Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B021905.702ON1810181089640.0
ZYRO0G06600g5.702ON1820185433370.0
SAKL0E14916g5.702ON1779176527630.0
Skud_11.3345.702ON1885177226360.0
Smik_11.3585.702ON1878178625790.0
YKR095W (MLP1)5.702ON1875179425690.0
Suva_11.3315.702ON1898183125530.0
Ecym_40185.702ON1769177924330.0
KLTH0E01056g5.702ON1771174823830.0
Kwal_55.196975.702ON1760164022620.0
NCAS0A032005.702ON1788175922490.0
CAGL0G02497g5.702ON1780176222130.0
KLLA0A00594g5.702ON1748173420950.0
AFR286W5.702ON1758176020390.0
NDAI0E050405.702ON1973172619290.0
TBLA0E017305.702ON1820160915510.0
Suva_9.395.702ON1682176014721e-173
NCAS0G002305.702ON1735173314441e-168
Skud_9.195.702ON1680176913011e-149
YIL149C (MLP2)5.702ON1679172912891e-148
KAFR0D022205.702ON1674169912791e-146
Smik_9.205.702ON1682172812731e-145
KNAG0C065905.702ON1651166311051e-123
KNAG0L021405.702ON160815658615e-93
KAFR0H002105.702ON145411477331e-77
Kpol_1043.705.702ON13216345953e-61
NDAI0F002905.702ON15544995473e-55
TPHA0E002305.702ON12847243253e-29
TPHA0D046105.702ON11835332627e-22
Kpol_2001.755.702ON10064521794e-12
TDEL0A054908.604ON781164980.012
TPHA0F012502.253ON1278163990.012
Klac_YGOB_Anc_8.3988.398ON592128960.023
NCAS0B030408.398ON59072950.029
TDEL0C040802.253ON148379910.10
Ecym_32912.253ON140070890.16
KLLA0F03531g2.253ON146596880.20
ZYRO0C08030g1.162ON711385870.25
Kpol_505.393.479ON692176860.28
KNAG0E018602.253ON149976850.52
TBLA0D040308.287ON1584109830.76
Skud_4.4578.398ON43089820.79
CAGL0A02596g5.414ON872272820.89
Ecym_53454.238ON1366163821.1
ADL248C2.253ON152897811.4
ZYRO0A01694g2.253ON147595801.9
CAGL0I10901g8.604ON816173792.1
KAFR0E040105.414ON905204792.3
CAGL0L05104g2.633ON675130792.4
ZYRO0F10714g8.604ON708210783.2
KNAG0I014501.380ON147651773.9
Kwal_23.38643.393ON423167764.0
Smik_4.1764.238ON1795192774.2
NDAI0B037202.253ON147496774.5
TPHA0F017202.174ON62971764.9
TDEL0A076506.350ON83291764.9
TDEL0B072802.634ON39277746.4
KAFR0C042701.335ON25499736.5
NCAS0A110303.340ON1044174757.2
TBLA0F041706.350ON935214748.0
CAGL0M07029g6.350ON838134748.9
SAKL0A01034g6.350ON85191749.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02190
         (1810 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...  3457   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...  1290   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...  1068   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...  1019   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   998   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   994   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   988   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   941   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   922   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   875   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   870   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   857   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   811   0.0  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   790   0.0  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   747   0.0  
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   602   0.0  
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   571   e-173
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   560   e-168
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   505   e-149
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   501   e-148
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   497   e-146
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   494   e-145
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   430   e-123
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   336   5e-93
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   286   1e-77
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   233   3e-61
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   215   3e-55
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   129   3e-29
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...   105   7e-22
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    74   4e-12
TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.6...    42   0.012
TPHA0F01250 Chr6 (286089..289925) [3837 bp, 1278 aa] {ON} Anc_2....    43   0.012
Klac_YGOB_Anc_8.398 Chr4 complement(1565442..1567220) [1779 bp, ...    42   0.023
NCAS0B03040 Chr2 (524519..526291) [1773 bp, 590 aa] {ON} Anc_8.3...    41   0.029
TDEL0C04080 Chr3 (717789..722240) [4452 bp, 1483 aa] {ON} Anc_2....    40   0.10 
Ecym_3291 Chr3 complement(548039..552241) [4203 bp, 1400 aa] {ON...    39   0.16 
KLLA0F03531g Chr6 complement(328830..333227) [4398 bp, 1465 aa] ...    39   0.20 
ZYRO0C08030g Chr3 (616547..618682) [2136 bp, 711 aa] {ON} simila...    38   0.25 
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...    38   0.28 
KNAG0E01860 Chr5 complement(383152..387651) [4500 bp, 1499 aa] {...    37   0.52 
TBLA0D04030 Chr4 complement(1000884..1005638) [4755 bp, 1584 aa]...    37   0.76 
Skud_4.457 Chr4 complement(810243..811535) [1293 bp, 430 aa] {ON...    36   0.79 
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    36   0.89 
Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON...    36   1.1  
ADL248C Chr4 complement(262457..267043) [4587 bp, 1528 aa] {ON} ...    36   1.4  
ZYRO0A01694g Chr1 complement(137498..141925) [4428 bp, 1475 aa] ...    35   1.9  
CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} simi...    35   2.1  
KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {O...    35   2.3  
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    35   2.4  
ZYRO0F10714g Chr6 (871970..874096) [2127 bp, 708 aa] {ON} weakly...    35   3.2  
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              34   3.9  
Kwal_23.3864 s23 (465097..466368) [1272 bp, 423 aa] {ON} YBR130C...    34   4.0  
Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W...    34   4.2  
NDAI0B03720 Chr2 (930486..934910) [4425 bp, 1474 aa] {ON} Anc_2....    34   4.5  
TPHA0F01720 Chr6 complement(394469..396358) [1890 bp, 629 aa] {O...    34   4.9  
TDEL0A07650 Chr1 complement(1331830..1334328) [2499 bp, 832 aa] ...    34   4.9  
TDEL0B07280 Chr2 complement(1282265..1283443) [1179 bp, 392 aa] ...    33   6.4  
KAFR0C04270 Chr3 complement(846716..847480) [765 bp, 254 aa] {ON...    33   6.5  
NCAS0A11030 Chr1 (2195054..2198188) [3135 bp, 1044 aa] {ON} Anc_...    33   7.2  
TBLA0F04170 Chr6 complement(1028080..1030887) [2808 bp, 935 aa] ...    33   8.0  
CAGL0M07029g Chr13 complement(713658..716174) [2517 bp, 838 aa] ...    33   8.9  
SAKL0A01034g Chr1 (105182..107737) [2556 bp, 851 aa] {ON} simila...    33   9.3  

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score = 3457 bits (8964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1747/1810 (96%), Positives = 1747/1810 (96%)

Query: 1    MSEKETLVGSSGTDELSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLR 60
            MSEKETLVGSSGTDELSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLR
Sbjct: 1    MSEKETLVGSSGTDELSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLR 60

Query: 61   LHATVDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMEN 120
            LHATVDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMEN
Sbjct: 61   LHATVDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMEN 120

Query: 121  VKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNE 180
            VKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNE
Sbjct: 121  VKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNE 180

Query: 181  VQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQE 240
            VQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQE
Sbjct: 181  VQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQE 240

Query: 241  VARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXX 300
            VARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMS     
Sbjct: 241  VARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKL 300

Query: 301  XXXXXXXXXSFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQ 360
                     SFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQ
Sbjct: 301  LDLQDEQLQSFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQ 360

Query: 361  AVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEY 420
            AVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEY
Sbjct: 361  AVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEY 420

Query: 421  KVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQ 480
            KVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQ
Sbjct: 421  KVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQ 480

Query: 481  RSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFK 540
            RSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFK
Sbjct: 481  RSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFK 540

Query: 541  DIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIE 600
            DIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIE
Sbjct: 541  DIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIE 600

Query: 601  SKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKN 660
            SKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKN
Sbjct: 601  SKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKN 660

Query: 661  NELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHEL 720
            NELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHEL
Sbjct: 661  NELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHEL 720

Query: 721  QSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVER 780
            QSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEK          RREIQKISVER
Sbjct: 721  QSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVER 780

Query: 781  NSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAK 840
            NSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAK
Sbjct: 781  NSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAK 840

Query: 841  RAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLN 900
            RAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLN
Sbjct: 841  RAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLN 900

Query: 901  DAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKS 960
            DAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKS
Sbjct: 901  DAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKS 960

Query: 961  NAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQ 1020
            NAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQ
Sbjct: 961  NAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQ 1020

Query: 1021 VKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQ 1080
            VKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQ
Sbjct: 1021 VKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQ 1080

Query: 1081 LKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSERE 1140
            LKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSERE
Sbjct: 1081 LKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSERE 1140

Query: 1141 FENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQE 1200
            FENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQE
Sbjct: 1141 FENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQE 1200

Query: 1201 NDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPL 1260
            NDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPL
Sbjct: 1201 NDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPL 1260

Query: 1261 NSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKE 1320
            NSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKE
Sbjct: 1261 NSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKE 1320

Query: 1321 LEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTK 1380
            LEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTK
Sbjct: 1321 LEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTK 1380

Query: 1381 VLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSL 1440
            VLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSL
Sbjct: 1381 VLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSL 1440

Query: 1441 KEQVRIFKEKENDSTLEGSQGLSNVVESMXXXXXXXXXXXXXXXXXXYNKKFEEEKAKLS 1500
            KEQVRIFKEKENDSTLEGSQGLSNVVESM                  YNKKFEEEKAKLS
Sbjct: 1441 KEQVRIFKEKENDSTLEGSQGLSNVVESMKKAFEEEKIKFIQEKTEEYNKKFEEEKAKLS 1500

Query: 1501 SENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKR 1560
            SENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKR
Sbjct: 1501 SENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKR 1560

Query: 1561 KTELEEEFQRRLKENNLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQ 1620
            KTELEEEFQRRLKENNLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQ
Sbjct: 1561 KTELEEEFQRRLKENNLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQ 1620

Query: 1621 AAMKSTLLERKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKV 1680
            AAMKSTLLERKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKV
Sbjct: 1621 AAMKSTLLERKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKV 1680

