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQ 827

Query: 813 GDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTR 864
           GDQALSRQYGGTGLGLSICRQLATMM+GTMKL+S +GVGSKF FT+PL QTR
Sbjct: 828 GDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTR 879

 Score =  219 bits (558), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 125/163 (76%), Gaps = 5/163 (3%)

Query: 934  VSLDRPFLQSTGTAXXXXX-----XXXXXXXXXXYRILVAEDNHVNQEVIKRMLTLEGID 988
            V LDRPFLQSTGTA                     RILVAEDNHVNQEVIKRML LE ID
Sbjct: 950  VRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKID 1009

Query: 989  RIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALT 1048
             IDLA DGQDAFDKVK+L +  E+Y++IFMDVQMPKVDGL++TKMIRKDL+Y++PIVALT
Sbjct: 1010 NIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALT 1069

Query: 1049 AFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYCHDDSKV 1091
            AFA+D NI+ CL+AGM+GFL KPIKRPKLK I+ +Y   + ++
Sbjct: 1070 AFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEYIDTEKQI 1112

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
           similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1155

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/926 (49%), Positives = 567/926 (61%), Gaps = 83/926 (8%)

Query: 8   KEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLKSS 67
           +E+F+PPF + +RTQ                   TGVYFT+NYKS+R+ERL VAAQLKSS
Sbjct: 15  RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74

Query: 68  QIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSVAR 127
           Q+DQNLNYLYYQ YW            N+ +GN +  NW               LFS AR
Sbjct: 75  QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134

Query: 128 VYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLM 187
           VYD  F TV+N+TNNG+GD + ++VLA+L PLS    L +SL + G++TDPV N T+YL+
Sbjct: 135 VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194

Query: 188 SMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGL 247
           SMSLP+  NPSIIL  + + GY+T+I SA+SLK+V +D  AL+KSSV+I+SA++  +  L
Sbjct: 195 SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254

Query: 248 GSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCS 307
             Y FVF P+GT+      T+PI N +F++ A   GK GS  +T++   R  AVGYSP +
Sbjct: 255 TGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPT 314

Query: 308 FKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVRLQKA 367
           FK VNWVA+++Q E VF+ P+ RL K           F+C+ TFP+AHWAVQPIVRLQKA
Sbjct: 315 FKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKA 374

Query: 368 TEIITEGRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLADEKGAVGRASTEGSFNY 427
           TEIIT GR L                               L ++    G  S   + NY
Sbjct: 375 TEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHNY 434

Query: 428 DQAVPSLNSNAEISS-----------DRTR-------------------KYMTSSNLVEA 457
           +   PS   +  +S+           D TR                   +Y+ S+NLVEA
Sbjct: 435 NVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIKSTNLVEA 494

Query: 458 RVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKT 517
            VPVYR FF DE SELTDTFNTMT+ LD+HYALLE+RVRARTKQL             KT
Sbjct: 495 YVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANEAKT 554

Query: 518 VFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGXXXXXXXXXXXXFSKN 577
           VFIANISHELRTPLNGILGMTAI+M E D+ K+Q+SLKLIFRSG            FSKN
Sbjct: 555 VFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTELLTFSKN 614

Query: 578 VLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQI 637
           VL+RTKLE+RDFS+ D+A+QIKSIFGK+AKDQ VK SI L PN IR +VL+GDSNRIIQI
Sbjct: 615 VLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQI 674

Query: 638 VMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPRE--------- 688
           VMNLVSNALKFTPVDGKV VR++LLGEYD +RSE+ D++ V+V+ G+E  +         
Sbjct: 675 VMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFNLTST 734

Query: 689 -------------------DGLIPPPVKQFEKQEDLEKEKISEKHNEEEAST--SDSEKT 727
                              DG   P  K  E    +E E  +E ++ +E+S       + 
Sbjct: 735 TPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLESKHEE 794

Query: 728 NLDDKTPDS-----KRSDADDQVXXXXXXXXXXXXXXFHTQFKK---HTSSSGDENGHL- 778
           N D+K   S       S  DD +              FH+QFKK    T S  +EN    
Sbjct: 795 NEDEKEKMSILSTSTSSSYDDAI--------------FHSQFKKVLSSTDSDTEENTFRD 840

Query: 779 LEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMM 838
           L+ PK W IS+EVEDTG GIDPSL ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM
Sbjct: 841 LKVPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMM 900

Query: 839 NGTMKLDSKLGVGSKFTFTLPLTQTR 864
            GTMKLDSK+GVGSKF FT+PL QT+
Sbjct: 901 KGTMKLDSKVGVGSKFIFTVPLQQTK 926

 Score =  228 bits (582), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 128/164 (78%)

Query: 927  SEFSVGNVSLDRPFLQSTGTAXXXXXXXXXXXXXXXYRILVAEDNHVNQEVIKRMLTLEG 986
            +E SVGNV +DRPFLQSTGTA               +R+LVAEDN+VNQEVIKRML LEG
Sbjct: 988  TENSVGNVRVDRPFLQSTGTATSTRSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEG 1047

Query: 987  IDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVA 1046
            +  +D+A DGQ+A++KV+ + + GE Y +IFMDVQMP+VDGLLATKMIR DL Y+ PIVA
Sbjct: 1048 LTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVA 1107

Query: 1047 LTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYCHDDSK 1090
            LTA+ADDSNI+VCLE+GM+GFL KPIKRP LK IIAQYC    K
Sbjct: 1108 LTAYADDSNIKVCLESGMDGFLPKPIKRPLLKKIIAQYCSKKEK 1151

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/885 (44%), Positives = 537/885 (60%), Gaps = 53/885 (5%)

Query: 1   MRLGTIAKEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYV 60
           +RL T      SPP+ +++R Q                   TGVYFT+NYKSLR+E+L++
Sbjct: 6   LRLAT------SPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFI 59

Query: 61  AAQLKSSQIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXX 120
           AAQLKSSQ+DQ+LNYLYYQ  W             Y SGNKT  NWV+            
Sbjct: 60  AAQLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSS 119

Query: 121 ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL 180
           ++FS A +YD +F  + N +NNGTG  + DD++ +L PLSS+  LPAS+ + G LTDPVL
Sbjct: 120 SIFSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVL 179

Query: 181 NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI 240
           N ++YLMS+SLPI+ NPSIIL++SRVYGYVTII  A S+ +V++D TALE S+V I+SA 
Sbjct: 180 NTSNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAK 239

Query: 241 YKKDQGLG-SYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPS 299
           Y+        Y FVF PYG+   ++D  +P++NNSFL  A  +   GS   T  FY+   
Sbjct: 240 YRNSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLV 299

Query: 300 AVGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQ 359
           AVGYS C+F   NWVA++SQ E+VF   + +LTK          A VC  TF ++++ V+
Sbjct: 300 AVGYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVK 359

Query: 360 PIVRLQKATEIITEGRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLADEKG----- 414
           PI++L++ATE+I+ GRGL                                  EK      
Sbjct: 360 PIIKLKQATELISRGRGLRPYYENLSDRTSQDNTSTRTTIDLSDLDGYTNEKEKSLPTCT 419

Query: 415 ------AVGRASTEGSFNYDQAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSD 468
                 ++   +++  F   + +   +S + + S  +  ++ +++    RVPV+  + +D
Sbjct: 420 EDERSKSLSNIASKSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITD 479

Query: 469 EFSELTDTFNTMTNALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELR 528
           E +EL +TFN M ++LD+H  LLE+RV+ARTK+L             KTVFIANISHELR
Sbjct: 480 ELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELR 539

Query: 529 TPLNGILGMTAISMEERDIDKIQSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRD 588
           TPLNGILGMTAI++EE D +K+Q SLKLI+RSG            FSKNVLQ+TKLEK  
Sbjct: 540 TPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSKNVLQKTKLEKIH 599

Query: 589 FSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKF 648
           F I D+A+QIKSIFGK+AKDQ V FSI + PN IR MV +GDSNRIIQ++MNLVSNALKF
Sbjct: 600 FCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKF 659

Query: 649 TPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQEDLEKE 708
           TP+DG V VR++LLGEYD+++S   ++  VY+ +GT    D             + +  E
Sbjct: 660 TPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGD------------NDAIPTE 707

Query: 709 KISEKHNEEEASTSDSE---KTNLDD------KTPDSKRSDADDQVXXXXXXXXXXXXXX 759
            IS+K +    S+S  +   KT+ +D      K+ DS  SD  ++               
Sbjct: 708 PISDKISFAGGSSSIHDYCSKTDENDNIKTEIKSDDSTISDYSEE--------------N 753

Query: 760 FHTQFKKHTSSSGDENGHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSR 819
               + ++ +   +  G  +  PK W ISV+VEDTGPGI P+L +SVFEPFVQGDQ LSR
Sbjct: 754 IMGSYYENKNPGQELLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSR 813

Query: 820 QYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTR 864
           QYGGTGLGLSICRQLA++M+GTM+LDS  G+GSKFTFT+PL Q R
Sbjct: 814 QYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQER 858

 Score =  152 bits (383), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 93/122 (76%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            +++L+ EDN VNQEVIKR+L LE I  I+ A DGQ+A D VK    + + +++IFMD+QM
Sbjct: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P VDG  AT++IR +L+Y YPIVALTAFADDSN + C  +GMN FL+KPIKR +LK II 
Sbjct: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059

Query: 1083 QY 1084
            ++
Sbjct: 1060 EF 1061

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/858 (44%), Positives = 514/858 (59%), Gaps = 40/858 (4%)

Query: 11  FSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLKSSQID 70
           +  P+++ +RTQ                   TGVYFT NY+ LR ++LY+AA+LKSSQID
Sbjct: 10  WKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQID 69

Query: 71  QNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSVARVYD 130
           Q +N LYYQC W            +Y +GN++  NW               +F    +YD
Sbjct: 70  QTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYD 129

Query: 131 ADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSMS 190
           + F  +LN TNN T D + DDVL+ L+PLS   +LP+ L + G+LTDPVLN ++YLMSMS
Sbjct: 130 SQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMS 189

Query: 191 LPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGLGSY 250
           LPI ANPS+ L++SRV+GY+T++MSA+++++V +D TALEKS V ++S+          Y
Sbjct: 190 LPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEY 249

Query: 251 RFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFKF 310
            FVF P+G +  I++  +P+ N++FLS A    + GS  ++   Y++  A+GY PCSF  
Sbjct: 250 HFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGL 309

Query: 311 VNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVRLQKATEI 370
            NWV  +SQ E VFM  S +LTK           FVC+ TFPL+ W+VQPIVRLQKATE+
Sbjct: 310 ANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEV 369

Query: 371 IT--EGRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLADEKGAVGRASTEGSFNYD 428
           I+  +G  +                                 D    V + +  G  N  
Sbjct: 370 ISKRDGNEVHRSNSSSSSRSTFSSNRRSKDGRHNSSSYNLYED----VEKYTEIGKANKS 425

Query: 429 QAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHY 488
               S  +  + SS  +   +   NL + +VP  R F  DE SELT+T+  MT+ALD+H 
Sbjct: 426 TESLSKENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHS 485

Query: 489 ALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDID 548
            LLE RV+ RTKQL             KTVFIAN++HELRTPLNGILGMTAI+MEE D++
Sbjct: 486 QLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDME 545

Query: 549 KIQSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKD 608
           +IQSSLKLI+RSG            FSKNVL++TKLEK  F + D+A+QI+SIFGK++KD
Sbjct: 546 RIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKD 605

Query: 609 QRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQ 668
           Q VK SI + PN++R MVL+GD NRI+Q++MNLVSNALKFTPVDGK++V ++LLGEYDK 
Sbjct: 606 QHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKD 665

Query: 669 RSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQEDLEKEKISEKHNEEEASTSDSEKTN 728
           RS  E++K VY+ +      D + P       K      + IS K     +  SD+E++ 
Sbjct: 666 RSAAENYKDVYMKEIRNSNGDKIKPLMTLISSKDTMSVADNISNK-----SVASDTERST 720

Query: 729 LDDKTPDSKRSDADDQVXXXXXXXXXXXXXXFHTQFKKHTS--SSGDENGHLLEHPKNWA 786
                                          +  +FK  ++   + D  G  L+  + W 
Sbjct: 721 ---------------------------NNTIYSNKFKNGSNFQDTDDAIGVPLDKKRKWV 753

Query: 787 ISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDS 846
           ISVEVEDTGPGI+PSL +SVFEPFVQGDQ LSRQYGGTGLGLSICRQLA +M+GTMKL+S
Sbjct: 754 ISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLES 813