Query: 1681 LKLSDKPAFSFQPSSKSNPFTSALPGNNNVFGMKPTFSFTPGSSQPESRPTFGSTGFNTT 1740
            LKLSDKPAFSFQPSSKSNPFTSALPGNNNVFGMKPTFSFTPGSSQPESRPTFGSTGFNTT
Sbjct: 1681 LKLSDKPAFSFQPSSKSNPFTSALPGNNNVFGMKPTFSFTPGSSQPESRPTFGSTGFNTT 1740

Query: 1741 AXXXXXXXXXXXXXXXXXXXXXASVQGQNGKVAEEAGSNVTTTQKRPADDQPDDEETHKR 1800
            A                     ASVQGQNGKVAEEAGSNVTTTQKRPADDQPDDEETHKR
Sbjct: 1741 AEPESNRSSSQSEESIPEKQESASVQGQNGKVAEEAGSNVTTTQKRPADDQPDDEETHKR 1800

Query: 1801 EKQQSSSPLG 1810
            EKQQSSSPLG
Sbjct: 1801 EKQQSSSPLG 1810

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 1290 bits (3337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 807/1854 (43%), Positives = 1195/1854 (64%), Gaps = 103/1854 (5%)

Query: 1    MSEKETLV------GSSGTDELSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNL 54
            MSE ET V      G +  D    +++ F G+ +D+L  VL D  +   L NK+ +FN L
Sbjct: 1    MSEGETGVANIVTSGDNHNDVSLGKLSAFYGVPEDQL--VLIDGGILTILENKVLDFNEL 58

Query: 55   QSNNLRLHATVDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLA 114
            +S NLRL+ T+DE+K + + + + LK E E L+++ND+ +  R++ +E+ +Q +++K   
Sbjct: 59   KSQNLRLNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKI 118

Query: 115  LGQMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQL 174
              ++E+++ +L +  +++  LK +K+EVV +LEEKI ELE+ + ES++ ++D+K LRQQ+
Sbjct: 119  QNEVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQV 178

Query: 175  METQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTEL 234
            +E +  VQ LK   L D+SE++ + Q++ +L K+++WLE+EVTSKTEQLI  R++ND EL
Sbjct: 179  LELETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDEL 238

Query: 235  QKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREM 294
             +   E    KN+ QLEKS  + +  KN+E+++ LQ KL E+K LSD L  EKQEF+ EM
Sbjct: 239  DRLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEM 298

Query: 295  SXXXXXXXXXXXXXXSFKEELRLTEEKHN-STEADNLQSTQQARFMDDLAQVRQQLEESN 353
            S              S + EL  + +K N    A   ++T+  + + +L  +++  EES 
Sbjct: 299  SMKQKLIDLLENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITLKENFEESE 358

Query: 354  HERLRLQAVVNEVM-GDSEEFDLDSTAN-VSI---PKLYGDIGVLKKQLIKERHQKENLQ 408
             ERLRL+A+V E++ GD  + D+++T++ +S+        D+G+LKK+LIKERHQKE LQ
Sbjct: 359  RERLRLEALVQELIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQ 418

Query: 409  RQIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIK 468
            RQ+ESF+VELEYK+PVINS KER+  LEKEL+D+ALLL+HTS+EKE++ RE E+ + K+K
Sbjct: 419  RQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVK 478

Query: 469  QLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDS 528
              E + HTL RQR+DLA QVQFLL N ++Q DS G L+A+EV+FIK+I+ N++P++ESDS
Sbjct: 479  DSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDS 538

Query: 529  QSIITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEA 588
            Q +I+ERLVEF +IATLQE+N ELLKT R LA++LE EEK+ N +I + E  TI EAKEA
Sbjct: 539  QRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEA 598

Query: 589  IITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRM---KDSQENQELIKS 645
            I++LQ+ N+ +ESKV  + KE DA+KAI S+     +    A+     ++   ++E +++
Sbjct: 599  IVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRT 658

Query: 646  LEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEM 705
            LE +L++LT E+S+NN++LN EI  LY+SKTQ++I  EKERSS+TL E+RLKL+Q TLE+
Sbjct: 659  LEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLEL 718

Query: 706  TKNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXX 765
            T+NEN +L++RS  LQSI  +Q++R  ETVN+ I+C SKL+VLE + ANL+ EK      
Sbjct: 719  TRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSS 778

Query: 766  XXXXRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTE 825
                R    K+S ERNSL +MV+QLQTLQSERE  LKE Q ++K  +  LE + ++ +  
Sbjct: 779  ERTSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARAR 838

Query: 826  ISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKK 885
            + +K  E +  E++KR Q +W+Q+K+D + +++  ++ EL TKT  V  LE EV  L+K+
Sbjct: 839  LDAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQ 898

Query: 886  IEESDSRIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLK 945
            +EES++RI SY+ L+ +    + +  LRK+LEKT I L   Y++ +++K + ST EE+L 
Sbjct: 899  VEESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLS 958

Query: 946  NLSNEFEERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEIL 1005
             L+ ++    + L+   E    EK QL+  V+ L +++  L          +E EKN + 
Sbjct: 959  QLTQDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQ 1018

Query: 1006 KKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIIS 1065
            KK+ +LE+      Q+K+EYD ++ +LQ+DLEQQ ++AN AQ+NYEEELQK + VSK IS
Sbjct: 1019 KKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTIS 1078

Query: 1066 QLRSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNK 1125
            +LR + Q  R  I +LK SE+Q ++VLE  EKSW  QK E +  ++  ++ ++++S+QN 
Sbjct: 1079 ELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNS 1138

Query: 1126 LLFSQVELLSKSEREFENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALE 1185
            LL+ Q+EL SK   +  N       E+L +LRRERDIL TKLTVS+REE+ L     ++E
Sbjct: 1139 LLYDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVE 1198

Query: 1186 DELAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSD 1245
            +EL   +++L + Q+  + HS++  QHE I+EQLNQ+NLLRESN+TLRNA     +KN +
Sbjct: 1199 NELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRE 1258

Query: 1246 LQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPE 1305
            LQ ELN L+ +ILPL SEL+    S+ EKDQ++ L  +EA+RWKERS +IL +H++IDPE
Sbjct: 1259 LQEELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPE 1318

Query: 1306 EYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQG 1365
            ++++L+E++S L+ +L+  +KEN +L+DRF RLKKQAHEKLN+SKIAQ  LS ++NEL+ 
Sbjct: 1319 DHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELRE 1378

Query: 1366 TKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGS 1425
             K+++E   +  + KV  L++ L    +++   E ++ EL DALE  +E+E  L  T+  
Sbjct: 1379 AKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQ 1438

Query: 1426 SEGLTSQLNEEINSLKEQVRIFKEKENDSTLEG--SQGLSNVVESMXXXXXXXXXXXXXX 1483
            +E +T +LN+EI+SLK ++   KE ++ +T +G  S+ LSNVVESM              
Sbjct: 1439 NEEITKKLNDEIDSLKLELHSLKE-QSAATAKGEISEDLSNVVESMR------------- 1484

Query: 1484 XXXXYNKKFEEEKAKLSSE-----------------NGSPAEPVSAP-DVNSLKKQWEEE 1525
                  + FEEEK     E                 NG+  EP   P +   +K+QWE E
Sbjct: 1485 ------RSFEEEKINFLKEKTEELKKLEEEKHTLQVNGN--EPQQQPVNYEEIKRQWESE 1536

Query: 1526 YEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQPEGGDAK 1585
             E    +RI EAEENLKKRIR+PTEERIK+V++K+K  LEE ++++L+E+    E  D  
Sbjct: 1537 QEESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESKSSLESSDGN 1596

Query: 1586 EREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQL----NS 1641
               +LKKQLE + + K++  + + KKKAFEEGKQQAAMKSTLLERKISKLESQL    +S
Sbjct: 1597 -NSDLKKQLEKDLQEKFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKVDS 1655

Query: 1642 SNNPTPEKAAATSVGLPTKIDE-SRTENMATGTPAF-GEKVLKL-SDKPAFSFQPSSKSN 1698
             +  + E ++     LP+KIDE S T N +   P   GEKVLKL   KP F+F   S  N
Sbjct: 1656 PDKSSSETSSVPKPNLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKPTFNFSSFSGGN 1715

Query: 1699 PFTSALPGNNN-----VFGMKPTFSFTPG----------SSQPESRPTFGSTGFNTTAXX 1743
            PFTS+ P NN+      FG KPTF+ +            SS  E++P    + F  T   
Sbjct: 1716 PFTSS-PQNNDTMGTSAFGFKPTFTLSNNSNKSSGTKIDSSSTENKPANPFSSFTETGAS 1774

Query: 1744 XXXXXXXXXXXXXXXXXXXASVQGQNGKVAEEAGSNVTTTQKRPADDQPDDEET 1797
                                  +  N  +    G   +T  KR A+D  DD E 
Sbjct: 1775 SPER------------------ESSNTAMTPTPGEGASTPSKRAAED--DDNEV 1808

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score = 1068 bits (2763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 701/1765 (39%), Positives = 1100/1765 (62%), Gaps = 93/1765 (5%)

Query: 20   IAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDSL 79
            I+ FL +  D  K    D  +   L  K  +F  L++ NL+   T+DELK+    + ++ 
Sbjct: 21   ISSFLEL--DASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAF 78

Query: 80   KKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSNK 139
            K + E++    ++ ++ ++  E++  +L  EK  A  ++  +K +L    +Q  + +S+K
Sbjct: 79   KLQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQLTELKQQNEIFRSSK 138

Query: 140  QEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVK 199
            Q+VV+LL EKI +LEAS+ E+++L+ + K LR+Q++E +NEVQT K N L  K+E++ + 
Sbjct: 139  QDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRLT 198

Query: 200  QQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLL 259
            Q++ +L  +N+WLEKE+ SK+E+   YRQ  ++ELQ +L E+  ++++ ++E+SS + L 
Sbjct: 199  QEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSELEIERSSSQTLK 258

Query: 260  KKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXXSFKEELRLTE 319
             +  ++SQ LQ+K+ E+K L D  + EKQEF+REM+              SFK EL    
Sbjct: 259  SRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESAR 318