Query: 847 KLGVGSKFTFTLPLTQTR 864
           ++GVGSKF FT+PL QTR
Sbjct: 814 EVGVGSKFIFTVPLLQTR 831

 Score =  170 bits (430), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 72/123 (58%), Positives = 100/123 (81%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            +++L+ EDN VNQ V+ RML LEGI+   +A DGQ+A +K+K +Q +GE+Y L+ MD+QM
Sbjct: 917  FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQM 976

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            PKVDG+ ATK+IR++L Y  PIVALTAFADDSNI+ C ++GM+GFL+KPIKR +LK I+ 
Sbjct: 977  PKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036

Query: 1083 QYC 1085
            ++C
Sbjct: 1037 EFC 1039

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/907 (44%), Positives = 517/907 (57%), Gaps = 74/907 (8%)

Query: 1   MRLGTIAKE--KFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERL 58
           MRLG + K      PPF+  +RTQ                   TGVYFTSNY++LR++RL
Sbjct: 1   MRLGYLRKRLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRL 60

Query: 59  YVAAQLKSSQIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXX 118
           +VAA+L SSQ+DQ+L  LYYQC             ++Y +GN++  NW++          
Sbjct: 61  HVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLE 120

Query: 119 XXALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSS-----NMALPASLESEG 173
               F +A +YD  +Q VL+  NN T   L ++ L +L PL       N AL   +E   
Sbjct: 121 RSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVE--- 177

Query: 174 MLTDPVLNGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSS 233
             T P  N T  LMSM+LP+ A  S I+    V G++TI+MSAD + +V +D + L +S 
Sbjct: 178 --TLP-YNKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESM 231

Query: 234 VTIVSAIYKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDL 293
           V+I++ I      L  YRFVF P  T   + +  +PI N SFL  A           T  
Sbjct: 232 VSILTGIPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSS 291

Query: 294 FYN--------RPSAVGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAF 345
           FY+        +  AVGYS C F+ ++WVA++SQ E+VF+ P+ +LTK           F
Sbjct: 292 FYHFGALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVF 351

Query: 346 VCIATFPLAHWAVQPIVRLQKATEIITEGRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXX 405
           +CI TF LA WAV+PIVRLQKATE I  GRGL                            
Sbjct: 352 MCIVTFILASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSL 411

Query: 406 XXXLADEKGAVGRASTEGSFNYDQAVPSLN----------------SNAEISSDRTRKYM 449
              L ++K  V    TE       +  S++                ++  I SD  +   
Sbjct: 412 PRELFEKKHHVSPFVTENHAANSGSCSSMSDHERYLHHIARYHDGETSTNILSDHEKGST 471

Query: 450 TSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLXXXXXXX 509
           +++N ++ RVPVYR  F+DE SELTDTFNTMT+ LD+ Y +LEDRVRARTKQL       
Sbjct: 472 SATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAAKIQA 531

Query: 510 XXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGXXXXXXXX 569
                 KTVFIANI HELRTPLNGILGMTAI+M E+D +KIQ+SLKLIFRSG        
Sbjct: 532 EAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLLHILT 591

Query: 570 XXXXFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYG 629
               FSKNVL+RTKLE+R FSI D+A+Q+KSIFGK+AKDQ VK SI L PN IR MVL+G
Sbjct: 592 ELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWG 651

Query: 630 DSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPRED 689
           DSNRIIQIVMNLVSNALKFTPVDGKV VR++L+GEYD  RSE  +F  VY++ GTE    
Sbjct: 652 DSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNS 711

Query: 690 GL--IPPPVKQFEKQEDLEKEKISEKHNEEEASTSDSEKTNLDDKTPDSKRSDAD----- 742
            +  IP  V++ EK  + E                        D TP+ K+ D++     
Sbjct: 712 SVNNIPTVVEEEEKACEEEPTA---------------------DDTPERKKKDSETVDDA 750

Query: 743 DQVXXXXXXXXXXXXXXFHTQFKKHTS----SSGDENGHL--LEHPKNWAISVEVEDTGP 796
           D +               H Q KK  +       D N  +  LE P++W I +EV+DTGP
Sbjct: 751 DAISISSSVATSYDDAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGP 810

Query: 797 GIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTF 856
           GI+PSLHESVF+PFVQGDQ LSRQYGGTGLGLSICRQLATMM GTMKL+SK+G GSKFTF
Sbjct: 811 GIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTF 870

Query: 857 TLPLTQT 863
           T+PL QT
Sbjct: 871 TVPLQQT 877

 Score =  222 bits (565), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 124/159 (77%)

Query: 926  ESEFSVGNVSLDRPFLQSTGTAXXXXXXXXXXXXXXXYRILVAEDNHVNQEVIKRMLTLE 985
            ESE S G+V +DRPFLQSTGTA                RILVAEDN+VNQEVIKRML LE
Sbjct: 939  ESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLE 998

Query: 986  GIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIV 1045
            G   IDLA DG+DA+ KV AL E+GEHY+LIFMDVQMP++DGLL TK++R+ L Y+YPIV
Sbjct: 999  GAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIV 1058

Query: 1046 ALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQY 1084
            ALTAFADDSNI+ CLE+GMN FL+KPIKRP LK I+ ++
Sbjct: 1059 ALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLEH 1097

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
           SLN1Histidine kinase osmosensor that regulates a MAP
           kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1220

 Score =  523 bits (1348), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 283/466 (60%), Positives = 325/466 (69%), Gaps = 19/466 (4%)

Query: 417 GRASTEGSFNYDQAVP-SLNSN-AEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELT 474
            + S +GS N+D   P SL  N  + SS+R+    TS+NL EAR+P YR  FSDE S+LT
Sbjct: 466 AKISMDGSLNHDLLGPHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLT 525

Query: 475 DTFNTMTNALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGI 534
           +TFNTMT+ALDQHYALLE+RVRARTKQL             KTVFIANISHELRTPLNGI
Sbjct: 526 ETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGI 585

Query: 535 LGMTAISMEERDIDKIQSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDV 594
           LGMTAISMEE D++KI++SLKLIFRSG            FSKNVLQRTKLEKRDF ITDV
Sbjct: 586 LGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDV 645

Query: 595 AVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGK 654
           A+QIKSIFGKVAKDQRV+ SI+LFPN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDG 
Sbjct: 646 ALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGT 705

Query: 655 VSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPRE-----DGLIPPPVKQFEKQEDLEKEK 709
           V VRM+LLGEYDK+ SE + +K VY+  GTE  E     D    P +    K  DLE   
Sbjct: 706 VDVRMKLLGEYDKELSEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSA 765

Query: 710 ISEKHNEEEASTSDSEKTNLD--------DKTPDSKRSDADDQVXXXXXXXXXXXXXXFH 761
            S   N  + ST   E T  +         K  D +++  DD                F+
Sbjct: 766 TSLGSN-RDTSTIQEEITKRNTVANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFN 824

Query: 762 TQFKKHTSSSGDENGHL---LEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALS 818
           +QF K   S  +E G+L   +E+PK W IS+EVEDTGPGIDPSL ESVF PFVQGDQ LS
Sbjct: 825 SQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLS 884

Query: 819 RQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTR 864
           RQYGGTGLGLSICRQLA MM+GTMKL+SK+GVGSKFTFTLPL QT+
Sbjct: 885 RQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTK 930

 Score =  419 bits (1078), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 210/377 (55%), Positives = 261/377 (69%)

Query: 1   MRLGTIAKEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYV 60
           MR G  +K + +PPFRI IRTQ                   TGVYFTSNYK+LRS+RLY+
Sbjct: 1   MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61  AAQLKSSQIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXX 120
           AAQLKSSQIDQ LNYLYYQ Y+            +YV+GNK+  NWVD            
Sbjct: 61  AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS 120

Query: 121 ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL 180
            LF VA+VYD+ F  VLNATNNGTGD++ +DVL  L PLS++  LP+SLE+ G+LTDPVL
Sbjct: 121 NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL 180

Query: 181 NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI 240
           N T YLMSMSLPI+ANPSIILT+SRVYGY+TIIMSA+ LKSV++D TALE S++ I+SA+
Sbjct: 181 NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV 240

Query: 241 YKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSA 300
           Y        Y FVF PYG+   +  + + I N++F+S+A R GK GS ++T++   R +A
Sbjct: 241 YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA 300

Query: 301 VGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQP 360
           +GYSPCSF  VNWVAI+SQ E+VF+ P+T+L K           FV + T PLAHWAVQP
Sbjct: 301 LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361 IVRLQKATEIITEGRGL 377
           IVRLQKATE+ITEGRGL
Sbjct: 361 IVRLQKATELITEGRGL 377

 Score =  231 bits (590), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 110/158 (69%), Positives = 126/158 (79%), Gaps = 3/158 (1%)

Query: 931  VGNVSLDRPFLQSTGTAXXXXXXXXXX---XXXXXYRILVAEDNHVNQEVIKRMLTLEGI 987
            +G+V+LDRPFLQSTGTA                   +ILV EDNHVNQEVIKRML LEGI
Sbjct: 1053 LGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGI 1112

Query: 988  DRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVAL 1047
            + I+LA DGQ+AFDKVK L  KGE+Y +IFMDVQMPKVDGLL+TKMIR+DL Y  PIVAL
Sbjct: 1113 ENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVAL 1172

Query: 1048 TAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085
            TAFADDSNI+ CLE+GMNGFLSKPIKRPKLKTI+ ++C
Sbjct: 1173 TAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFC 1210

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
           YIL147C (REAL)
          Length = 1230

 Score =  521 bits (1343), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 281/465 (60%), Positives = 325/465 (69%), Gaps = 17/465 (3%)

Query: 417 GRASTEGSFNYDQAVPS--LNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELT 474
            + S +GS N+D   P+   N++ + SS+R+    TS+NL EAR+P YR  FSDE S+LT
Sbjct: 466 AKVSMDGSLNHDLLAPNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLT 525

Query: 475 DTFNTMTNALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGI 534
           +TFNTMT+ALDQHYALLEDRVRARTKQL             KTVFIANISHELRTPLNGI
Sbjct: 526 ETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGI 585

Query: 535 LGMTAISMEERDIDKIQSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDV 594
           LGMTAISMEE D++KI++SLKLIFRSG            FSKNVLQRTKLEKRDF ITDV
Sbjct: 586 LGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDV 645

Query: 595 AVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGK 654
           A+QIKSIFGKVAKDQRV+ SI+LFPN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDG 
Sbjct: 646 ALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGT 705

Query: 655 VSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPRE-----DGLIPPPVKQFEKQEDLEKEK 709
           V VRM+LLGEYDK  SE + FK V+V  GTE  E     +    P      K  DLE   
Sbjct: 706 VDVRMKLLGEYDKDLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTT 765

Query: 710 ISEKHN-------EEEASTSDSEKTNLDDKTPDSKRSDADDQVXXXXXXXXXXXXXXFHT 762
            S   N       EE    + +   N+  +  D+++  +DD                F++
Sbjct: 766 TSITSNRDTSIIQEEITKRNTAANENIYKRMNDAEKLSSDDVSSIVSTTTSSYDDAIFNS 825

Query: 763 QFKKHTSSSGDENGHL---LEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSR 819
           QF K   S  DE G+L   +E+PK W IS+EVEDTGPGIDPSL ESVF PFVQGDQ LSR
Sbjct: 826 QFNKAPGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSR 885

Query: 820 QYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTR 864
           QYGGTGLGLSICRQLA MMNGTM+L+SK+GVGSKFTFTLPL QT+
Sbjct: 886 QYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTK 930

 Score =  421 bits (1081), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 211/377 (55%), Positives = 262/377 (69%)

Query: 1   MRLGTIAKEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYV 60
           MRL   +K +F+PPFRI IR Q                   TGVYFTSNYK+LRS+RLY+
Sbjct: 1   MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61  AAQLKSSQIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXX 120
           AAQLKSSQIDQ LNYLYYQ Y+            ++V+GNK+  NWVD            
Sbjct: 61  AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120

Query: 121 ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL 180
            LF VA+VYD+ F TVLNATNNGTGD++ +DVL  L PLS++  LP+SLE+ G+LTDPV+
Sbjct: 121 NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180

Query: 181 NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI 240
           N T YLMSMSLPI+ANPSIILT+SRVYGY+TIIMSA+ LKSV++D TALEKS+V I+SA+
Sbjct: 181 NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240

Query: 241 YKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSA 300
           Y        Y F+F PYGT   +    + I NN+F+S+A R GK GS ++T+ F  +  A
Sbjct: 241 YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300

Query: 301 VGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQP 360
           +GYSPCSF+ VNWVA++SQ E+VF+ P+T+L K           FV + T PLAHWAVQP
Sbjct: 301 LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361 IVRLQKATEIITEGRGL 377
           IVRLQKATE+ITEGRGL
Sbjct: 361 IVRLQKATELITEGRGL 377

 Score =  231 bits (590), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/161 (68%), Positives = 128/161 (79%), Gaps = 3/161 (1%)

Query: 928  EFSVGNVSLDRPFLQSTGTAXXXXXXXXXX---XXXXXYRILVAEDNHVNQEVIKRMLTL 984
            E S+G+V+LDRPFLQSTGTA                   +ILV EDNHVNQEVIKRML L
Sbjct: 1051 EESLGSVNLDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNL 1110

Query: 985  EGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPI 1044
            EGI+ I+LA DGQ+AFDKVK L  KG +Y +IFMDVQMPKVDGLL+TKMIR+DL Y+ PI
Sbjct: 1111 EGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPI 1170

Query: 1045 VALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085
            VALTAFADDSNI+ CLE+GMNGFLSKPIKRPKLKTI+ ++C
Sbjct: 1171 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFC 1211

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
           YIL147C (REAL)
          Length = 1221

 Score =  514 bits (1325), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/464 (59%), Positives = 323/464 (69%), Gaps = 17/464 (3%)

Query: 418 RASTEGSFNYDQAVPS--LNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTD 475
           + S +GS N+D   P+   N++ + SS R+    TS+NL EAR+P Y+  FSDE S+LT+
Sbjct: 467 KISMDGSLNHDLLAPNSLRNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTE 526

Query: 476 TFNTMTNALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGIL 535
           TFNTMT+ALDQHYALLEDRVRARTKQL             KTVFIANISHELRTPLNGIL
Sbjct: 527 TFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGIL 586

Query: 536 GMTAISMEERDIDKIQSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVA 595
           GMTAISMEE D++KI+++LKLIFRSG            FSKNVLQRTKLE+RDF ITDVA
Sbjct: 587 GMTAISMEETDVNKIRNNLKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVA 646

Query: 596 VQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKV 655
           +QIKSIFGKVAKDQRV+ SI+LFPN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDG V
Sbjct: 647 LQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTV 706

Query: 656 SVRMRLLGEYDKQRSENEDFKAVYVIDGTEPRE-----DGLIPPPVKQFEKQEDLEKEKI 710
            VRM+LLGEYDK  SE   FK V+V  GTE  +     D    P      K  +LE    
Sbjct: 707 DVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTA 766

Query: 711 S-------EKHNEEEASTSDSEKTNLDDKTPDSKRSDADDQVXXXXXXXXXXXXXXFHTQ 763
           S           EE    + +   N+  K  D ++S  DD                F++Q
Sbjct: 767 SITSCRDNSAIQEEITKRNTAANENIYKKANDREKSSNDDVSSIVSTTTSSYDDAIFNSQ 826

Query: 764 FKKHTSSSGDENGHL---LEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQ 820
           F K   S  DE+G++   +E+PK W IS+EVEDTGPGI+PSL ESVF+PFVQGDQ LSRQ
Sbjct: 827 FNKALDSDSDESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQ 886

Query: 821 YGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTR 864
           YGGTGLGLSICRQLA MM+GTMKL+S++GVGSKFTFTLPL QT+
Sbjct: 887 YGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQTK 930

 Score =  420 bits (1080), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 209/377 (55%), Positives = 260/377 (68%)

Query: 1   MRLGTIAKEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYV 60
           MR    ++  F PPFRI IR Q                   TGVYFTSNYK+LRS+RLY+
Sbjct: 1   MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61  AAQLKSSQIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXX 120
           AAQLKSSQ+DQ LNYLYYQ Y+            +YV+GNK++ NWVD            
Sbjct: 61  AAQLKSSQVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120

Query: 121 ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL 180
            LF VARVYD+ F TVLNATNNGTGD++ +DVL  L PLS+++ LP+SLE+ G+LTDP++
Sbjct: 121 NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180

Query: 181 NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI 240
           N T YLMSMSLPI+ANPSIILT+SRVYGY+TI+MSA+ LKSV++D TALEKS+V I+SA 
Sbjct: 181 NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240

Query: 241 YKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSA 300
           Y        Y FVF PYGT   I    +PI NN+F+S+  R GK GS ++T+ F  +  A
Sbjct: 241 YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300

Query: 301 VGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQP 360
           +GYSPCSF+ VNWVA++SQ E+VF+ P+T+LTK           FV + T PL HWAV+P
Sbjct: 301 LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360

Query: 361 IVRLQKATEIITEGRGL 377
           IVRLQKATE+ITEGRGL
Sbjct: 361 IVRLQKATELITEGRGL 377

 Score =  231 bits (590), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 109/161 (67%), Positives = 129/161 (80%), Gaps = 3/161 (1%)

Query: 928  EFSVGNVSLDRPFLQSTGTAXXXXXXXXXX---XXXXXYRILVAEDNHVNQEVIKRMLTL 984
            E ++G+V++DRPFLQSTGTA                   +ILV EDNHVNQEVI+RML L
Sbjct: 1051 EENLGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNL 1110

Query: 985  EGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPI 1044
            EGID I+LA DGQ+AFDKVK L  KGE+Y +IFMDVQMPKVDGLL+TKMIR+DL Y+ PI
Sbjct: 1111 EGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPI 1170

Query: 1045 VALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085
            VALTAFADDSNI+ CLE+GMNGFLSKPIKRPKL TI++++C
Sbjct: 1171 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFC 1211

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  504 bits (1297), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 271/452 (59%), Positives = 311/452 (68%), Gaps = 32/452 (7%)

Query: 442 SDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQ 501
           S ++    TS+NL+EARVP YR  FSDE S+LTDTFNTMT+ALDQHYALLEDRVRARTKQ
Sbjct: 514 STKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQ 573

Query: 502 LXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSG 561
           L             KTVFIANISHELRTPLNGILGMTAISMEE DI KI+SSLKLIFRSG
Sbjct: 574 LEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSG 633

Query: 562 XXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQ 621
                       FSKNVL+RT LEKRDF ITDVA+QIKSIFGKVAKDQRVK SITL PN 
Sbjct: 634 ELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNT 693

Query: 622 IRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVI 681
           IR MVLYGDSNRIIQIVMNLVSNALKFTPVDGKV+V+++L+GEYD+  S   +FK VYV 
Sbjct: 694 IRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVK 753

Query: 682 DGTE--------PREDGLIPPPVKQ-------------FEKQEDLEKEKISEKHNEEEAS 720
            GTE         + +  IP P  +                +   E EK ++  ++E+ +
Sbjct: 754 QGTELLGCSNPIEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFEDEKSADDLDDEKIA 813

Query: 721 TSDSEKTNLDD-KTPDSKRSDADDQVXXXXXXXXXXXXXXFHTQFKKHTSSSG----DEN 775
           T D+E  N DD +  D +     D +              F++QFKK   S G    DEN
Sbjct: 814 TKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKK---SPGLYDDDEN 870

Query: 776 ---GHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICR 832
              G L+E PK W I + VEDTGPGID +L ESVF+PFVQGDQ LSRQYGGTGLGLSICR
Sbjct: 871 NDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICR 930

Query: 833 QLATMMNGTMKLDSKLGVGSKFTFTLPLTQTR 864
           QLA MM+GTMKL S++GVGS FTFT+PL QTR
Sbjct: 931 QLANMMHGTMKLKSEVGVGSTFTFTVPLKQTR 962

 Score =  454 bits (1168), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 212/365 (58%), Positives = 264/365 (72%)

Query: 13  PPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLKSSQIDQN 72
           PPFRI IR Q                   TGVYFT+NYK+LRS+RLY+AAQLKSSQIDQ 
Sbjct: 11  PPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQIDQT 70

Query: 73  LNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSVARVYDAD 132
           LNYLYYQCY+            NYV+GNK++ NW D             LFSVA+VYDA 
Sbjct: 71  LNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYDAS 130

Query: 133 FQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSMSLP 192
           F TVLN TNNGTGD + D +LAKL+PLS+N+ L +SLE+ G+LTDPVLN ++YLMSMSLP
Sbjct: 131 FTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMSLP 190

Query: 193 IYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGLGSYRF 252
           I+ANPS+IL ESRVYGY+T++MSA+ L++V++D TALEKS+V IVSA+Y     L +YRF
Sbjct: 191 IFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAYRF 250

Query: 253 VFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFKFVN 312
           VFAP G    I++ T+ + N SFLS+ALR+GK GS + T  FY++  A+GYSPC+F FVN
Sbjct: 251 VFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSFVN 310

Query: 313 WVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVRLQKATEIIT 372
           WVA++SQ+E+VF+ PST+L K           FV I TFPLAHWAV+PIVRLQKATE+I+
Sbjct: 311 WVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATELIS 370

Query: 373 EGRGL 377
           EGRGL
Sbjct: 371 EGRGL 375

 Score =  233 bits (595), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 125/158 (79%), Gaps = 6/158 (3%)

Query: 934  VSLDRPFLQSTGTAXXXXXXXXXXXX------XXXYRILVAEDNHVNQEVIKRMLTLEGI 987
            VSLDRPFLQSTGTA                      +ILVAEDNHVNQEVIKRML LEG+
Sbjct: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153

Query: 988  DRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVAL 1047
            ++IDLA DGQ+AFDKVK L E+ + Y +IFMDVQMPKVDGLL+TKMIRKDL Y +PIVAL
Sbjct: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213

Query: 1048 TAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085
            TAFADDSNI+ CLE+GMNGFLSKPIKRPKL+TII +YC
Sbjct: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYC 1251

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
           YIL147C
          Length = 1214

 Score =  496 bits (1276), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/427 (62%), Positives = 300/427 (70%), Gaps = 18/427 (4%)

Query: 452 SNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLXXXXXXXXX 511
           S ++E +VPVYR  F DE SELTDTFNTM++ALDQHYALLE+RVRARTKQL         
Sbjct: 472 STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEA 531

Query: 512 XXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGXXXXXXXXXX 571
               KTVFIANISHELRTPLNGILGMTAISMEE DID I+SSLKLIFRSG          
Sbjct: 532 ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTEL 591

Query: 572 XXFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDS 631
             FSKNVLQRTKLE+RDF ITDVA+QIKSIFGKVAKDQ VK SI L PN+IR +VL+GDS
Sbjct: 592 LTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651

Query: 632 NRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPRE--- 688
           NRIIQIVMNLVSNALKFTP+DGKVSVRM LLGEYDK++S+  D+K V+V  GTEP E   
Sbjct: 652 NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711

Query: 689 --------DGLIPPPVKQFEKQEDLEKEKISEKHNEEEASTSDSEKTNLDDKTPDSKRSD 740
                   + LI     +    E+   E I EK N+  ++   S  T  D    +  R  
Sbjct: 712 KILQKLNTEKLIATRSARSCDNEERHNELIGEK-NDIISNNHQSSNTTFDISIHNRTR-- 768

Query: 741 ADDQVXXXXXXXXXXXXXXFHTQFKKHTSSSGDENGHL---LEHPKNWAISVEVEDTGPG 797
            DD +              F+ QFKK T     +   L   ++ PK W I +EVEDTGPG
Sbjct: 769 -DDTLSLLSTSTSSYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPG 827

Query: 798 IDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFT 857
           I P+L ESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM L+SK+G GSKFTFT
Sbjct: 828 IHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFT 887

Query: 858 LPLTQTR 864
           +PLTQTR
Sbjct: 888 VPLTQTR 894

 Score =  429 bits (1102), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 207/366 (56%), Positives = 250/366 (68%), Gaps = 1/366 (0%)

Query: 13  PPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLKSSQIDQN 72
           PP  I IRTQ                   TG+YFT NYK +R +RL +AA+LKSSQ+DQ 
Sbjct: 13  PPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQVDQT 72

Query: 73  LNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSVARVYDAD 132
           LN+LYYQCYW           ANY +GNK+ + W D             +FS++R+YDA+
Sbjct: 73  LNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLYDAN 132

Query: 133 FQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSMSLP 192
           F  V+NATNNGTG+V+ +DVLAKL+PLSS+  LPASL S GMLTDPVLN T+YLMSMSLP
Sbjct: 133 FNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTTYLMSMSLP 192

Query: 193 IYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKK-DQGLGSYR 251
           I ANPSIILT+S+VYGY+TIIMSA+SL SVY+D TALEKS+V IVS  Y      L  Y 
Sbjct: 193 ILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLTEYH 252

Query: 252 FVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFKFV 311
           FVF PYG TP I+D  +P+ N SFL  A+   K GS  +T  FYN   A+GYSPCSF  V
Sbjct: 253 FVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSFDLV 312