Query: 320  EKH--NSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVM--------GD 369
             K   NS   D     ++ + +++L + +++LE S  + ++L+  V+E++        G+
Sbjct: 319  NKSVSNSDHVD----AEREKIIEELIETKKKLEISESKAVKLEETVDELLSTDGERGAGN 374

Query: 370  SEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLK 429
            + +  LDS  ++ +PKL+GDIG+LKK+LI+ER QKE LQ Q+E+FV+ELE+KVPV+NS K
Sbjct: 375  TSKVSLDSKNSI-VPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFK 433

Query: 430  ERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQ 489
            ER+  LEKELSD+AL+LE TS +KE K  EL S   KI   E   H+L+RQRSDLA QVQ
Sbjct: 434  ERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQVQ 493

Query: 490  FLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERN 549
             LL   +++NDS GPLT +E  FIKKII +     E D+Q II+ERLV F+ +  LQE+N
Sbjct: 494  HLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQEKN 553

Query: 550  TELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKE 609
             ELL + R LAD+LE EEK S  +   +E +T+ EAKEAI+TLQE N  +ES++  I KE
Sbjct: 554  MELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKSLESQLEIIAKE 613

Query: 610  RDAYKAILSQ--TSQSFDNLGDADRMKDSQENQEL------IKSLEDKLSTLTTETSKNN 661
            RDA+K + S   TS    N+       +S EN+ L      IK LE+ LS+LT E++KN 
Sbjct: 614  RDAFKILASDKGTSNGPSNV-------NSSENRHLVLAEEKIKELENHLSSLTEESAKNI 666

Query: 662  ELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQ 721
            +LLN+EI +LY+++   +++ EKERSSR LAEDR KL+ +TLEMTK EN EL +R H LQ
Sbjct: 667  KLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQ 726

Query: 722  SILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVERN 781
              + KQ+++  +T+   ISC+S+LS L+++  N  +E+          ++E + +S ERN
Sbjct: 727  ENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESLSEERN 786

Query: 782  SLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKR 841
            ++ +++TQLQTLQ+ERE+LL+E+Q + +    +LE + S+   ++ +K  EI      K 
Sbjct: 787  NMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKD 846

Query: 842  AQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLND 901
            +Q KW+QEK D ++ +    R++L++K   +  LEL+V  L  K+EES++RI ++  LN 
Sbjct: 847  SQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNY 906

Query: 902  AGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSN 961
            + + E+    LR++LEKT I+L  AYSQ E++K ++ ++EE+   + +  E+        
Sbjct: 907  SESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEK 966

Query: 962  AEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQV 1021
             E    E+   +  V  LK  I  LNNE   QK++ E + ++  + L  L++ +  L  +
Sbjct: 967  IETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNM 1026

Query: 1022 KKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQL 1081
            K EY+QK+ ++Q+DL QQT+YAN AQKNYE+ELQKHA+VSK IS LR+E Q  +SE + L
Sbjct: 1027 KAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETL 1086

Query: 1082 KASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREF 1141
            + + + AK+ LE  E SW  Q ++ +  +    ++++++++Q+K+L+ Q++ LSK +   
Sbjct: 1087 RNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTS 1146

Query: 1142 ENKLLPGSSE---LLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKL 1198
               L+P S+E   LL SLRRE+DILETKL VS REEK+L QK   +E +L  +R +L KL
Sbjct: 1147 SEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKL 1206

Query: 1199 QENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKIL 1258
            Q   S +S   K  E+IM QLNQ+NLLRESN+TLRN      E++ +L++EL+ L  K+ 
Sbjct: 1207 QRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQ 1266

Query: 1259 PLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLK 1318
            PL S+++  + S+ EKD +I L  +EA+RWK+RS DIL ++E+IDPEE++KL +++S L+
Sbjct: 1267 PLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQ 1326

Query: 1319 KELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQ 1378
            +E+++KS EN +L+ RF RLK+QAHEKLNA+K AQ+ L++++N+L+ TK K+E  L   +
Sbjct: 1327 QEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQK 1386

Query: 1379 TKVLNLEKLLTERD-SESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEI 1437
             +V NLE  +T+ + ++S+   DL+ +L+++  +  E E KL +   SS  L  +LNE I
Sbjct: 1387 EEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERI 1446

Query: 1438 NSLKEQVRIFKE----KENDSTLEGSQG------LSNVVESMXXXXXXXXXXXXXXXXXX 1487
             SL  ++++ +E     + +S  +GSQ        S +VE++                  
Sbjct: 1447 ESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESE 1506

Query: 1488 YNKKFEEEKA------------KLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQ 1535
              ++FEEEKA            +L+++   P  PV   +++ +KK+WEEEYE  + QRI+
Sbjct: 1507 LREQFEEEKASILEAKEQELREQLATQKLDP--PV---NIDEIKKKWEEEYEQKTSQRIR 1561

Query: 1536 EAEENLKKRIRMPTEERIKKVLDKRKTELEEEF----QRRLKENNLQPEGGDAKEREELK 1591
            E+ E LKKRIR+PTEE+I K+++K++ ELE EF    Q++ +E        ++   E L+
Sbjct: 1562 ESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVLE 1621

Query: 1592 KQ------LESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNNP 1645
            K       L+ E + K+ E +A  KK+AFEEGKQQA+MKST LE+KI+KLE+Q+ + ++ 
Sbjct: 1622 KHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSA 1681

Query: 1646 TP--EKAAATSV-GLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTS 1702
             P  + ++AT     PT      T+++   TP    +   L  KP   F P+     F  
Sbjct: 1682 IPINDNSSATPAESGPT------TQDVKQLTPILNNQAAILPGKP-LPFNPAH----FAF 1730

Query: 1703 ALPGNNNVFGMKPTFSF-TPGSSQP 1726
             +P     FG   + SF  P +SQP
Sbjct: 1731 GMP-----FGQTTSNSFQNPFNSQP 1750

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score = 1019 bits (2636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 701/1772 (39%), Positives = 1076/1772 (60%), Gaps = 103/1772 (5%)

Query: 1    MSEKETLVGSS----GTDELSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQS 56
            MS++  L+ S+    G  E    IA F   S +++K +  D +    L  KL +FN L+S
Sbjct: 1    MSDQGLLMKSTQNEEGASERLNVIASFFDCSLEQVKSIDTDIITR--LNEKLIQFNELKS 58

Query: 57   NNLRLHATVDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALG 116
             NL++  + DELK     K+D LK E E ++R+ND  ++ RN    +   L  EK     
Sbjct: 59   ENLQITVSFDELKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSN 118

Query: 117  QMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLME 176
            ++E+VK +L +  E+K  ++SN+Q  +K+L+E++ E+E +KVE+    N+ +NLR  ++E
Sbjct: 119  ELESVKRKLNDLTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVE 178

Query: 177  TQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQK 236
             + + QT   N L  +SELE   Q++ +L  + +WLEKE++SK+EQ + YRQ  D  + +
Sbjct: 179  LETKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISE 238

Query: 237  SLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSX 296
               E+ RLKND+QLEK++ + L +KN E+S  LQ K+ ++K LSD LNTEKQEFS E++ 
Sbjct: 239  IRSELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIAL 298

Query: 297  XXXXXXXXXXXXXSFKEELRLTE--EKHNSTEADNLQ-STQQARFMDDLAQVRQQLEESN 353
                         + KEEL+     +  N T  D+ +  ++    + DL   +++L +  
Sbjct: 299  KQRLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCE 358

Query: 354  HERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIES 413
             E LRL ++  E   +S      S+          D  +LKKQ IKE+  KE LQ QIES
Sbjct: 359  SECLRLSSITEETGEESGTLTSRSST---------DFILLKKQYIKEKRAKEQLQNQIES 409

Query: 414  FVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEIN 473
            F+VELE+KVPVINS KER+  LE EL++ ALLLEHTS+EK  K REL     KI + E +
Sbjct: 410  FIVELEHKVPVINSFKERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCEND 469

Query: 474  THTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENP-SNESDSQSII 532
             H L RQR DL RQVQ+LL   ++ NDS+GPL  +E+ FI+ I++N+N  + ESDSQ I+
Sbjct: 470  IHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKIL 529

Query: 533  TERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITL 592
            T RLVEF+++  LQE+NTELL+  R LAD+LE  E  S   +  +E KTI+EAKEAI++L
Sbjct: 530  TGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSL 589

Query: 593  QERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLST 652
            Q     +ESKV  +E+ER+  K+ +S+ + SF+N       K  +E +  ++ L+ ++S 
Sbjct: 590  QSEKMSLESKVEELERERETLKSSISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQ 649

Query: 653  LTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAE 712
            +T E+++N  LLN+EI+++Y SK+ ++I   KE+SSR LAE+R KLL +TL++TK EN +
Sbjct: 650  ITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQ 709

Query: 713  LIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRRE 772
            L +RS  LQS +SKQ+++  ET+N+YISC+SKLSV E   +NL  E+          ++E
Sbjct: 710  LRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQE 769

Query: 773  IQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNE 832
            + K+S E+ SL +MVTQLQTLQ ERE+LL E++ S +  I ++E   +ELK E S KD  
Sbjct: 770  LDKLSSEKTSLRIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQH 829

Query: 833  IKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSR 892
            I   E+   ++ +W+Q KI+ +  D   + + +  K   + +L+ +V  L+K+IEE+  R
Sbjct: 830  IMQLEEDNTSKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIR 889

Query: 893  IASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFE 952
            + +Y  +++  N ++    LRK+LE + I L  AYSQ +E+K++  +  ++L+ ++++ +
Sbjct: 890  LHTYNVMDETINDDS----LRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLD 945

Query: 953  ERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLE 1012
            E  EA  +  +    EK+ LE  VS LK+    LNNE  LQKN  E++K E  K +  L+
Sbjct: 946  ESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQ 1005

Query: 1013 SSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQ 1072
            ++   +  VK EY+ KL ++Q DL+QQT YAN AQ NYE+ELQKHA+VSK IS+LR ++ 
Sbjct: 1006 NNNKEIETVKSEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLH 1065