Query: 312 NWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVRLQKATEII 371
           +WVAI+SQ E+VF+ PST+LT+           FVC  TFPL+HWAV+PIVRLQKATE+I
Sbjct: 313 SWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATELI 372

Query: 372 TEGRGL 377
            EGRGL
Sbjct: 373 AEGRGL 378

 Score =  171 bits (433), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 100/125 (80%), Gaps = 5/125 (4%)

Query: 966  LVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQ-----EKGEHYELIFMDV 1020
            LV EDNHVNQEVIKRML LE +  IDLA DG++A+ KVK +      +K  +Y+LIFMDV
Sbjct: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132

Query: 1021 QMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTI 1080
            QMP++DGL +TK+IR +L Y  PIVALTAFAD+SNI+ CL+ GM+GFLSKPIKRPKLK I
Sbjct: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192

Query: 1081 IAQYC 1085
            + ++C
Sbjct: 1193 LNEFC 1197

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1127

 Score =  491 bits (1264), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 263/452 (58%), Positives = 313/452 (69%), Gaps = 17/452 (3%)

Query: 423 GSFNYDQAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTN 482
           G+ N   +   +N + ++SS  ++KY TS+NL+EARVPVY     DE SELTDTFNTMT+
Sbjct: 442 GNNNSSHSSMGINPDDDLSSS-SQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTD 500

Query: 483 ALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISM 542
           ALDQHY LLE+RVRARTKQL             KTVFIANISHELRTPLNGILGMTAISM
Sbjct: 501 ALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISM 560

Query: 543 EERDIDKIQSSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVAVQIKSIF 602
           EE D+DKI+ +LKLIFRSG            FSKNVLQRTKLEKRDF IT+VA+QIKSIF
Sbjct: 561 EEDDVDKIRGNLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITEVALQIKSIF 620

Query: 603 GKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLL 662
           GK+AKDQ VK SI L PN +R  VL+GDSNRIIQ+VMNLVSNALKFTPVDG V VR+ LL
Sbjct: 621 GKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLL 680

Query: 663 GEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQE--DLEKEKISEKHNEEEA- 719
           GEYD++RS+ ED+K VYV  GTE      +P  +   + +E  D+ ++  +E +N+E   
Sbjct: 681 GEYDEERSKAEDYKKVYVKQGTE------LPLNISHLKTEENNDISRKSETELNNDENET 734

Query: 720 ---STSDSEKTNLDDKTPDSKRSDADD--QVXXXXXXXXXXXXXXFHTQFKKHTSSSGDE 774
              S  D+  +++     D + S+ D                      Q  K T    DE
Sbjct: 735 HTISKDDTADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYDDTALMKQLIKSTDLDDDE 794

Query: 775 N--GHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICR 832
           N  G  L+  K W ISVEV+DTG GIDP L ESVFEPFVQGDQALSRQYGGTGLGLSIC+
Sbjct: 795 NKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICK 854

Query: 833 QLATMMNGTMKLDSKLGVGSKFTFTLPLTQTR 864
           QL+TMMNGTM+L+S++GVGSKF FTLPL QTR
Sbjct: 855 QLSTMMNGTMELESEVGVGSKFIFTLPLKQTR 886

 Score =  365 bits (936), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 179/373 (47%), Positives = 244/373 (65%), Gaps = 1/373 (0%)

Query: 6   IAKEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLK 65
           I K+ + PP+RISIR Q                    GVYFT+NYK+L++ RLY+AAQLK
Sbjct: 4   IPKKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLK 63

Query: 66  SSQIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSV 125
           +SQIDQ LNYLYYQCY+            +Y +GN +  NW +             LFSV
Sbjct: 64  ASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSV 123

Query: 126 ARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSY 185
           AR+YD +F  ++NATNN +G+ + + V+ KL  LS N++LP+SLE+ G+ TDPVLNG+++
Sbjct: 124 ARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNF 183

Query: 186 LMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQ 245
           LMSMSLPI+ANPSIIL++SR+YGY+++IMSA+ LKSV++D TALE S V ++SA Y    
Sbjct: 184 LMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITT 243

Query: 246 GLGSYRFVFA-PYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYS 304
            L  + F+FA  Y       D  + I+N++F+   L  GK G+ ++T+ F    +AVGYS
Sbjct: 244 NLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYS 303

Query: 305 PCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVRL 364
            CSF  VNW+AI++Q EA F E +T+L +           FVC+ TFPL+HWAVQP++RL
Sbjct: 304 SCSFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRL 363

Query: 365 QKATEIITEGRGL 377
           QKATE I EGRGL
Sbjct: 364 QKATERIAEGRGL 376

 Score =  192 bits (489), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 96/166 (57%), Positives = 113/166 (68%), Gaps = 12/166 (7%)

Query: 934  VSLDRPFLQSTGTAXXXX------------XXXXXXXXXXXYRILVAEDNHVNQEVIKRM 981
            V L+RPFLQSTGTA                             ILVAEDNHVNQEVIKRM
Sbjct: 960  VRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRM 1019

Query: 982  LTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQ 1041
            L LEGI+ IDLA DGQDAFDK K L E   +Y++IFMDVQMP++DGL ATKMIR++L+Y 
Sbjct: 1020 LKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYT 1079

Query: 1042 YPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYCHD 1087
             PIVAL+AF  + N++ CL+ GMN FLSKPIKRP LK I+ +Y  D
Sbjct: 1080 QPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIED 1125

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score =  488 bits (1256), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 266/457 (58%), Positives = 311/457 (68%), Gaps = 48/457 (10%)

Query: 442 SDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQ 501
           S+R++K  TS+NL+EARVP YR  FSDE S+LTDTFN MT+ALDQHYALLEDRVRARTKQ
Sbjct: 474 SNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQ 533

Query: 502 LXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSG 561
           L             KT+FIANISHELRTPLNGILGMTAISMEE DI KI+SSLKLIFRSG
Sbjct: 534 LEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSG 593

Query: 562 XXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQ 621
                       FSKNVL+RT LEKRDF ITDVA+QIKSIFGKVAKDQRV+ SI L PN 
Sbjct: 594 ELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNI 653

Query: 622 IRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVI 681
           IR M+L+GDSNRIIQIVMNLVSNALKFTPVDGKV+VR++L+GEYD+  S   +FK V V 
Sbjct: 654 IRTMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVK 713

Query: 682 DGT---EPREDGLIPPPVKQFEKQEDLEKEKISEKHNEEE--------ASTSDSEK---- 726
            GT   E +   ++  P K   K       +I E  N           ++TSD +K    
Sbjct: 714 SGTEFIETKAKAILGAPKKDDPKTSTESVVQIKENLNSNTSSSSNDIISTTSDEKKYDEK 773

Query: 727 ---------------TNLDDKT-PDSKRSDADDQVXXXXXXXXXXXXXXFHTQFKKHTSS 770
                          T+++ ++   +  S  DD V              F+ QFKK    
Sbjct: 774 EDEGEEDNSDNDNDDTSMETQSIVSTSTSSYDDAV--------------FNNQFKKTPEL 819

Query: 771 SGDENGHL---LEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLG 827
             DE+G+L   L +PK W I++EV+DTGPGIDPSL +SVFEPFVQGDQ LSRQYGGTGLG
Sbjct: 820 YEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLG 879

Query: 828 LSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTR 864
           LSICRQLA MMNGTM+L S++GVGS FTFT+PL QTR
Sbjct: 880 LSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTR 916

 Score =  445 bits (1144), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 208/367 (56%), Positives = 261/367 (71%)

Query: 11  FSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLKSSQID 70
             PPFR+ IRTQ                   TGVYFTSNYK+LRS+RLY+AAQLKSSQID
Sbjct: 11  LKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70

Query: 71  QNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSVARVYD 130
           QNLNYLYYQ YW            NYV+GNKT  NW D             LFS A++YD
Sbjct: 71  QNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYD 130

Query: 131 ADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSMS 190
           + F  VL ATNNGTGD++ + VL KL PL++N  L +SLE+ G+LTDPVLNG++Y+MSMS
Sbjct: 131 SSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMS 190

Query: 191 LPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGLGSY 250
           LPI+ANPSIILT+S+VYGY+TI+MSA+ LK+V++D TALE+S+V IVS +Y  +  L +Y
Sbjct: 191 LPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAY 250

Query: 251 RFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFKF 310
            FVFAPYG    +++ T+ I NNSFL+ ALR+GK GS ++T  FY +  AVGYSPC+F F
Sbjct: 251 HFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSF 310

Query: 311 VNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVRLQKATEI 370
           VNW+AI+SQ E+VF+ PST+L K           FV + TFPLAHWAV+PIVRLQKATE+
Sbjct: 311 VNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATEL 370

Query: 371 ITEGRGL 377
           ++EGRGL
Sbjct: 371 MSEGRGL 377

 Score =  243 bits (620), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 110/155 (70%), Positives = 130/155 (83%)

Query: 931  VGNVSLDRPFLQSTGTAXXXXXXXXXXXXXXXYRILVAEDNHVNQEVIKRMLTLEGIDRI 990
            +G V++DRPFLQSTGTA               ++ILVAEDNHVNQEVIKRML LEG++ I
Sbjct: 1013 LGTVNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENI 1072

Query: 991  DLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAF 1050
            +LA DGQDAF++VKA+ E+GEH+++IFMDVQMPKVDGLL+TKMIR DL Y YPIVALTAF
Sbjct: 1073 ELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAF 1132

Query: 1051 ADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085
            ADDSNI+ CLEAGMNGFLSKPIKRPK+KTI+ +YC
Sbjct: 1133 ADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYC 1167

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1200

 Score =  486 bits (1250), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 265/435 (60%), Positives = 300/435 (68%), Gaps = 21/435 (4%)

Query: 442 SDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQ 501
           S+ ++ Y T+ NL++ARVP YR  F DE S+LT+TFNTMT+ALDQHYALLE+RVRARTKQ
Sbjct: 469 SNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQ 528

Query: 502 LXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSG 561
           L             KTVFIANISHELRTPLNGILGMTAISMEE DIDKI++SLKLIFRSG
Sbjct: 529 LEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSG 588

Query: 562 XXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQ 621
                       FSKNVL+RTKLEKR+F ITDVA+QIKSIFGKVAKDQ V+ SI L PN 
Sbjct: 589 ELLLHILTELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNM 648

Query: 622 IRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVI 681
           IR MVLYGDSNRIIQIVMNLVSNALKFTPVDGKV VRM++LG YD+  SE  +   VYV 
Sbjct: 649 IRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVK 708

Query: 682 DGTEPREDGLIPPPVKQFEKQEDLEKEKISEKHNEEEASTSDSEKTNLDDKTPDSKR--- 738
            GTE  +     P +    K E   K+K +     +  ++SD+      D TP + R   
Sbjct: 709 PGTEITDS---TPSLNV--KSEGQGKDKFTSDTASKNNTSSDTAY----DATPTTDRVAQ 759

Query: 739 -SDAD----DQVXXXXXXXXXXXXXXFHTQFKKHTS----SSGDENGHLLEHPKNWAISV 789
            SD D    D                F++QFKK T+        E G  LE PK W IS 
Sbjct: 760 ESDEDNMYEDNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISF 819

Query: 790 EVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLG 849
           EVED+GPGID  L ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM G M L+SK+G
Sbjct: 820 EVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVG 879

Query: 850 VGSKFTFTLPLTQTR 864
           VGSKFTFTLPLTQTR
Sbjct: 880 VGSKFTFTLPLTQTR 894

 Score =  458 bits (1179), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 215/365 (58%), Positives = 267/365 (73%)

Query: 13  PPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLKSSQIDQN 72
           PP+R+ IR Q                   TGVYFTSNYK+LRS+RLY+AAQLKSSQIDQN
Sbjct: 12  PPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQN 71

Query: 73  LNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSVARVYDAD 132
           LNYLYYQCYW           ANYV+GNK+DANW+D             LFSVARVYD+ 
Sbjct: 72  LNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDSS 131

Query: 133 FQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSMSLP 192
           F TVLN TNN TGD++ +DVL +L+PLS+N+ LP+SLE+ G++T+PV NG+SYLMSMSLP
Sbjct: 132 FTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSLP 191

Query: 193 IYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGLGSYRF 252
           I+ANPSIILT+SRVYGYVT++MSA+ L SV++D TALE+S V IVSA+Y     L +YRF
Sbjct: 192 IFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYRF 251

Query: 253 VFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFKFVN 312
           VF P+G+T  IL+ET+P+NNN+FLS+ALRQGK G+ + T LFY    AVGYSP +    N
Sbjct: 252 VFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLAN 311