Query: 1073 SGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVE 1132
            + R +++ L  S  + + +L+  EKSW +QK  L   +D    +++++SSQNKLL++Q+E
Sbjct: 1066 TYRGQVKTLTLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIE 1125

Query: 1133 LLSKSEREF-ENKLLPG-SSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAE 1190
            L + +     + +  P  ++++L++LRRERDIL+TK+TV++R+ K+L QK   ++ EL +
Sbjct: 1126 LYTAAGNGVGDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQD 1185

Query: 1191 ARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSEL 1250
            AR KL   +  +   S I +QH+ IME+LNQ+NLLRESN+TLRN +    +KN +LQSEL
Sbjct: 1186 ARTKLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSEL 1245

Query: 1251 NHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKL 1310
              L+  I P+ SELS  + S++EK+Q I L  +E  RWK+RS DIL +H+++   +Y KL
Sbjct: 1246 VKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKL 1305

Query: 1311 EEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKM 1370
            E E+ +LK +LE K ++ T+  +RF RL++QA EKL  SK+ Q  L+ ++NEL+  K  +
Sbjct: 1306 ESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVAL 1365

Query: 1371 EEILKETQTKVLNLEKLLTERDSESAN-NEDLRHELDDALERCKEIEVKLGETVGSSEGL 1429
            E  L +  T++  LE    E+ +E  N +E ++   +DA +  +E+E KL E   S    
Sbjct: 1366 ERSLNDANTRIQELE---GEKVAEDNNRSEMIKRSQEDAEKSSRELEEKLEENAISYSST 1422

Query: 1430 TSQLNEEINSLKEQVRIFKEKENDSTLEGSQG-----LSNVVESMXXXXXXXXXXXXXXX 1484
              +LNEEI +LKE++   K+ +    L+ + G     LSN+VESM               
Sbjct: 1423 VRKLNEEIATLKEEIE--KQGQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKFIEEK 1480

Query: 1485 XXXYNKKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKR 1544
                NKK +E + +L+       +P S+ +++ +KKQWE E+E    +R++EAEE LKKR
Sbjct: 1481 TREVNKKIQEAQERLN-------QP-SSVNIDEMKKQWEAEHEEEVAERVREAEEALKKR 1532

Query: 1545 IRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQPEGGDAKEREELKKQLE--------- 1595
            IR+PTEE+I K+++++K +LE+EF  +L+E  ++   G  +    L+KQLE         
Sbjct: 1533 IRLPTEEKISKIIERKKEDLEKEFNEKLEEK-VKSISGSEQMEAMLQKQLEIRVQEKQKE 1591

Query: 1596 -------------------------------SEFEAKYKEIL----ASTKKKAFEEGKQQ 1620
                                           +E EAK +E L     + KKK+FEEGKQQ
Sbjct: 1592 LEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKKSFEEGKQQ 1651

Query: 1621 AAMKSTLLERKISKLESQLN----SSNNPTPEKAAATS---VGLPTKIDESRTENMATGT 1673
            A MK+TLLERK++K+ESQL+    S+ +P P+ A       +GLP KI+E+   N    T
Sbjct: 1652 ATMKTTLLERKLAKMESQLSEIKQSAESP-PKHANNVPNPLLGLPRKIEEN--SNSPFNT 1708

Query: 1674 PAFGEKVLKLSDKPAFSFQPSSKSNPFTSALP 1705
               GEK+LK + K +     S   NPFTS  P
Sbjct: 1709 LLSGEKLLKFNSKSS----SSGAFNPFTSPSP 1736

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/1786 (38%), Positives = 1069/1786 (59%), Gaps = 92/1786 (5%)

Query: 9    GSSGTDELSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDEL 68
             S  TDE  + IA F G S ++++ + +D  L   L +KL +FN L+S NL++  + DEL
Sbjct: 13   NSDNTDERLKAIASFFGFSFEQVESINSD--LIKHLNDKLLQFNELKSENLQITVSFDEL 70

Query: 69   KALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNT 128
            K   + K+D+LKKE E LI++ND  ++ R+   +++     EKT    ++E++K    + 
Sbjct: 71   KTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDL 130

Query: 129  IEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNG 188
            IE+K  L+ N+Q  +K+L+E++ ELE ++ ++    N+ K LR  +++ + + Q L  + 
Sbjct: 131  IEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSD 190

Query: 189  LGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDY 248
            L  ++ELE   Q++ +L  +N+WLEKE+ SK EQ + YR++ D  + +   E+  L++D+
Sbjct: 191  LNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDF 250

Query: 249  QLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXX 308
            Q+EK+  + L +KN E+S+ LQ KL EIK LSD L++EKQEFS E++             
Sbjct: 251  QVEKTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQL 310

Query: 309  XSFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMG 368
             + KEEL  T     S ++    S ++   + +L   +++L +   E +RL +++ E   
Sbjct: 311  NAVKEELDSTRGLETSNDSKKHMSEKED-LVKELQLTKEELAQCKSECIRLSSIIGET-- 367

Query: 369  DSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSL 428
                   D  +  S  +   D  +LKKQLIKE+  KE+LQ QIESF++ELE+KVP+INS 
Sbjct: 368  -------DEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSF 420

Query: 429  KERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQV 488
            KER+ TLE EL++ ALLLEHTS+EK  K REL + + K+KQ E +  TLI+QR DL RQV
Sbjct: 421  KERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQV 480

Query: 489  QFLLFNGTLQNDSRGPLTADEVAFIKKIIENE-NPSNESDSQSIITERLVEFKDIATLQE 547
            Q+LL   ++  DS+GPL  +E+ FI+ I++N+ + + E+DSQ I+TERLVEF+ I  LQE
Sbjct: 481  QYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQE 540

Query: 548  RNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIE 607
            +NTELLK  R LADRLE  E  S   +  +E +TI+EAKEAI+TL+    ++ESKV  +E
Sbjct: 541  KNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELE 600

Query: 608  KERDAYKAILSQTSQSFDNLGDADRMKDSQENQEL-IKSLEDKLSTLTTETSKNNELLNQ 666
            KE +  KA+LS    S  N     ++ +++ N E  I+ L+  +S +T E+++N  LLN+
Sbjct: 601  KECENSKALLSNEETSHLN-STIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNK 659

Query: 667  EIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSK 726
            EI++LY SK+ ++I   KE+SSR LAE+R KLL +TL++TK EN +L +R   LQS + K
Sbjct: 660  EIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILK 719

Query: 727  QEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVERNSLNLM 786
            Q+++  ET+N+YISC+SKL++ E    NL  E+          ++E+QK+S E+  L +M
Sbjct: 720  QDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIM 779

Query: 787  VTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKW 846
            VTQLQTLQ ERENLL E++ S++  I +LE   +ELK E S KD  IK  E+   +  +W
Sbjct: 780  VTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEW 839

Query: 847  FQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNGE 906
            +Q KI+ +  D   I   +  K A + +L+ +V  L+K+I+E+  R+ +Y  ++   N +
Sbjct: 840  YQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDD 899

Query: 907  TTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYL 966
            +    LRK+LEK+ I L  AYSQ +E+K++  T  ++LK + ++FEE ++   +  +   
Sbjct: 900  S----LRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLT 955

Query: 967  AEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYD 1026
             EK  LE+ +S LK+ I  LNNE  LQ    +EEK E  KK+  L+++   +  VK EY+
Sbjct: 956  NEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYE 1015

Query: 1027 QKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKASEQ 1086
             KL ++QKDL+QQT YAN AQ NYE+ELQKHA+VSK IS+LR ++ + R ++  L  S  
Sbjct: 1016 SKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRN 1075

Query: 1087 QAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREF-ENKL 1145
            Q +  L+  E+SW +Q+  L   ++    ++++++SQNKLL+ Q+EL + +++   +   
Sbjct: 1076 QLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTND 1135

Query: 1146 LPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNH 1205
             P  + +L+SLRRERDIL+TK+TV++R+ K+L QK   ++ EL EAR KL   +  +   
Sbjct: 1136 KPALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKR 1195

Query: 1206 SDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELS 1265
              I +QHEDIME+LNQ+NLLRESN+TLRN +    E+   LQSEL+ L+  I P+ SEL+
Sbjct: 1196 PTIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELA 1255

Query: 1266 ECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKS 1325
              + S++EK+Q + L  +E  RWK+RS DIL +H ++   +Y KLE EI +LK +L+ K+
Sbjct: 1256 ALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKT 1315

Query: 1326 KENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLE 1385
            ++  +  +RF RL++QA E+L  SK++   L+ +VN+L+  K K+E+ L +  TK+  LE
Sbjct: 1316 RQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELE 1375

Query: 1386 KLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQV- 1444
                E+D+   +   ++    DA    KE + KL E     +    +LNEEI +L+E++ 
Sbjct: 1376 NAKAEQDNNQLDA--IKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITLREEIE 1433

Query: 1445 ---RIFKEKENDSTLEGSQGLSNVVESMXXXXXXXXXXXXXXXXXXYNKKFEEEKAKLSS 1501
               RI ++ +++   E +  LS +VESM                   N+K  E + +L+ 
Sbjct: 1434 KQRRIQQQLQSEPANEQN-DLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLN- 1491

Query: 1502 ENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRK 1561
                  +P S  +++ LK +W+ E+E     RI+EAEE LKKRIR+PTEE+I K++++++
Sbjct: 1492 ------QP-SNINIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKR 1544

Query: 1562 TELEEEFQRRLKEN-NLQPEGG-------------------------------------- 1582
             +LE+EF  +++E   L  + G                                      
Sbjct: 1545 EDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSI 1604

Query: 1583 DAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSS 1642
               ER++L+ ++E++   +    L   KKK+FEEGKQQA MK+TLLERK++K+ESQL+ +
Sbjct: 1605 SIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSET 1664

Query: 1643 NNPT--PEKAAATS----VGLPTKIDESRTENMATGTPAF-GEKVLKLSDKPAFSFQPSS 1695
               T  P K    +    +GLP KI+E+ +   ++  P   GEK      K       S 
Sbjct: 1665 KKITESPSKHVNHTQNQLLGLPRKIEENSS---SSFNPLLSGEK----LLKLNSKSSSSG 1717

Query: 1696 KSNPFTSALPGNNNVFGMKPTFSFTPGSSQPESRPTFGSTGFNTTA 1741
              NPFTS  P N +   +      T   + P   PT  +  FN  A
Sbjct: 1718 GFNPFTSPSP-NKSSQKVDDQRELTTNKADP---PTHLTPSFNIPA 1759

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/1794 (38%), Positives = 1072/1794 (59%), Gaps = 103/1794 (5%)

Query: 5    ETLVGSSGTDELSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHAT 64
            E++     +DE    IA F G S +++K    D V    L +KL +FN L+S NL++  +
Sbjct: 9    ESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVV--KHLNDKLLQFNELKSENLKVTVS 66

Query: 65   VDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFE 124
             DELKA    K+D LK E E +IREND  ++ RN    +   +  EK     ++E VK +
Sbjct: 67   FDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRK 126

Query: 125  LQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTL 184
            L +  E+K   +SN+Q  +K+L+E++ E+E  +VE+    ++ K LR  +M+ + + Q  
Sbjct: 127  LDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGY 186

Query: 185  KCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARL 244
              N L  ++ELE   Q++ +L  +N+WLEKE+ SK EQ + YRQ+ D  +     E+ RL
Sbjct: 187  ITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRL 246

Query: 245  KNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXX 304
            +ND+Q+E+++ + L +KN E+S+ LQ KL EIK LSD LN+EKQEFS EMS         
Sbjct: 247  RNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLL 306

Query: 305  XXXXXSFKEELRLTEEKHNS-TEADNL--QSTQQARFMDDLAQVRQQLEESNHERLRLQA 361
                 + KEEL    E + +   AD+   Q+ +    + +L   +++L +   E LRL +
Sbjct: 307  ESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRLSS 366

Query: 362  VVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYK 421
            + +E   D+E     S++         D   LKKQLIKER  KE+LQ QIE+F+VELE+K
Sbjct: 367  ITDEADEDNENLSAKSSS---------DFIFLKKQLIKERRTKEHLQNQIETFIVELEHK 417

Query: 422  VPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQR 481
            VP+INS KER+  LE EL++ ALLLEHTS+EK  K +EL +   K+ + E +  TL +QR
Sbjct: 418  VPIINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQR 477

Query: 482  SDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKII-ENENPSNESDSQSIITERLVEFK 540
             DL RQ+Q+LL   ++ NDS+GPL  +E+ FI+ I+ E+++   ESDSQ ++TERLVEFK
Sbjct: 478  LDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFK 537

Query: 541  DIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIE 600
            +I  LQE+N ELLK  R LAD+LE +EK S   +  +E +T++EAKEAIITL+    ++E
Sbjct: 538  NIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLE 597

Query: 601  SKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKN 660
            S++  ++KE +  K  +     S+ N+      +  ++ +  ++ L+ ++S +T E+++N
Sbjct: 598  SRIEELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTEN 657

Query: 661  NELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHEL 720
              LLN+EI++LY SK+ ++I   KE+SSR LAE+R KLL +TL++TK EN +L +R   L
Sbjct: 658  MSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYL 717

Query: 721  QSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVER 780
            Q+ + KQ+++  ET+N+Y+SC+SKLS++E    NL  E+          ++E+ K+S E+
Sbjct: 718  QNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEK 777

Query: 781  NSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAK 840
            +SL +MVTQLQTLQ ERE+LL+E++ S +  I +LE   SELK E S KD+ IK  E+  
Sbjct: 778  DSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDN 837

Query: 841  RAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLN 900
             +  +W+Q KI+ +  D   +   + +K   + +L+ +V  L+K+IEE   R+ +Y  ++
Sbjct: 838  NSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMD 897

Query: 901  DAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKS 960
            +  N ++    LRK+LEK+ I L  AYSQ +E+K +  T  ++L+  +++ +E  +   +
Sbjct: 898  ETINDDS----LRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTN 953

Query: 961  NAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQ 1020
              +    EK  LE  +S LK+ +  LNNE  LQK   E+EK +  K++  L+++   +  
Sbjct: 954  QIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEA 1013

Query: 1021 VKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQ 1080
            VK EY+ KL ++Q DL+QQT YAN AQ NYE+ELQKHA+VSK IS+LR ++ + + +++ 
Sbjct: 1014 VKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKT 1073

Query: 1081 LKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSERE 1140
            L  S  Q +  L+  EKSW +QK  L   +D    +++++SSQNKLL+ Q+++ + +++E
Sbjct: 1074 LNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKE 1133

Query: 1141 FENKL-LPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQ 1199
              N    PG + +LI+LRRERDIL+TK+TV++R+ K+L QK   ++ EL +AR KL   +
Sbjct: 1134 VNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSR 1193

Query: 1200 ENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILP 1259
                NHS I +QH+DIME+LNQ+NLLRESN+TLRN +     K  +LQSEL+ L+  + P
Sbjct: 1194 VEKENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAP 1253

Query: 1260 LNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKK 1319
            + SEL+  + S++EK+Q + L  +E  RWK+RS DIL +HE++   +Y KLE EI NLK+
Sbjct: 1254 IESELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKE 1313

Query: 1320 ELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQT 1379
            ELE K ++  +  ++F RL++QA E+L  SK++Q +L+ +VN L+  K  +E  L E   
Sbjct: 1314 ELENKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANA 1373

Query: 1380 KVLNLEKLLTERDSESANN-EDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEIN 1438
            ++   E+L   + ++  N  E +R   +DA +  +E++ KL E+  S E   + LNEEI 
Sbjct: 1374 RI---EELQNAKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEIT 1430

Query: 1439 SLKEQV--RIFKEKENDSTLEGSQG-LSNVVESMXXXXXXXXXXXXXXXXXXYNKKFEEE 1495
            +LKE++  +   +++  +T    Q  LSN+VESM                   N+K  E 
Sbjct: 1431 TLKEEIEKQRQIQQQLQATSANEQNDLSNIVESMKKSFEEDKIKFIKEKTQEVNEKILEA 1490

Query: 1496 KAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKK 1555
            + +L+       +P S  ++  +KK+WE E+E    Q+I+EAEE LKKRIR+PTEE+I K
Sbjct: 1491 QERLN-------QP-SNINMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINK 1542

Query: 1556 VLD----------------------------------------KRKTELEEEFQRRLKEN 1575
            +++                                        +++ ELE E+ ++L+E 
Sbjct: 1543 IIERKKEELEKEFEEKVEERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEE 1602

Query: 1576 NLQ--PEGGDAK--EREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERK 1631
             L+  P        ER++L+ ++ES    ++   L + KKK+F+EGKQQA MK+TLLERK
Sbjct: 1603 -LKDVPHSSHISDDERDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERK 1661

Query: 1632 ISKLESQLNSSNNP--TPEKAAATS----VGLPTKIDESRTENMATGTPAFGEKVLKLSD 1685
            ++K+ESQL+ +     +P K+        +GLP KI+E+   N        GEK+LKL+ 
Sbjct: 1662 LAKMESQLSETKQSAESPPKSVNNVQNPLLGLPRKIEEN--SNSPFNPLLSGEKLLKLNS 1719

Query: 1686 KPAFSFQPSSKSNPFTSALPG----NNN------VFGMKPTFSFTPGSSQPESR 1729
            K +     S   NPFTS  P     N+N           P     P  + P SR
Sbjct: 1720 KSS-----SGGFNPFTSPSPNKHLQNDNDKRESLANKTDPPTHLEPSFNIPASR 1768

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  988 bits (2553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 690/1831 (37%), Positives = 1081/1831 (59%), Gaps = 147/1831 (8%)

Query: 1    MSEKETLVGSSGTDELS----QRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQS 56
            MS++   + S+  DE +      IA F   S +++K +  D V    L +KL +FN L+S
Sbjct: 1    MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTH--LNDKLLQFNELKS 58

Query: 57   NNLRLHATVDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALG 116
             N+++  T+DELK     K++SLK E E ++R+ND  ++ RN    +   + +EKT    
Sbjct: 59   ENIQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSN 118

Query: 117  QMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLME 176
            ++E++K +L +  E+K  ++S++Q  +K+L+E++ ELE  K  S    ++ K LR  ++E
Sbjct: 119  ELESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILE 178

Query: 177  TQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQK 236
             + + QT   N L  KS+LE   Q++ +L  + +WLEKE++SK +Q + YRQ+ +T + +
Sbjct: 179  LETKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISE 238

Query: 237  SLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSX 296
               ++ R++ND+QLEK++ + L +KN E+S+DLQ KL +IK LSD  N+EK++FS E++ 
Sbjct: 239  IRNDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITL 298

Query: 297  XXXXXXXXXXXXXSFKEELRLTEEKH----NSTEADNLQSTQQARFMDDLAQVRQQLEES 352
                         + KEEL  T E +    NS ++  L S +  + + DL   + +L + 
Sbjct: 299  KQRLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLIS-ENEKLLKDLQLTKHKLVQC 357

Query: 353  NHERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIE 412
             +E LRL ++  E     E+  L S +N       GD  +LKKQLIKE+  KE+LQ QIE
Sbjct: 358  ENECLRLSSITEE--AGKEDGILTSKSN-------GDFILLKKQLIKEKRAKEHLQNQIE 408

Query: 413  SFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEI 472
            SF+VELE+KVP+INS KER+ TLE EL++ ALLLEHTS+EK  K +EL+    K+ + + 
Sbjct: 409  SFIVELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKD 468

Query: 473  NTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENEN-PSNESDSQSI 531
              H L +QR DL RQ+Q+LL   ++ NDS+GPL  +E+ FI+ I++N++  + ESDSQ I
Sbjct: 469  EIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKI 528

Query: 532  ITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIIT 591
            +TERLVEF+DI  LQE+N+ELL+  R LAD+LE  E  S   + ++E +TI+EAKEAI+T
Sbjct: 529  VTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILT 588

Query: 592  LQERNSEIESKVSTIEKERDAYKAILSQTSQSFDN-----LGDADRMKDSQENQELIKSL 646
            LQ +  ++ESK+  +EKER+ +K        S +N     L +  R  +SQ      + L
Sbjct: 589  LQSQKVQLESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQ-----TQDL 643