Query: 313 WVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVRLQKATEIIT 372
           WVAI++Q+E+VF+ P+T+L K           F  + TFPLAHWAV+PIVRLQKATE+IT
Sbjct: 312 WVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELIT 371

Query: 373 EGRGL 377
           E RGL
Sbjct: 372 ESRGL 376

 Score =  220 bits (560), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 127/189 (67%), Gaps = 29/189 (15%)

Query: 934  VSLDRPFLQSTGTAXXXXX-------------------------XXXXXXXXXXYRILVA 968
            +SLDRPFLQSTGTA                                        Y+ILVA
Sbjct: 1011 MSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVA 1070

Query: 969  EDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGL 1028
            EDNHVNQEVIKRML LEG+  IDLA DGQDAFDKVK LQ+KG  Y LIFMDVQMPKVDGL
Sbjct: 1071 EDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGL 1130

Query: 1029 LATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYCHD- 1087
             +TKMIR DL   +PIVALTAFADDSNI+ CL+AGM+GFLSKPIKR KLKTI+ ++C D 
Sbjct: 1131 TSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSDE 1190

Query: 1088 ---DSKVVD 1093
               DSK V+
Sbjct: 1191 REEDSKPVE 1199

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1187

 Score =  477 bits (1227), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 259/442 (58%), Positives = 300/442 (67%), Gaps = 22/442 (4%)

Query: 442 SDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQ 501
           S+R++  +T +NL EARVP+ R  F DE S+LT+TFNTMT+ALD+HY LLEDRVRARTKQ
Sbjct: 489 SERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTKQ 548

Query: 502 LXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSG 561
           L             KTVFIANISHELRTPLNGILGMTAISMEE DI KI+SSLKLIFRSG
Sbjct: 549 LEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSG 608

Query: 562 XXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQ 621
                       FSKNVLQRTKLEKR+F ITDVA+Q+KSIFGKVAKDQ V+ SI L PN 
Sbjct: 609 ELLLHILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNI 668

Query: 622 IRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVI 681
           +R MVLYGDSNRIIQ+VMNLVSNALKFTPVDGKV V+++LLGEYD++ S+N  F+ VYV 
Sbjct: 669 MRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVK 728

Query: 682 DGTEPREDGLIPPPVKQFEKQEDLE-----------KEKI----SEKHNEEEASTSDSEK 726
            GTE      IP  +    K+E              KEK+    +     +  S   SE 
Sbjct: 729 GGTEFTS---IPAELAALSKRESTAGSHFSGSSSHIKEKLDGIPANVFASDSDSDDPSEG 785

Query: 727 TNLD-DKTPDSKRSDADDQVXXXXXXXXXXXXXXFHTQFKKHTSSSGDENGHL---LEHP 782
           T ++  +   S   D  D +              F++QFKK      DE+G+L   L   
Sbjct: 786 TTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQ 845

Query: 783 KNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM 842
           K W   +EV DTGPGID SL ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLATMMNGTM
Sbjct: 846 KTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTM 905

Query: 843 KLDSKLGVGSKFTFTLPLTQTR 864
            L+S +G GSKF FT+PLTQTR
Sbjct: 906 TLESTVGSGSKFIFTVPLTQTR 927

 Score =  422 bits (1085), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 203/376 (53%), Positives = 255/376 (67%)

Query: 2   RLGTIAKEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVA 61
           RL  +A     PP+RISIRTQ                   TGVYFTS+YK+LR+ RLY+A
Sbjct: 14  RLKRLAHLNTKPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIA 73

Query: 62  AQLKSSQIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXA 121
           AQLKSSQIDQ L YLYYQ YW           AN+V+GNK+ +NW               
Sbjct: 74  AQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSD 133

Query: 122 LFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLN 181
            FS  +VYD +F TVL+ TNNGTG+ +  DVL KL PLS+N+ L +SLE+ G+LTDPVLN
Sbjct: 134 YFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLN 193

Query: 182 GTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIY 241
           GTSYLMSMSLP++ANPSIIL+ SRVYGY+TIIM+AD L SV++D TA+EKS+V IVSA+Y
Sbjct: 194 GTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVY 253

Query: 242 KKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAV 301
                L +Y     PYG T  + D  + + N+SFL+ AL+QGK GS ++T   YN+  AV
Sbjct: 254 NNQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAV 313

Query: 302 GYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPI 361
           GYSPCSF+  NWV+++SQ+E+VF  PST+LTK           FV + T PLA++AV+PI
Sbjct: 314 GYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPI 373

Query: 362 VRLQKATEIITEGRGL 377
           VRL+KATEIITEGRGL
Sbjct: 374 VRLKKATEIITEGRGL 389

 Score =  237 bits (604), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 109/156 (69%), Positives = 127/156 (81%)

Query: 930  SVGNVSLDRPFLQSTGTAXXXXXXXXXXXXXXXYRILVAEDNHVNQEVIKRMLTLEGIDR 989
            S  N++LDRPFLQSTGTA                 +LVAEDNHVNQEVIKRML+LEG+  
Sbjct: 1010 SGSNLNLDRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKN 1069

Query: 990  IDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTA 1049
            IDLA DGQDAFD VK+L+E+GE Y++IFMDVQMPKVDGL ATKMIR DL Y++PIVALTA
Sbjct: 1070 IDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTA 1129

Query: 1050 FADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085
            FADDSNI+ CL+AGM+GFLSKPIKRP+LKTI+ +YC
Sbjct: 1130 FADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEYC 1165

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
           similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  474 bits (1220), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 245/429 (57%), Positives = 298/429 (69%), Gaps = 24/429 (5%)

Query: 442 SDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQ 501
           S+R   + TS+N +E RVPVYR  FSDE SELTDTFN+MT+ LD+HYALLEDRVRARTKQ
Sbjct: 469 SERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQ 528

Query: 502 LXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSG 561
           L             KT+FIANISHELRTPLNGILGMTAI+M E D++K+Q+SLKLIFRSG
Sbjct: 529 LEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSG 588

Query: 562 XXXXXXXXXXXXFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQ 621
                       FSKN+L+R KLE+R+FS+ DVA+Q+KSIFGK+AKDQ VKFSI L PN 
Sbjct: 589 ELLLHILTELLTFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNL 648

Query: 622 IRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVI 681
           IRKMVL+GDSNRIIQIVMNLVSNALKFTPVDGKVS+R++LLGEYD++ SE  +   V++ 
Sbjct: 649 IRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIK 708

Query: 682 DGTEPREDGLIPPPVKQFEKQEDLEKEKISEKHNEEEASTSDSEKTN--LDDKTPDSKRS 739
            GTE  +                 E + + +   EE+  +   E T+  ++     +++ 
Sbjct: 709 QGTEISD-----------------ETKNVFDTITEEKYVSCSGESTDDTIETGQEGAQKP 751

Query: 740 DADDQVXXXXXXXXXXXXXXFHTQFKKHTSSSGDENGHL-----LEHPKNWAISVEVEDT 794
           D  D +              FH++FKK  +    + G L      E  K W IS+EVEDT
Sbjct: 752 DKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVEDT 811

Query: 795 GPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKF 854
           GPGIDPSL ESVF+PFVQGDQ LSRQYGGTGLGLSICRQL+TMM GTMKL S++GVGSKF
Sbjct: 812 GPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKF 871

Query: 855 TFTLPLTQT 863
            FT+PL QT
Sbjct: 872 IFTVPLRQT 880

 Score =  297 bits (760), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 163/373 (43%), Positives = 226/373 (60%), Gaps = 1/373 (0%)

Query: 6   IAKEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLK 65
           I K  F PP++  + TQ                   TGVYFT+NYKSLR++RL VAAQL 
Sbjct: 18  IRKHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLT 77

Query: 66  SSQIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSV 125
           S+QI+Q LN +YYQCYW            +Y  GN +  N  +                 
Sbjct: 78  SAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFR 137

Query: 126 ARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSY 185
             +YD+ F  VL+ + N TG+++GDD+L  L+PLSSN  LP+S+  +GML++PV NG+S+
Sbjct: 138 THLYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSF 197

Query: 186 LMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQ 245
            MSMSLP+ A  SI+  +S   GY+T++MSAD + SV   + AL  S+V++++ +Y ++ 
Sbjct: 198 FMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENN 257

Query: 246 GLGSYRFVFAP-YGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYS 304
            L SY+ +F P     P +L+  +PI NNSFL  A     +GS  +T+ FY    AVGY+
Sbjct: 258 ILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYA 317

Query: 305 PCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVRL 364
            CSFK VNWVA+++Q EAVF+ PST+LTK           F+CI TF +A+WAV+PIVRL
Sbjct: 318 ACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRL 377

Query: 365 QKATEIITEGRGL 377
           QKATE+I  GRGL
Sbjct: 378 QKATELIAAGRGL 390

 Score =  207 bits (528), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 119/150 (79%)

Query: 936  LDRPFLQSTGTAXXXXXXXXXXXXXXXYRILVAEDNHVNQEVIKRMLTLEGIDRIDLAAD 995
            +DRPFLQSTGTA               +++LVAEDN+VNQEVIKRML LEGI  I+LA D
Sbjct: 951  VDRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACD 1010

Query: 996  GQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSN 1055
            G++A +KV  L  + +HY ++FMDVQMPK+DGL+AT+ IRK+L+Y YPIVALTAFADDSN
Sbjct: 1011 GEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSN 1070

Query: 1056 IRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085
            I+VCLE+GM+GFLSKPIKR KL+ I+ +YC
Sbjct: 1071 IKVCLESGMDGFLSKPIKREKLRKILLEYC 1100

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  363 bits (933), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 207/434 (47%), Positives = 267/434 (61%), Gaps = 19/434 (4%)

Query: 448 YMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLXXXXX 507
           +++ S   E +VPVYR  F DE +ELTDTFN M+NALD+HYALLE RV  RTKQL     
Sbjct: 474 HVSLSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKV 533

Query: 508 XXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGXXXXXX 567
                   KTVFIANISHELRTPLNGILGMT+ S+EE DI KI+  LKLIFRSG      
Sbjct: 534 QAEAANEAKTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNI 593

Query: 568 XXXXXXFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQ-IRKMV 626
                 FSKNVL +TKLE R+F+I ++  QIK+IF K+ + Q VK  I L P + ++ ++
Sbjct: 594 LTELLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLL 653

Query: 627 LYGDSNRIIQIVMNLVSNALKFTP-VDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTE 685
            YGDSNRI+Q++MNL+SNA+KFTP V+GKV V M LLGEYD++ S+ E++  V +   T+
Sbjct: 654 FYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQ 713

Query: 686 -PREDG-LIPPPVK-QFEKQEDLEKEKISEKHNEEEAST----SDSEKTNLDDKT---PD 735
              E G LI   ++ +  K         +      E++T    S    TN    T    D
Sbjct: 714 IVTESGELIKSKIRCKITKSTTNMNTATTNNSARIESNTNQYLSPYSHTNTRTHTHPGAD 773

Query: 736 SKRSDADDQVXXXXXXXXXXXXXXF-HTQFKKHTSSSGDENGH------LLEHPKNWAIS 788
           S+R+     V              + +  F +     GD + +       +E  K W I 
Sbjct: 774 SRRNSNVSTVNNSSISLDSESSKMYDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIR 833

Query: 789 VEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKL 848
            EV D GPGID +LH+SVF+PFVQGDQ LSRQYGGTGLGLSIC+QL  MM GT++L+S+L
Sbjct: 834 FEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESEL 893

Query: 849 GVGSKFTFTLPLTQ 862
           G GSKF +T+PL Q
Sbjct: 894 GKGSKFIYTIPLLQ 907

 Score =  285 bits (730), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 146/374 (39%), Positives = 215/374 (57%), Gaps = 4/374 (1%)

Query: 8   KEKFSPPFRISIRTQXXXXXXXXXXXXXXXXXXXTGVYFTSNYKSLRSERLYVAAQLKSS 67
           K+   PP+R S+R Q                   TGVYFT++YK L   RLY+A+QLKSS
Sbjct: 14  KQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQLKSS 73

Query: 68  QIDQNLNYLYYQCYWXXXXXXXXXXXANYVSGNKTDANWVDXXXXXXXXXXXXALFSVAR 127
           QIDQ LNYLYYQCYW            +  +G    +  ++             LF    
Sbjct: 74  QIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTM 133

Query: 128 VYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSS-NMALPASLESEGMLTDPVLNGTSYL 186
           +YD + ++++N+TNN +G  +   +L++L+PLSS N  +P  + + G+LTDP+LN T YL
Sbjct: 134 IYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNSTKYL 193

Query: 187 MSMSLPI---YANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKK 243
           MSMSLPI   Y+  + I  +S +YGY+T++MSA+SLKSV++D   L  S+  ++SAIY  
Sbjct: 194 MSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTN 253