Query: 647  EDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMT 706
            + ++S +T E+++N  LLN+E+++LY SK+ L+I   +E+SSR LAE+R KLL +TL++ 
Sbjct: 644  QARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLA 703

Query: 707  KNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXX 766
            K EN +L +RS  LQ+ +SKQ+++  ET+N Y+SC+SKLS +E   +NL  E+       
Sbjct: 704  KAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELE 763

Query: 767  XXXRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEI 826
               ++E+ ++S E+ SL++MVTQLQTLQ ERENLL E++ S +  I  L+   +ELKTE 
Sbjct: 764  KNLKQELSELSSEKTSLHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEA 823

Query: 827  SSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKI 886
              KD  IK  E+   ++ +W+Q KI+ +  D   +   L  K   V + + E+  L+K+I
Sbjct: 824  IRKDQYIKQLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEI 883

Query: 887  EESDSRIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKN 946
            EE+  R+ +Y  L+++ N ++    LR++LEK+ I L  AYSQ +E+K++  T +++L+ 
Sbjct: 884  EENKIRLHTYNVLDESINDDS----LRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQE 939

Query: 947  LSNEFEERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILK 1006
            +S++ +E  +A  +  +    EK  LE  VS L++ +  LNNE  LQ    E+EK E  K
Sbjct: 940  MSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKK 999

Query: 1007 KLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQ 1066
            K+  L+++   +  VK EY+ KL ++QKDL+QQT YAN AQ NYE+ELQKHA+VSK IS+
Sbjct: 1000 KISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISE 1059

Query: 1067 LRSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKL 1126
            LR ++ + + +++ L  +  Q ++ L+  E +W +QK  L   +D    +++++SSQNKL
Sbjct: 1060 LREQLHTYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKL 1119

Query: 1127 LFSQVELLSKSEREFENKLLPGSS------ELLISLRRERDILETKLTVSKREEKLLHQK 1180
            L+ Q+EL + +     NK     S      ++LI+LRRERDIL+TK+ V++R+ K+L QK
Sbjct: 1120 LYDQIELYTTTG----NKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQK 1175

Query: 1181 QVALEDELAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQ 1240
               ++ EL EAR KL   +  +   S I +QH+++ME+LNQ+NLLRESN TLRN ++++ 
Sbjct: 1176 ISLIDVELQEARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSN 1235

Query: 1241 EKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHE 1300
             KN +LQSEL  L+  I P+ SEL+  + SI+EK+Q I L  +E  RWK+RS DI+ +H+
Sbjct: 1236 SKNKELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQ 1295

Query: 1301 KIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEV 1360
            ++   +Y KLE EI +LK +LE K+++  D  ++F RL++QA EKL ASK++Q +   ++
Sbjct: 1296 QLSSTDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQL 1355

Query: 1361 NELQGTKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLRHEL-------DDALERCK 1413
            NEL+  K  +E+ L     ++  LE      D++ A N   R++L       +D  E  K
Sbjct: 1356 NELKDAKLALEKSLNNANARIQELE------DAKVAEN---RNQLSMIKKLQEDTEENSK 1406

Query: 1414 EIEVKLGETVGSSEGLTSQLNEEINSLKEQV-RIFKEKENDSTLEGSQ--GLSNVVESMX 1470
            E+E KL E   S +    +LNEEI  LKE++ +  + ++      G++   LS VVESM 
Sbjct: 1407 ELETKLEENAISYDSTVKKLNEEIGILKEELEKQRQIQQQFQAAAGTEQDDLSKVVESMK 1466

Query: 1471 XXXXXXXXXXXXXXXXXYNKKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAIS 1530
                              N+K  E +        +  +P S  +++ +KKQWE E+    
Sbjct: 1467 RSFEEDKIKFIEEKTREVNQKIREFQEA-QEAEETGLKP-SNINIDEIKKQWEAEHNEEV 1524

Query: 1531 QQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQPEGGDAKEREEL 1590
             ++I+EAEE LKKRIR+PTEE+I K+++++K +LE+EF  +++E  L+      K  +  
Sbjct: 1525 SKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVEER-LKSISQSGKMEDIF 1583

Query: 1591 KKQLESEFEAKYKEI--------------------------------------------L 1606
            +KQLES  + K KE+                                            L
Sbjct: 1584 QKQLESRIQEKQKELENEYNKKLQEKLRELPSSDIISSDDKDKLRADIEAQLREEFNHEL 1643

Query: 1607 ASTKKKAFEEGKQQAAMKSTLLERKISKLESQLN----SSNNPTPE--KAAATSVGLPTK 1660
             + KKK+FEEGKQQA MK+TLLERK++K+ESQL+    S ++P     K     +GLP K
Sbjct: 1644 QTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQSVDSPPKHLSKMPNPLLGLPRK 1703

Query: 1661 IDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKS----------NPFTSALPGNNNV 1710
            I+E+         P +          P  S +   K           NPFTS  P N  +
Sbjct: 1704 IEEN-------SNPPYN---------PLLSGEKLLKLNSKSSSSGGFNPFTSPSP-NKPL 1746

Query: 1711 FGMKPTFSFTPGSSQPESRPTFGSTGFNTTA 1741
             G +     +   ++P   PT  +  FN  A
Sbjct: 1747 QGDEAEREPSSNETEP---PTHLAPSFNIPA 1774

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  941 bits (2433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/1779 (37%), Positives = 1031/1779 (57%), Gaps = 104/1779 (5%)

Query: 19   RIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDS 78
            ++A FL +  DE K    D  +      K  EF+ ++++N+RL  ++D LK     K+++
Sbjct: 17   KVAAFLEV--DEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINT 74

Query: 79   LKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSN 138
             K++ E+L+ +  + +Q + + E++  +L  EK     ++  ++ +++   +   ++ S 
Sbjct: 75   FKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASA 134

Query: 139  KQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIV 198
            KQ+V KLLEEKIS+L ASK ES  L+  NK LR+  ++ +  +Q  K   L +KSE++ +
Sbjct: 135  KQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRL 194

Query: 199  KQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFL 258
             Q++ ++  + +WL KE+ SK EQL  +R++ ++ELQ   ++V  LK+  +  +++   L
Sbjct: 195  HQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTL 254

Query: 259  LKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXXSFKEELRLT 318
              K  E+S  LQ KL E KKL+D LNTEK+EF+REMS              S K +L   
Sbjct: 255  KAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDL--- 311

Query: 319  EEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMG---------- 368
            E  + S   + + + ++ + +D+L   ++ LE +  E ++L+A VNE++           
Sbjct: 312  ENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVI 371

Query: 369  --DSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVIN 426
              +  +  LDS  + ++PKL GDIG+LKKQL++ER QKE LQ Q+ESFVVELE+K+P++N
Sbjct: 372  NSNVSDTSLDSKIS-TVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILN 430

Query: 427  SLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLAR 486
            S KER+  LE+EL+D+ LLLE T+ ++++KT EL     KI   E    +LI QRSDLA 
Sbjct: 431  SFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAH 490

Query: 487  QVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQ 546
            QVQ+LL   ++++D+ GPLT  EV F+K+II +E+ + +SD+Q II+ERLV+FK +  LQ
Sbjct: 491  QVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQ 550

Query: 547  ERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTI 606
             +N ELL T R LAD+LE+EEK S  R+ S+E +T+ EAKEAI++LQE    +E ++  +
Sbjct: 551  SKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIV 610

Query: 607  EKERDAYKAILSQTSQSFDNLGDADRMKDSQENQ--ELIKSLEDKLSTLTTETSKNNELL 664
             KERDA+K   S   Q     GD+      Q  +  E I  LE +L  L  ++  N +LL
Sbjct: 611  SKERDAFKLANSANKQ-----GDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIKLL 665

Query: 665  NQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSIL 724
            N EI+ LY++K+++T+  E+ERSS+ LAE+RLKL+QSTL +TK EN EL +RS +LQ +L
Sbjct: 666  NDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVL 725

Query: 725  SKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVERNSLN 784
             KQ+ +   T+++ I+ +S+LS L ++ A L +E+          + E + ++ E  +  
Sbjct: 726  LKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSK 785

Query: 785  LMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQT 844
            ++V+QLQTLQ ER+ LL+E+Q +++  I +LE    E +  +  +  E +    +  +Q 
Sbjct: 786  ILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQY 845

Query: 845  KWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGN 904
            KWFQ K+D ++      R  L  KT ++  L+L    L  K+EE++ R  SY  L +A +
Sbjct: 846  KWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADD 905

Query: 905  GETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEK 964
                   LRK+LEK  I L  AYSQ E++K ++  +E++   +S   EE     + N   
Sbjct: 906  ITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIAL 965

Query: 965  YLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKE 1024
               E+  L   ++ L   I  LN+E   QK++++ EK+E++KKL  L+ S+ SL ++K E
Sbjct: 966  LEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSE 1025

Query: 1025 YDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKAS 1084
            Y++K+ +LQ+DL QQ +YAN AQKNYE+ELQKHA+V+K IS LR E Q  +SE++  K S
Sbjct: 1026 YEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRS 1085

Query: 1085 EQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSK---SEREF 1141
              +AK  LE  E+SW  Q  +L++ +   +++ + +++QN+LL+ QVELLSK   S+ E 
Sbjct: 1086 ASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATSSDSEA 1145

Query: 1142 ENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQEN 1201
               +   S EL+++LRRERDILETKL VS REEK+L Q+    + EL   R +  K Q  
Sbjct: 1146 AASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQAT 1205

Query: 1202 DSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLN 1261
              +     +  E IME+LNQ+NLLRESNVTLRN      E++   Q+E+  LQ ++ PL 
Sbjct: 1206 APDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQLQPLE 1265

Query: 1262 SELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKEL 1321
            S+L     +I E+DQ+I LL +E+ RWK+RS DIL ++E+IDP E++KL +E++ LK EL
Sbjct: 1266 SQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTELKNEL 1325

Query: 1322 EAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKV 1381
            E KS EN +  +RF +L+KQA+E+L+  K A+A + +E   +   K ++E  L +T  KV
Sbjct: 1326 EKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKV 1385