Query: 244 DQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGY 303
           D     + FVF P+     I+DE   I N +F   A  + K+GS+++  L   +  A+GY
Sbjct: 254 DTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNYAIGY 313

Query: 304 SPCSFKFVNWVAIISQSEAVFMEPSTRLTKXXXXXXXXXXAFVCIATFPLAHWAVQPIVR 363
           +P +F    WVA+++  +  F   S +LTK           FV + + PL++WAVQPIVR
Sbjct: 314 APTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVR 373

Query: 364 LQKATEIITEGRGL 377
           LQ+A+E+IT+ RGL
Sbjct: 374 LQRASELITKRRGL 387

 Score =  149 bits (375), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 95/124 (76%)

Query: 964  RILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMP 1023
            ++LVAEDN VNQEVIKRML LE I  I+LA DG +AF+KVK      + Y++IFMD+QMP
Sbjct: 1016 KVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMP 1075

Query: 1024 KVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQ 1083
            K+DGL +T  IR++L Y+  IVALTAFAD+SNI+ C +AGM+GF+ KPIKR  L T++ +
Sbjct: 1076 KMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEE 1135

Query: 1084 YCHD 1087
            +  D
Sbjct: 1136 FQQD 1139

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 69/125 (55%), Gaps = 7/125 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V  ++  + L   G   +++  DG  A + V+  Q     Y+L+ MD+ M
Sbjct: 318  FHVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEKFQ-----YDLVLMDIVM 371

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT +IR   D Q PI+A+T   +D ++   L+ GMN  L+KP  +  L +++ 
Sbjct: 372  PNLDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLV 430

Query: 1083 QYCHD 1087
            +Y  D
Sbjct: 431  RYLKD 435

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 69/125 (55%), Gaps = 7/125 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V  ++  + L   G   +++  DG  A + V+  Q     Y+L+ MD+ M
Sbjct: 329  FCVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEKFQ-----YDLVLMDIVM 382

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT +IR   D Q PI+A+T   +D ++   L+ GMN  L+KP  +  L +++ 
Sbjct: 383  PNLDGATATSVIRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 441

Query: 1083 QYCHD 1087
            +Y  D
Sbjct: 442  RYLKD 446

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 72/133 (54%), Gaps = 7/133 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ ++ ++  + L   G   + +  DG  A   ++        Y+L+ MD+ M
Sbjct: 403  FHVLLVEDDAISIQLCSKFLRKYGC-TVQVVTDGLSAITTLE-----NSRYDLVLMDIVM 456

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT +IR   D Q PI+A+T   DD ++   L+ GMN  L+KP  R  L +++ 
Sbjct: 457  PNLDGATATSIIRS-FDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSMLI 515

Query: 1083 QYCHDDSKVVDKE 1095
            +Y  D + + +++
Sbjct: 516  RYLKDRTPLCEQK 528

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 71/132 (53%), Gaps = 7/132 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V+ ++  + L   G   + +  DG  A   ++  +     Y+L+ MD+ M
Sbjct: 405  FHVLLVEDDSVSIQLCSKFLRKYGC-TVQVVTDGLSAISNLEKFR-----YDLVLMDIVM 458

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT ++R   D Q PI+A+T   +D ++   L+ GMN  L+KP  R  L +I+ 
Sbjct: 459  PNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSILI 517

Query: 1083 QYCHDDSKVVDK 1094
            ++  D   + D+
Sbjct: 518  RHLKDRIPLCDQ 529

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 69/125 (55%), Gaps = 7/125 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ ++ ++  + L   G   +++  DG  A   ++  +     Y+L+ MD+ M
Sbjct: 353  FHVLLVEDDAISIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKFR-----YDLVLMDIVM 406

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT +IR   D Q PI+A+T   +D ++   L+ GMN  L+KP  R  L +++ 
Sbjct: 407  PNLDGATATSIIRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLI 465

Query: 1083 QYCHD 1087
            +Y  D
Sbjct: 466  RYLKD 470

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 68/125 (54%), Gaps = 7/125 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V  ++  + L   G   +++  DG  A   ++  +     Y+L+ MD+ M
Sbjct: 307  FHVLLVEDDSVCIQLCSKFLLKYGC-SVEVVTDGLSAISTLEKFR-----YDLVLMDIVM 360

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT ++R   D Q PI+A+T   +D ++   LE GMN  L+KP  +  L +++ 
Sbjct: 361  PNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLI 419

Query: 1083 QYCHD 1087
            +Y  D
Sbjct: 420  RYLKD 424

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 73/133 (54%), Gaps = 7/133 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V+  +  + L   G   +++  DG  A   ++  +     Y+L+ MD+ M
Sbjct: 381  FHVLLVEDDAVSIRLCSKFLRKYGC-TVEVVTDGLSAISTLEKFR-----YDLVLMDIVM 434

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT +IR + D Q PI+A+T   +D ++   L+ GMN  L+KP  +  L +++ 
Sbjct: 435  PNLDGATATSIIR-NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 493

Query: 1083 QYCHDDSKVVDKE 1095
            +Y  D   + D++
Sbjct: 494  RYLKDRIPLRDQQ 506

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 71/133 (53%), Gaps = 7/133 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V  ++  + L   G   +++  DG  A   ++  +     Y+L+ MD+ M
Sbjct: 334  FHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKFR-----YDLVLMDIVM 387

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT ++R   D   PI+A+T   +D ++   L+ GMN  L+KP  +  L +++ 
Sbjct: 388  PNLDGATATSIVRS-FDNHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 446

Query: 1083 QYCHDDSKVVDKE 1095
            +Y  D   +V ++
Sbjct: 447  RYLKDRVPLVKQQ 459

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 68/125 (54%), Gaps = 7/125 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ +  ++  + L   G   +++  DG  A   ++  +     Y+L+ MD+ M
Sbjct: 305  FHVLLVEDDSICIQLCSKFLMKYGC-TVEVVTDGLSAISTLEKFR-----YDLVLMDIVM 358

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT ++R   D Q PI+A+T   +D ++   L+ GMN  L+KP  +  L +++ 
Sbjct: 359  PNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 417

Query: 1083 QYCHD 1087
            +Y  +
Sbjct: 418  RYLRN 422

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 68/125 (54%), Gaps = 7/125 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V  ++  + L   G   +++  DG  A   ++      + ++L+ MD+ M
Sbjct: 329  FHVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAISTLEK-----QRFDLVLMDIVM 382

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT ++R   D + PI+A+T   DD ++   L+ GMN  L+KP  +  L +++ 
Sbjct: 383  PNLDGATATSIVRS-FDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 441

Query: 1083 QYCHD 1087
            +Y  D
Sbjct: 442  RYLKD 446

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 71/133 (53%), Gaps = 7/133 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V+ ++  + L   G   + +  DG  A   ++  +     Y+L+ MD+ M
Sbjct: 379  FHVLLVEDDAVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKFR-----YDLVLMDIVM 432

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT ++R   D + PI+A+T    + ++   L+ GMN  L+KP  R  L +I+ 
Sbjct: 433  PNLDGATATSIVRS-FDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 491

Query: 1083 QYCHDDSKVVDKE 1095
            +Y  D   + +++
Sbjct: 492  RYLKDRIPLCEQQ 504

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 72/133 (54%), Gaps = 7/133 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V+ ++  + L   G   + + +DG  A   ++  +     Y+L+ MD+ M
Sbjct: 377  FHVLLVEDDAVSIQLCSKFLRKYGC-TVQVVSDGLSAISTLEKYR-----YDLVLMDIVM 430

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT ++R   D + PI+A+T    + ++   L+ GMN  L+KP  R  L +I+ 
Sbjct: 431  PNLDGATATSIVRS-FDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 489

Query: 1083 QYCHDDSKVVDKE 1095
            +Y  D   + +++
Sbjct: 490  RYLKDRIPLCEQQ 502

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 71/133 (53%), Gaps = 7/133 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V  ++  + L   G   +++  DG  A   ++  +     Y+L+ MD+ M
Sbjct: 376  FHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLAAISTLEKFR-----YDLVLMDIVM 429

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT ++R   D   PI+A+T   +D ++   L+ GMN  L+KP  +  L +++ 
Sbjct: 430  PNLDGATATSIVRS-FDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 488

Query: 1083 QYCHDDSKVVDKE 1095
            +Y  D   ++ ++
Sbjct: 489  RYLRDRVPLIKQQ 501

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 69/122 (56%), Gaps = 7/122 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            Y +L+ ED+ V+ ++  + L   G   +++  DG  A   ++A +     Y+L+ MD+ M
Sbjct: 424  YHVLLVEDDAVSIQLCSKFLRKSGCT-VEVVTDGLAAISILEAFR-----YDLVLMDIVM 477

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT +IR + D + PI+A+T   +D ++   L+ GM   L+KP  R  L +++ 
Sbjct: 478  PNLDGATATSIIR-NFDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSMLI 536

Query: 1083 QY 1084
            ++
Sbjct: 537  RH 538

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 71/133 (53%), Gaps = 7/133 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V+ ++  + L   G   + +  DG  A   ++  +     Y+L+ MD+ M
Sbjct: 378  FHVLLVEDDAVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKFR-----YDLVLMDIVM 431

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT ++R   D + PI+A+T    + ++   L+ GMN  L+KP  R  L +I+ 
Sbjct: 432  PNLDGATATSIVRS-FDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 490

Query: 1083 QYCHDDSKVVDKE 1095
            +Y  D   + +++
Sbjct: 491  RYLKDRIPLCEQQ 503

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 71/133 (53%), Gaps = 7/133 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V+ ++  + L   G   + +  DG  A   ++  +     Y+L+ MD+ M
Sbjct: 379  FHVLLVEDDVVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKFR-----YDLVLMDIVM 432

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT ++R   D + PI+A+T    + ++   L+ GMN  L+KP  R  L +I+ 
Sbjct: 433  PNLDGATATSIVRS-FDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 491

Query: 1083 QYCHDDSKVVDKE 1095
            +Y  D   + +++
Sbjct: 492  RYLKDRIPLCEQQ 504

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 72/133 (54%), Gaps = 7/133 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V+ ++  + L   G   + +  DG  A   ++  +     ++L+ MD+ M
Sbjct: 382  FHVLLVEDDDVSIQLCSKFLRKYGC-TVQVVTDGLAAISILEKFR-----FDLVLMDIVM 435

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT +IR + D + PI+A+T   +  ++   L+ GMN  L+KP  R  L +I+ 
Sbjct: 436  PNLDGATATSIIR-NFDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLYSILI 494

Query: 1083 QYCHDDSKVVDKE 1095
            +Y  D   + D++
Sbjct: 495  RYLKDRVPISDQK 507

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 69/125 (55%), Gaps = 7/125 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ +  ++  + L ++    +++  DG  A   ++  +     ++L+ MD+ M
Sbjct: 302  FHVLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKFR-----FDLVLMDIVM 355

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT ++R   D Q PI+A+T   +D ++   L+ GMN  L+KP  +  L +++ 
Sbjct: 356  PNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 414

Query: 1083 QYCHD 1087
            +Y  +
Sbjct: 415  RYLRN 419

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 66/125 (52%), Gaps = 7/125 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V  ++  + L   G   + +  DG  A   ++        ++L+ MD+ M
Sbjct: 416  FHVLLVEDDEVCIQLCSKFLRKYGC-TVRVVTDGLTAISVLE-----NHRFDLVLMDIVM 469

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT ++R + D   PI+A+T   +D ++   L+ GMN  L+KP  +  L +++ 
Sbjct: 470  PNLDGATATSIVR-NFDNYTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLV 528

Query: 1083 QYCHD 1087
            +Y  D
Sbjct: 529  RYLRD 533

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 68/125 (54%), Gaps = 7/125 (5%)

Query: 963  YRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQM 1022
            + +L+ ED+ V+ ++  + L   G   + +  DG  A   ++  +     ++L+ MD+ M
Sbjct: 350  FNVLLVEDDEVSIQLCSKFLIKYGC-TVQVVTDGLAAISTLEKYR-----FDLVLMDIVM 403

Query: 1023 PKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIA 1082
            P +DG  AT +IR + D + PI+A+T   +  ++   L+ GMN  L+KP  R  L +++ 
Sbjct: 404  PNLDGATATSIIR-NFDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSMLT 462

Query: 1083 QYCHD 1087
            +Y  +
Sbjct: 463  RYLKN 467

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 74/148 (50%), Gaps = 34/148 (22%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I   ++A +G +A +K +   + G H  LI MD+Q+P 
Sbjct: 551  VLIVEDNIINQAILVSFLKRHRIS-YEIAKNGAEAVEKWR---QGGIH--LILMDLQLPL 604

Query: 1025 VDGLLATKMIRK-----------------------DLD---YQYP--IVALTAFADDSNI 1056
            + GL ATK IR                        DLD   ++ P  IVALTAF+  ++ 
Sbjct: 605  LSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSHADR 664

Query: 1057 RVCLEAGMNGFLSKPIKRPKLKTIIAQY 1084
            R  L AG N +L+KP+    L + I ++
Sbjct: 665  REALVAGCNDYLTKPVNLDWLSSKITEW 692

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 68/147 (46%), Gaps = 33/147 (22%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    LA +GQ+A   V   +E G H  LIFMD+Q+P 
Sbjct: 488  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEA---VNIWKEGGLH--LIFMDLQLPV 541

Query: 1025 VDGLLATKMIR-----------KDLDYQYP----------------IVALTAFADDSNIR 1057
            + G+ A K IR           K L+  YP                IVALTA     + R
Sbjct: 542  LSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMDKR 601

Query: 1058 VCLEAGMNGFLSKPIKRPKLKTIIAQY 1084
              L +G N +L+KP+    L   I ++
Sbjct: 602  KALVSGCNDYLTKPVNLHWLSKKITEW 628

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 67/126 (53%), Gaps = 13/126 (10%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    +A +G++A   V+  +  G H  LIFMD+Q+P 
Sbjct: 477  VLIVEDNVINQAILGGFLRKHKIS-YKVAKNGKEA---VEMWKNGGLH--LIFMDLQLPV 530

Query: 1025 VDGLLATKMIRKDLDYQYP------IVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLK 1078
            + G+ A K IR D + + P      IVALTA     + R  L +G N +L+KP+    L 
Sbjct: 531  LSGIDAAKQIR-DFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHWLS 589

Query: 1079 TIIAQY 1084
              I ++
Sbjct: 590  KKITEW 595

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    +A +G++A D  K   E G H  LIFMD+Q+P 
Sbjct: 519  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWK---EGGLH--LIFMDLQLPV 572

Query: 1025 VDGLLATKMIR-----KDLDYQYP--IVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKL 1077
            + G+ A K IR     +      P  IVALTA     + R  L +G N +L+KP+    L
Sbjct: 573  LSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPVNLHWL 632

Query: 1078 KTIIAQY 1084
               I ++
Sbjct: 633  SKKITEW 639

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 68/147 (46%), Gaps = 33/147 (22%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    LA +GQ+A   V   +E G H  LIFMD+Q+P 
Sbjct: 506  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEA---VNIWKEGGLH--LIFMDLQLPV 559

Query: 1025 VDGLLATKMIR-----------KDLD--------------YQYP--IVALTAFADDSNIR 1057
            + G+ A K IR           K L+               Q P  IVALTA     + R
Sbjct: 560  LSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMDKR 619

Query: 1058 VCLEAGMNGFLSKPIKRPKLKTIIAQY 1084
              L +G N +L+KP+    L   I ++
Sbjct: 620  KALLSGCNDYLTKPVNLHWLSKKITEW 646

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 68/147 (46%), Gaps = 33/147 (22%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    LA +GQ+A   V   +E G H  LIFMD+Q+P 
Sbjct: 495  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEA---VNIWKEGGLH--LIFMDLQLPV 548

Query: 1025 VDGLLATKMIR-----------KDLD--------------YQYP--IVALTAFADDSNIR 1057
            + G+ A K IR           K L+               Q P  IVALTA     + R
Sbjct: 549  LSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMDKR 608

Query: 1058 VCLEAGMNGFLSKPIKRPKLKTIIAQY 1084
              L +G N +L+KP+    L   I ++
Sbjct: 609  KALLSGCNDYLTKPVNLHWLSKKITEW 635

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 65/129 (50%), Gaps = 28/129 (21%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ +++  L    I    +A +GQ+A D+ K   E G   +LIFMD+Q+P 
Sbjct: 503  VLIVEDNVINQAILRSFLKKHKIS-YKVAKNGQEAVDRWK---EGG--IDLIFMDLQLPV 556

Query: 1025 VDGLLATKMIRKDLD-------------------YQYP--IVALTAFADDSNIRVCLEAG 1063
              G+ A K IR DL+                    + P  IVA TA    ++ R  L +G
Sbjct: 557  FSGMDAAKKIR-DLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALLSG 615

Query: 1064 MNGFLSKPI 1072
             N +L+KP+
Sbjct: 616  CNDYLTKPV 624

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 28/142 (19%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +LV EDN +NQ ++   L    I    +A +G +A D+ K   E G H  LI MD++MP 
Sbjct: 408  VLVVEDNMINQAILSSFLRKHKI-HYKVAKNGVEAVDRWK---EGGMH--LILMDLEMPL 461

Query: 1025 VDGLLATKMIR--------------------KDLDYQYP--IVALTAFADDSNIRVCLEA 1062
            + G+ A K IR                    K L  + P  IVALTA    ++    L A
Sbjct: 462  LSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTEALLA 521

Query: 1063 GMNGFLSKPIKRPKLKTIIAQY 1084
            G N +L+KP+    L   I ++
Sbjct: 522  GCNDYLTKPVNLDWLTRKITEW 543

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 66/147 (44%), Gaps = 33/147 (22%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    LA +GQ+A   V   +E G H  LIFMD+Q+P 
Sbjct: 505  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEA---VNIWKEGGLH--LIFMDLQLPV 558

Query: 1025 VDGLLATKMIR--------------KDLDYQYP-------------IVALTAFADDSNIR 1057
            + G+ A K IR               +  Y +              IVALTA     + R
Sbjct: 559  LSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMDKR 618

Query: 1058 VCLEAGMNGFLSKPIKRPKLKTIIAQY 1084
              L +G N +L+KP+    L   I ++
Sbjct: 619  KALLSGCNDYLTKPVNLHWLSKKITEW 645

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 66/139 (47%), Gaps = 25/139 (17%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    +A +G++A D  K   E G H  LIFMD+Q+P 
Sbjct: 547  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWK---EGGLH--LIFMDLQLPV 600

Query: 1025 VDGLLATKMIR-----------------KDLDYQYP--IVALTAFADDSNIRVCLEAGMN 1065
            + G+ A + IR                 K    + P  IVALTA     + R  L +G N
Sbjct: 601  LSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISGCN 660

Query: 1066 GFLSKPIKRPKLKTIIAQY 1084
             +L+KP+    L   I ++
Sbjct: 661  DYLTKPVNLHWLSKKITEW 679

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 67/150 (44%), Gaps = 36/150 (24%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    +A +G++A DK K   E G H  LIFMD+Q+P 
Sbjct: 513  VLIVEDNVINQTILASFLRKHKIS-YKVAKNGREAVDKWK---EGGLH--LIFMDLQLPV 566

Query: 1025 VDGLLATKMIR-------------------------KDLDYQYP-----IVALTAFADDS 1054
            + G+ A K IR                         K +D         IVA TA    +
Sbjct: 567  LSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNSLT 626

Query: 1055 NIRVCLEAGMNGFLSKPIKRPKLKTIIAQY 1084
            + R  L +G N +L+KP+    L   I ++
Sbjct: 627  DKREALISGCNDYLTKPVNLHWLSKKITEW 656

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 71/148 (47%), Gaps = 34/148 (22%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I   ++A +G +A +K +   + G H  LI MD+Q+P 
Sbjct: 511  VLIVEDNIINQAILSSFLRKHKIS-YEIAKNGVEAVEKWR---KGGIH--LILMDLQLPL 564

Query: 1025 VDGLLATKMIRK-----------------------DLD---YQYP--IVALTAFADDSNI 1056
            + G+ A K IR                        +L+   ++ P  IVALTAF+  ++ 
Sbjct: 565  LSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSHADR 624

Query: 1057 RVCLEAGMNGFLSKPIKRPKLKTIIAQY 1084
               L AG N +L+KP+    L   I ++
Sbjct: 625  NEALVAGCNDYLTKPVNLDWLSNKITEW 652

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 66/146 (45%), Gaps = 32/146 (21%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    +A +GQ+A D     +E G H  LIFMD+Q+P 
Sbjct: 567  VLIVEDNVINQTILSSFLRKHKI-FYKVAKNGQEAID---VWREGGIH--LIFMDLQLPV 620

Query: 1025 VDGLLATKMIRK--------------------------DLDYQYPIVALTAFADDSNIRV 1058
            + G+ A K IR+                           ++    IVA TA    S+ + 
Sbjct: 621  LSGIDAAKKIRELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSDKKE 680

Query: 1059 CLEAGMNGFLSKPIKRPKLKTIIAQY 1084
             L +G N +L+KP+    L   I ++
Sbjct: 681  ALISGCNDYLTKPVNLHWLSNKINEW 706

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 65/147 (44%), Gaps = 33/147 (22%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    +A +G++A DK K   E   H  LIFMD+Q+P 
Sbjct: 465  VLIVEDNVINQAILGSFLRKNKIS-YKIAKNGKEAVDKWK---EGNLH--LIFMDLQLPV 518

Query: 1025 VDGLLATKMIRK---------------------------DLDYQYPIVALTAFADDSNIR 1057
            + G+ A K IR+                             +    IVALTA     + R
Sbjct: 519  LSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQEDKR 578

Query: 1058 VCLEAGMNGFLSKPIKRPKLKTIIAQY 1084
              L +G N +L+KP+    L   I ++
Sbjct: 579  EALISGCNDYLTKPVNLLWLSKKITEW 605

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 65/143 (45%), Gaps = 29/143 (20%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +LV EDN +NQ ++   L    I    +A +G +A D+ K   E G H  LI MD++MP 
Sbjct: 421  VLVVEDNMINQTILSSFLRKHKIS-YKVAKNGIEAVDRWK---EGGMH--LILMDLEMPL 474

Query: 1025 VDGLLATKMIR---------------------KDLDYQYP--IVALTAFADDSNIRVCLE 1061
            + G+ A K IR                     K    + P  IVALTA    S+    L 
Sbjct: 475  LSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPAKRSTSKAPVIIVALTASNSQSDKTEALL 534

Query: 1062 AGMNGFLSKPIKRPKLKTIIAQY 1084
            AG N +L+KP+    L   I ++
Sbjct: 535  AGCNDYLTKPVNLDWLTRKITEW 557

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 67/144 (46%), Gaps = 31/144 (21%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    +A +G++A D  K   E G H  LIFMD+Q+P 
Sbjct: 672  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWK---EGGLH--LIFMDLQLPV 725

Query: 1025 VDGLLATKMIRKDLD----------------------YQYP--IVALTAFADDSNIRVCL 1060
            + G+ A + IR D +                       Q P  IVALTA     + R  L
Sbjct: 726  LSGIEAARQIR-DFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRKAL 784

Query: 1061 EAGMNGFLSKPIKRPKLKTIIAQY 1084
             +G N +L+KP+    L   I ++
Sbjct: 785  LSGCNDYLTKPVNLHWLSKKITEW 808

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 68/148 (45%), Gaps = 34/148 (22%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    +A +G++A +K K   E G H  LIFMD+Q+P 
Sbjct: 473  VLIVEDNVINQTILASFLRKHKI-SYRIAKNGREAVEKWK---EGGIH--LIFMDLQLPV 526

Query: 1025 VDGLLATKMIR-----KDLDYQYP-----------------------IVALTAFADDSNI 1056
            + G+ A K IR     K +  + P                       +VA TA    ++ 
Sbjct: 527  MSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLTDK 586

Query: 1057 RVCLEAGMNGFLSKPIKRPKLKTIIAQY 1084
            R  L +G N +L+KP+    L   I ++
Sbjct: 587  REALVSGCNDYLTKPVNLHWLSKKITEW 614

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 66/150 (44%), Gaps = 36/150 (24%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            IL+ EDN +NQ ++   L    I    +A +G++A DK K   E G H  LIFMD+Q+P 
Sbjct: 567  ILIVEDNVINQTILGSFLRKNKI-FYKVAKNGREAVDKWK---EGGIH--LIFMDLQLPV 620

Query: 1025 VDGLLATKMIRK-----DLDYQYP-------------------------IVALTAFADDS 1054
            + G  A K IR+      +  Q                           IVA TA    +
Sbjct: 621  LSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASNSLA 680

Query: 1055 NIRVCLEAGMNGFLSKPIKRPKLKTIIAQY 1084
            + R  L AG N +L+KP+    L   I ++
Sbjct: 681  DKRAALIAGCNDYLTKPVNLHWLSKKITEW 710