Query: 1382 LNLEKLLT--------ERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQL 1433
              LE  L+        E DS     E+LR    +A E   +I+    E   S + L +Q+
Sbjct: 1386 SELESKLSSSANEKNGEADSLKEELEELRANFIEANEAVADIK---AEAASSEKDLKNQI 1442

Query: 1434 NEEINSLKEQVRIFKEKENDSTLEG-----SQGLSNVVESMXXXXXXXXXXXXXXXXXXY 1488
             E    L E+++  + +   S LE      S   + +VE+M                   
Sbjct: 1443 QE----LTEKIKTLESEIEHSELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKDEEL 1498

Query: 1489 NKKFEE-------------EKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQ 1535
              K EE              + K S    +P  P+   D  +LK + E EYE  + +RI+
Sbjct: 1499 RMKLEEIQKQYEEERERELSELKASLVESTPNAPL--IDEETLKSKLEAEYEKKTLERIR 1556

Query: 1536 EAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQ-----PE---GGDAKER 1587
            EAEE LKKRIR+P+EERI +V+++R+  L++EF+ R++   L+     PE   G  AK  
Sbjct: 1557 EAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLI 1616

Query: 1588 EELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLN--SSNNP 1645
            +E +++++ + EAK+ E LA  +KKAFEEGKQQ  MK  LLE KI+KLE Q N  + NN 
Sbjct: 1617 KEHQEEMD-KLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNS 1675

Query: 1646 TPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTSALP 1705
             P K       +P  ID     N    +P   + +         + +PS     F  A+ 
Sbjct: 1676 VPSK-------IP--ID-----NNNNSSPQGAQPI---------AIKPSPFQVAFGKAME 1712

Query: 1706 GNNNVFG-----MKPTFSFTPGSSQPESRPTFGSTGFNT 1739
              N  FG     +  +  F   ++   +    G+ G NT
Sbjct: 1713 --NTSFGSFKGSLLDSKQFIANTADTSTSTLTGNVGTNT 1749

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/1748 (37%), Positives = 1027/1748 (58%), Gaps = 82/1748 (4%)

Query: 23   FLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDSLKKE 82
            FLGI  +EL  V    V++  +  K +EF  LQ+ NLR   TVDEL++    K+ + K +
Sbjct: 22   FLGIESNELLAVDGGVVVN--IAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQ 79

Query: 83   TERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSNKQEV 142
               L++E ++ +    + E+   +LT EK  AL   E ++   +   +QK  L+S+K +V
Sbjct: 80   VHLLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDV 139

Query: 143  VKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVKQQV 202
             +LL EKISEL + K E+ +L+ +N+ LRQQ ++ ++E +  K   L  K+EL  + Q++
Sbjct: 140  ARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQEL 199

Query: 203  GMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLLKKN 262
             +   ++EWLE ++  K  +   YR    ++L    Q++  L+ + Q    + + L + N
Sbjct: 200  SLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLREHN 259

Query: 263  QEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXXSFKEELRLTEEKH 322
              I+ DL+ +L  +KKL+D LN+EKQEF+REMS              S K +L L   + 
Sbjct: 260  ARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLEL---RS 316

Query: 323  NSTEADNLQSTQQARFM-DDLAQVRQQLEESNHERLRLQAVVNEVMGDSEEFDLDSTAN- 380
             + E D+   +     + ++LAQ  QQLEES  +  +L+  V +++   +E  L S+A+ 
Sbjct: 317  TAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAHE 376

Query: 381  --VSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKE 438
               S+  LYGDI +LK+Q+I E+ QKE+LQ Q+E+FVVELE KVP+++S K+R+  LE++
Sbjct: 377  YPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQ 436

Query: 439  LSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQ 498
            L++ A +LE  S +KE    +L     +I   EI    L RQRSDLARQVQ+LL   +++
Sbjct: 437  LAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVR 496

Query: 499  NDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNTELLKTART 558
            +DS+GPLT +E+AF+++I+E  + S E D+Q +I+ERLVEF+DI  LQ +N++LL+T R 
Sbjct: 497  SDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRN 556

Query: 559  LADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILS 618
            LAD+LE EE+ S +R  ++E   I EAKEAIITLQE   E+ES++  + KERDAYKAI  
Sbjct: 557  LADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKAI-- 614

Query: 619  QTSQSFDNLGDADRMKDSQENQEL-IKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQ 677
            Q S +  N      + +S+      +  LE  L T   E  KN ++LN EI+ L + KT+
Sbjct: 615  QPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTK 674

Query: 678  LTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNK 737
            L I  EKER+S+ LAE+RLK+ Q +L++TK EN EL +R H +Q  L KQ+ +  ET++ 
Sbjct: 675  LAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQETLSC 734

Query: 738  YISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVERNSLNLMVTQLQTLQSER 797
             I CQSKL+ LE+   +  A+              I++++ ERN+L ++VTQLQTLQ ER
Sbjct: 735  LIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNLTILVTQLQTLQGER 794

Query: 798  ENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSD 857
            + LL E++ S+K  +  LEV+ S+L+T++S KD E         ++++W+QEKID ++  
Sbjct: 795  DKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNET 854

Query: 858  AGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNGETTQGQLRKDLE 917
               +  +L ++  T   LE +   L+ +++E +++  SY  LN   +       LR +LE
Sbjct: 855  LKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRMELE 914

Query: 918  KTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYLAEKVQLEQCVS 977
            K+ I+L+ AYSQ EE +    +AEE L  ++N FE        +      ++ +L   V 
Sbjct: 915  KSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKEDELVGQVE 974

Query: 978  NLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLE 1037
             LK  I  LNNE   QK + + EKNE+  +LVSL+S++ ++  +K+ Y+Q+L +L +DL 
Sbjct: 975  ALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQDLN 1034

Query: 1038 QQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKASEQQAKEVLENGEK 1097
            QQ A+AN AQ+NYE+ELQ+HA+VSK ISQLR E Q  +++   L++S +Q ++ L+  + 
Sbjct: 1035 QQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTLDESDG 1094

Query: 1098 SWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPGSS--ELLIS 1155
             W NQK E +A +  L +++++++ QN LL  Q++L +K       +  P     EL+ S
Sbjct: 1095 KWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQEKVRELITS 1154

Query: 1156 LRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIAKQHEDI 1215
            LRRERDIL+TKL VSKR E +  +K  A+E EL+ A+++L  LQ   S +S +A +H  +
Sbjct: 1155 LRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQALSSQNSIMADEHNKL 1214

Query: 1216 MEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKD 1275
            +EQLNQ+NLLRESN+TLR+ V    ++  +L+ ++++LQ  + PL SEL+  ++S+  KD
Sbjct: 1215 LEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLKRSVRAKD 1274

Query: 1276 QRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRF 1335
             +I L+ +E +RWK+RS DIL + E+IDPEE++KL EE+S  K EL AK+ +N++L DRF
Sbjct: 1275 SQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELEDRF 1334

Query: 1336 TRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSES 1395
             RLKKQA E+L+A+K  Q NLS E+ + +  ++ ME  L++ Q     L++ L   +SE+
Sbjct: 1335 QRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRVESEA 1394

Query: 1396 ANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQV----RIFKE-- 1449
              +   + EL+ AL++  + E K  +       +   L  E+  +K       R   E  
Sbjct: 1395 KADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHAEELERRLDEAR 1454

Query: 1450 KENDSTLEGSQGL---SNVVESMXXXXXXXXXXXXXXXXXXYNKKFEE----EKAKLSS- 1501
            +E +S  E  QG    S+ +E M                      +EE    EKA     
Sbjct: 1455 REVESLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEELRLKEKATYEKE 1514

Query: 1502 --ENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDK 1559
              ENG    PV   D+ +LKKQWEE+YE  + +RI+E+ E L+KRIR+PTEE+I K+++ 
Sbjct: 1515 LEENGKHT-PV---DIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVET 1570

Query: 1560 RKTELEEEFQRRLKEN-----NLQPEGGDAKE-----REELKKQLESEFEAKYKEILAST 1609
            RK+ELE+EF+ +L++      N +P+     E     ++E++K L+++   +  E +A  
Sbjct: 1571 RKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEK-LKADLTREMDEEMAQV 1629

Query: 1610 KKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNN-PTPEKAAATSVGLPTKIDESRTEN 1668
            +KKAF+EGKQQA+MKS  LE+KI+KLE+Q+ +S     P  +A TS   PT         
Sbjct: 1630 RKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAVP--SAPTSKNSPT--------- 1678

Query: 1669 MATGTPAFGEKVLKLSDKPAFSFQPS------SKSNPFTSALPGNNNVFGMKPTFSFTPG 1722
                            +KP    + S      S+++P   +LP         P+ +  P 
Sbjct: 1679 ----------------EKPVRILEASPLEDALSRNDPNKESLPIKKISL---PSLTPEPQ 1719

Query: 1723 SSQPESRP 1730
             SQPE  P
Sbjct: 1720 QSQPEEAP 1727

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/1640 (36%), Positives = 972/1640 (59%), Gaps = 38/1640 (2%)

Query: 20   IAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDSL 79
            +A FL +  + L  V     ++  +  K++EF  LQ+ NL+   T+DEL++  + K+ + 
Sbjct: 21   VASFLELDREAL--VNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGAC 78

Query: 80   KKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSNK 139
            K +   L++E +  +    +LE++ +Q   E+  ++   + ++   +   +QK VL++NK
Sbjct: 79   KDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQVLEANK 138

Query: 140  QEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVK 199
             +V +LL EKI ++   + E++ L+ + + LRQQ +E + + +  K   L  K++   + 
Sbjct: 139  NDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLS 198

Query: 200  QQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLL 259
            Q+V +L  +NEWLE ++  K  +   YRQ   +EL    Q +   + D Q    + + L 
Sbjct: 199  QKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLR 258

Query: 260  KKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXXSFKEELRLTE 319
            ++N +   +L+ +   +KKL+DEL + KQEF+REMS              + K EL    
Sbjct: 259  EQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELEFKN 318