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 42/72 (58%), Gaps = 6/72 (8%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L   GI    +A DG +A +K K   E   H  LI MD+Q+P 
Sbjct: 396  VLIVEDNAINQAILALFLRKNGIS-YKVAKDGVEAIEKWK---EGDSH--LILMDLQLPL 449

Query: 1025 VDGLLATKMIRK 1036
            + GL ATK IR+
Sbjct: 450  LSGLEATKKIRE 461

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 6/71 (8%)

Query: 965  ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPK 1024
            +L+ EDN +NQ ++   L    I    +A +G++A DK K   + G H  LI +D+Q+P 
Sbjct: 464  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGREAVDKWK---QGGIH--LILLDLQLPI 517

Query: 1025 VDGLLATKMIR 1035
            + G+ ATK IR
Sbjct: 518  LSGIEATKEIR 528

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 38.9 bits (89), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 15/81 (18%)

Query: 787 ISVEVEDTGPGIDPSLHESVFEPFV------QGDQALS---------RQYGGTGLGLSIC 831
           + + + D G GIDP + + VF+         + D  +S         +   G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 832 RQLATMMNGTMKLDSKLGVGS 852
           +    + NGT+ + S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 36/87 (41%), Gaps = 25/87 (28%)

Query: 786 AISVEVEDTGPGIDPSLHESVFEPFV------------QGDQALS--------RQYGGTG 825
            +S+ V D G GI P       EPF+            +GD A           +  G G
Sbjct: 300 TLSIRVRDHGGGIPPER-----EPFILDYAYTSEVNKHEGDPATQVNQVNADVPRVAGLG 354

Query: 826 LGLSICRQLATMMNGTMKLDSKLGVGS 852
            GL +CR  A +  G++ + S  G+G+
Sbjct: 355 FGLPLCRMYAELFGGSLSIQSLWGLGT 381

>TDEL0H02230 Chr8 complement(375714..377006) [1293 bp, 430 aa] {ON}
           Anc_7.222 YIL042C
          Length = 430

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 45/111 (40%), Gaps = 23/111 (20%)

Query: 764 FKKHTSSSGDENGHLLEHP-------KNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQA 816
           F+ H   S  EN  L E P       K+  + + + D G GI P++ E +++        
Sbjct: 305 FRAHIEGSTSEND-LTEKPIEITIVRKDDEMQIRIRDYGGGISPAVEERMYDYSYSTVSE 363

Query: 817 LSRQYG---------------GTGLGLSICRQLATMMNGTMKLDSKLGVGS 852
            ++  G               G G GL +C+    M +G + + S LG G+
Sbjct: 364 KAKDTGAEAYMIPGEDVNNVSGMGFGLPMCKAYIDMFDGGLDVQSLLGWGT 414

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 35.4 bits (80), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 787 ISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYG---------------GTGLGLSIC 831
           + + + D G GI P + + +FE      QA ++  G               G G GL +C
Sbjct: 317 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 376

Query: 832 RQLATMMNGTMKLDSKLGVGS 852
           +    M +G++ + S  G G+
Sbjct: 377 KAYLEMFDGSLDIQSLYGWGT 397

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 1013 YELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPI 1072
            Y+L+ +D  +  ++  +   M+   + Y  PI+ +T+  +D  +   L+ G+N  L KP 
Sbjct: 536  YDLVIIDAHVKFLNVPILESML-SSIQYHPPIILMTSSLNDQQLIFYLQHGINSILEKPF 594

Query: 1073 KRPKLKTIIAQYCHD 1087
               KL   +     D
Sbjct: 595  HSHKLLKFLVNLLKD 609

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 1010 GEHYELIFMDVQMPKVDGLLATKMIR--KDLDYQYPIVALTAFADDSNIRVCLEAGMNGF 1067
            G  ++LI   +++PK+  +   K+IR    ++   PIVALT +  D+      +      
Sbjct: 1481 GVKFDLIITAMKLPKLGAIDIAKLIRHTNSVNCTTPIVALTVYYHDAKESKVFD----DV 1536

Query: 1068 LSKPIKRPKLKTIIAQYC 1085
            L KP+   +L+ ++++Y 
Sbjct: 1537 LEKPVSVEQLRKLVSKYA 1554

>TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8.34
            YFL033C
          Length = 1972

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 1013 YELIFMDVQMPKVDGLLATKMIRKD--LDYQYPIVALTAFADDSNIRVCLEAGMNGFLSK 1070
            ++LI   +++PK+D +   K+I++   ++   PI+A T +  ++    C     N  + K
Sbjct: 1884 FDLIITALKLPKIDAVDIVKLIKQTNGINSLTPIIAATNYTQEA--ETC--HVFNDIMEK 1939

Query: 1071 PIKRPKLKTIIAQYCHDDSKV 1091
            PI+   L+ ++++Y    S++
Sbjct: 1940 PIQLDILRRVVSRYALQKSQI 1960

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033c RIM15
            protein kinase involved in expression of meiotic genes
          Length = 1682

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 64/128 (50%), Gaps = 15/128 (11%)

Query: 963  YR--ILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDV 1020
            YR  ILV E   +++  + R L   G   + + A      D++ +    G  ++LI   +
Sbjct: 1540 YRMDILVCEPIPIHRYRVTRDLESVGCTVVSVGAG-----DELVSRANSGVKFDLIVTAL 1594

Query: 1021 QMPKVDGLLATKMIR--KDLDYQYPIVALTAFADDSNIRVCLEAGM-NGFLSKPIKRPKL 1077
            ++PK+  +   K+I+    ++ + PI+A+T F  ++     + A + +  L KPI   ++
Sbjct: 1595 KLPKLGAIDIVKLIKHTNGINSRTPIIAITNFYHEA-----ISAKVFDDVLEKPIMLDEI 1649

Query: 1078 KTIIAQYC 1085
            + ++A+Y 
Sbjct: 1650 RHLVAKYA 1657

>Ecym_4378 Chr4 (798444..799775) [1332 bp, 443 aa] {ON} similar to
           Ashbya gossypii ADL116C
          Length = 443

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 33/81 (40%), Gaps = 15/81 (18%)

Query: 787 ISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYG---------------GTGLGLSIC 831
           + V + D G GI P + + +F+      +  ++  G               G G GL +C
Sbjct: 345 LEVRIRDFGGGIPPDVEDKMFDYSYSTSEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLC 404

Query: 832 RQLATMMNGTMKLDSKLGVGS 852
           +    M NG + + S  G G+
Sbjct: 405 KAYLEMFNGQLDIQSLWGWGT 425

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
            (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 1028 LLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKT 1079
            LL+   I K + +Q  +  +  F DD+N+ + LE   NG L   +K+ KL T
Sbjct: 126  LLSEIQIHKSMKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLT 177

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 48/90 (53%), Gaps = 8/90 (8%)

Query: 999  AFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRK--DLDYQYPIVALTA-FADDSN 1055
            A D++ +    G  ++LI   +++PK+  +   +++++    +   PIVA+T  F + + 
Sbjct: 1666 AGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQTNGANSTTPIVAITNYFQEAAT 1725

Query: 1056 IRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085
             RV      +  L KP+K  +LK ++A+Y 
Sbjct: 1726 SRV-----FDDVLEKPVKLDELKKLVAKYA 1750

>Ecym_7426 Chr7 complement(873420..875714) [2295 bp, 764 aa] {ON}
           similar to Ashbya gossypii AER169C
          Length = 764

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%)

Query: 780 EHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMN 839
           E+ +N     E E    G D SLH  +F+      +    +  GTG+G ++  QL   M+
Sbjct: 327 ENIRNLFKDAEAEYKAKGEDSSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMD 386

Query: 840 GTMKLDSKLGVG 851
           G  +L++ L +G
Sbjct: 387 GVDQLNNILVIG 398

>NCAS0I01400 Chr9 (256606..258882) [2277 bp, 758 aa] {ON} Anc_3.304
          Length = 758

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%)

Query: 780 EHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMN 839
           E+ +N     E E    G D SLH  +F+      +    +  GTG+G ++  QL   M+
Sbjct: 321 ENIRNLFKDAEAEYKAKGEDSSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMD 380

Query: 840 GTMKLDSKLGVG 851
           G  +L++ L +G
Sbjct: 381 GVDQLNNILVIG 392

>KAFR0C00290 Chr3 (54829..57111) [2283 bp, 760 aa] {ON} Anc_3.304
           YBR080C
          Length = 760

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%)

Query: 780 EHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMN 839
           E+ +N     E E    G D SLH  +F+      +    +  GTG+G ++  QL   M+
Sbjct: 323 ENIRNLFKDAEAEYRAKGEDSSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMD 382

Query: 840 GTMKLDSKLGVG 851
           G  +L++ L +G
Sbjct: 383 GVDQLNNILVIG 394

>NDAI0A07600 Chr1 complement(1741778..1744060) [2283 bp, 760 aa]
           {ON} Anc_3.304
          Length = 760

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%)

Query: 780 EHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMN 839
           E+ +N     E E    G D SLH  +F+      +    +  GTG+G ++  QL   M+
Sbjct: 323 ENIRNLFKDAEAEYRAKGEDSSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMD 382

Query: 840 GTMKLDSKLGVG 851
           G  +L++ L +G
Sbjct: 383 GVDQLNNILVIG 394

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
            (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%)

Query: 1026 DGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKT 1079
            + LL+   I K++ +Q  +  +  F DD N+ + LE   NG L   +KR K+ T
Sbjct: 140  NKLLSEIQIHKNMRHQNIVHFIDCFEDDINVYILLEICPNGSLMDLLKRRKILT 193

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
            CDC5Polo-like kinase with multiple functions in mitosis
            and cytokinesis through substrate phosphorylation, also
            functions in adaptation to DNA damage during meiosis; has
            similarity to Xenopus Plx1 and S. pombe Plo1p; possible
            Cdc28p substrate
          Length = 705

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 6/64 (9%)

Query: 1028 LLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKR------PKLKTII 1081
            LL+   I K + +   +  +  F DDSN+ + LE   NG L + +KR      P+++   
Sbjct: 126  LLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFT 185

Query: 1082 AQYC 1085
             Q C
Sbjct: 186  TQIC 189

>ZYRO0B07304g Chr2 (574633..575661) [1029 bp, 342 aa] {ON} highly
           similar to uniprot|P09201 Saccharomyces cerevisiae
           YLR377C FBP1 Fructose-1 6-bisphosphatase key regulatory
           enzyme in the gluconeogenesis pathway required for
           glucose metabolism
          Length = 342

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 6/53 (11%)

Query: 137 LNATNNGTGD------VLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGT 183
           L  T+N TGD      VLGD++    M  S N+ +  S E E ++  P  NGT
Sbjct: 64  LAGTSNTTGDEQKKLDVLGDEIFINAMKSSGNVKVLVSEEQEDLIVFPTSNGT 116

>KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {ON}
           Anc_7.222 YIL042C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 409

 Score = 32.3 bits (72), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 38/96 (39%), Gaps = 17/96 (17%)

Query: 779 LEHPKNWAISVEVEDTGPGIDPSLHESVFE----------------PFVQGDQALSRQYG 822
           L  P    +++ V D G GI P +   +F+                  +   +A+ +   
Sbjct: 305 LLRPHETELTLRVSDRGGGIPPGVESHIFDYSYTTTTEAADTDTATAQMHAGEAV-KSVA 363

Query: 823 GTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTL 858
           G G GL +CR    + +G + + S  G G+    T+
Sbjct: 364 GMGFGLPLCRTYLELFDGKIDVQSLWGHGTDVYLTM 399

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
            YMR001C (REAL)
          Length = 705

 Score = 32.3 bits (72), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 6/64 (9%)

Query: 1028 LLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKR------PKLKTII 1081
            LL+   I K + +   +  +  F DDSN+ + LE   NG L + +KR      P+++   
Sbjct: 126  LLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFT 185

Query: 1082 AQYC 1085
             Q C
Sbjct: 186  TQIC 189

>KNAG0J02320 Chr10 complement(431036..433312) [2277 bp, 758 aa] {ON}
           Anc_3.304 YBR080C
          Length = 758

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%)

Query: 780 EHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMN 839
           E+ +N     E E    G D SLH  +F+      +    +  GTG+G ++  QL   M+
Sbjct: 324 ENIRNLFKDAEAEYKAKGDDSSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMD 383

Query: 840 GTMKLDSKLGVG 851
           G  +L++ L +G
Sbjct: 384 GVDQLNNILVIG 395

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,946,458
Number of extensions: 3608800
Number of successful extensions: 21031
Number of sequences better than 10.0: 198
Number of HSP's gapped: 21233
Number of HSP's successfully gapped: 247
Length of query: 1095
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 975
Effective length of database: 39,721,479
Effective search space: 38728442025
Effective search space used: 38728442025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)