Query: 320  EKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMGDSEEFDLDSTA 379
                ST+A   +S  Q++  D+L    QQLEES  +  +L+  V +++   E+     + 
Sbjct: 319  SPQASTDAATTES--QSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKT---ISG 373

Query: 380  NVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKEL 439
            + S+P LY DIG+LKKQ+I ER QKE LQ Q+E+FVVELE KVP+++S K+R+  LEKEL
Sbjct: 374  SQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKEL 433

Query: 440  SDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQN 499
            ++ A +L+  S +K+    +L+    +I+ LE     L +QRSDLARQVQ+LL   T++ 
Sbjct: 434  AETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRG 493

Query: 500  DSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNTELLKTARTL 559
            DS GPL+A+E AF+KK++  EN   + D+Q II+ERLVEFK+I  LQ +N +LL T R L
Sbjct: 494  DSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNL 553

Query: 560  ADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQ 619
            A++LE EE+    + +++E  TI EAKEAI+TLQ+   E+E+++  I +ERDAYKAI SQ
Sbjct: 554  ANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKAIQSQ 613

Query: 620  TSQSFDNLGDADRMKDSQENQEL-IKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQL 678
            TS    N G  D    + EN +L I+ LE+ LS    E   N +LL  E + L +SK++L
Sbjct: 614  TSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQELARSKSEL 673

Query: 679  TISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKY 738
             ++ EKE+SSR LAE+RLK+ +S+L +TK EN EL +R   L++ L+KQ+ R  ET+++ 
Sbjct: 674  VVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLAKQDTRTQETISEL 733

Query: 739  ISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVERNSLNLMVTQLQTLQSERE 798
            I C+S+L+ L A   N  A++          +   ++++ ERN L ++VTQLQTLQ ER+
Sbjct: 734  IDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNELTILVTQLQTLQKERD 793

Query: 799  NLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDA 858
             LLK+S  + K  I  LE + S+L+T +S K  E+        ++++W+QEKID ++   
Sbjct: 794  TLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEKIDALNECL 853

Query: 859  GKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNGETTQGQLRKDLEK 918
                 +L +KT  + +L+ + + L  K+ +++++  SY  LN   +  T    LR +LEK
Sbjct: 854  KSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVLTQTDALRSELEK 913

Query: 919  TMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYLAEKVQLEQCVSN 978
            T I LK A+SQ +E+K + ++ +ETL  ++   E   +      E    E+  L    + 
Sbjct: 914  TRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAV 973

Query: 979  LKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQ 1038
            LK  +  LN+E   QKN  E  K+E  K    ++S++ +L  +K +Y  +L +L +DL Q
Sbjct: 974  LKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELSKLTEDLNQ 1033

Query: 1039 QTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKASEQQAKEVLENGEKS 1098
            Q  YAN AQ+NYE+ELQ+HA+VSK ISQLR E Q  ++++  L+AS  + K+ LE  E  
Sbjct: 1034 QAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKKSLEENESC 1093

Query: 1099 WYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPGSSELLISLRR 1158
            W  QK E +       ++++++S+QN+LLF Q+ L         ++L   + EL+ +L+R
Sbjct: 1094 WAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDELKSEARELISTLKR 1153

Query: 1159 ERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIAKQHEDIMEQ 1218
            E DIL+TKL ++KR+E  L QK    E EL+ A+ ++ K Q      S + +++  I+EQ
Sbjct: 1154 ECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQ 1213

Query: 1219 LNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRI 1278
            LNQ+NLLRESN+TLRN +    ++N DL+  +  LQ  + PL +++   ++S+  KD++I
Sbjct: 1214 LNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQI 1273

Query: 1279 ILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRL 1338
             L+ +E +RWK+RS DIL ++E++DPEE++KL EE+S  + E  A +++ ++L DRF RL
Sbjct: 1274 SLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRL 1333

Query: 1339 KKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNL-EKLLTERDSESAN 1397
            KKQA E+L+ ++  Q  L+AE+ E + ++  +E+ L + + K  +L E +    ++E  N
Sbjct: 1334 KKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEENEIEN 1393

Query: 1398 NEDLRHELDDALERCKEIEVKLGE--TVGSSEGLT------------SQLNEEINSLKEQ 1443
            +   R +L DAL++ ++ + ++ E  T  S E  T             QL E +   + +
Sbjct: 1394 SSATRDQLQDALQKLEDAQARINEMSTAPSQEEQTLREELERTRQHVKQLEEHLAKTQNE 1453

Query: 1444 VRIFKEKENDSTLEGSQG-LSNVVESMXXXXXXXXXXXXXXXXXXYNKKFEEEKAKLSSE 1502
            VR+ +E +N   + G++  ++ V   +                  Y K+  E+KA+L   
Sbjct: 1454 VRVLEEAKNQ--VSGTEAEIARVKTELIDHSNKLLAEKEAEIKEKYEKQRLEDKAELEKS 1511

Query: 1503 NGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKT 1562
              S +E + + D+ +LKK+WEEEYE  + +RI+EA E L+KRIR+PTEE+I K+++ RK 
Sbjct: 1512 LAS-SESLKSSDIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPTEEKINKIIENRKR 1570

Query: 1563 ELEEEFQRRLKENNLQPEGGDA----------KEREELKKQLESEFEAKYKEILASTKKK 1612
            EL+EEF+ +L++   +  G             + ++E++K L+++ + +  E +A  KKK
Sbjct: 1571 ELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRHKQEVEK-LKADMKREMDEEVAQAKKK 1629

Query: 1613 AFEEGKQQAAMKSTLLERKI 1632
            AF+EGKQQA+MKS  LE+KI
Sbjct: 1630 AFDEGKQQASMKSMFLEKKI 1649

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1759 (35%), Positives = 1018/1759 (57%), Gaps = 85/1759 (4%)

Query: 10   SSGTDELSQR----IAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATV 65
            S+  D L++     I  FL +  ++L  +    +LS+ L  K+++F  LQS +L+   ++
Sbjct: 2    STAADTLTKEELTLIGSFLSVPVEQLNAI-ETSILSN-LKTKVEQFTELQSQSLKNEVSL 59

Query: 66   DELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFEL 125
            +EL+     +++ L+ + E LI +N +  + + ++E+++S   KE        +N++ EL
Sbjct: 60   EELQKTSQGRINDLRTQLEDLIEQNASASEEKKKIEKELSDEKKESFQLSSTRDNLRAEL 119

Query: 126  QNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLK 185
            +   E+ + L+   Q+ +KLL+ KIS+ E  K  + +L N  +    +  + ++E+Q+LK
Sbjct: 120  KEIQEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLK 179

Query: 186  CNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLK 245
             N    ++ +  + Q +  +++  E LE E+ +K +++ +Y      E+Q   ++++ L+
Sbjct: 180  YNDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLE 239

Query: 246  NDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXX 305
            N+  + KS  + L K+N+ +S +L  K  ++++L++  NTEK+E  +E+S          
Sbjct: 240  NNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELS---------- 289

Query: 306  XXXXSFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQV---RQQLEESNHER------ 356
                  K+E+            D LQ TQ  +  DD  ++   +Q + +++ ER      
Sbjct: 290  -----LKQEM-----------IDVLQ-TQVQKLQDDYTRILNTKQPIVQNDEERNLEVEE 332

Query: 357  -----LRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQI 411
                 +  +  +N+ + +     + + ++    +   D+  +KK+LI+ER+QKE LQ Q+
Sbjct: 333  LKQKLIETETQLNKELEERRNITMQTESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQV 392

Query: 412  ESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLE 471
            E F+VELE KVP INS K+R+  LEKEL+D  LLLE+   EK + T EL++     K ++
Sbjct: 393  EIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVK 452

Query: 472  INTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSI 531
              T +L +QR+DLA Q+Q++L + ++QNDS GPL+A+EV FI+ I++NE+    SDSQ +
Sbjct: 453  WETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQV 512

Query: 532  ITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIIT 591
            I+ERLV F++I  LQ++N +LLK+ R LA +LE +E++       +E++ IDEAKEAII+
Sbjct: 513  ISERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIIS 572

Query: 592  LQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLS 651
            LQ  N+++E K+ T+  E D YK++        D   + + ++ ++EN +LIK LE +L+
Sbjct: 573  LQSYNTKLEDKIKTLNDELDCYKSL-----PKPDTKVETEHLRLNEENTDLIKELETRLA 627

Query: 652  TLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENA 711
            T   E++K    LN EI ++ ++ +Q     + ER+SR LAE RLKL+Q++L ++K EN 
Sbjct: 628  TSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENE 687

Query: 712  ELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRR 771
            +L +R   LQ I  KQ+ R  ET+ +Y+SC+  LS  +     + ++           + 
Sbjct: 688  QLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKD 747

Query: 772  EIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDN 831
            +I  +S ERN L  +V+QLQ+LQ+ERE +   ++   +  +  +E +  ++  ++ +KD 
Sbjct: 748  DITIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDR 807

Query: 832  EIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDS 891
            EIK  E  + ++ +W+Q KID +       +DEL  KT  + +L  E+  L+K ++ S+S
Sbjct: 808  EIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASES 867

Query: 892  RIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEF 951
            R+ +YK LN++ N  T    L+ +LEK+ I L  AY++ +++KQ +S  EE L+N  N  
Sbjct: 868  RVTAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTV 927

Query: 952  EERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSL 1011
            EE  +      E    ++ +L    S L + I  LNNE   Q     EEK+EI KKL  L
Sbjct: 928  EETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNEL 987

Query: 1012 ESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEV 1071
             +  H++ +V  +Y+ KL  LQ DLEQQ +YANIAQ NYE+ELQKHAE++K ISQLR + 
Sbjct: 988  LAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDA 1047

Query: 1072 QSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQV 1131
             + R ++  ++A+    +E+L   EK W  Q+   +  I  LK++++++SSQNKLLF QV
Sbjct: 1048 HTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQV 1107

Query: 1132 ELLSKSEREFENKLLPGSSE-LLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAE 1190
            +LLSKSE  +  +     +E L++SLR +RDIL+T+L+V++ E K L  K  ++  EL  
Sbjct: 1108 DLLSKSENSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTN 1167

Query: 1191 ARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSEL 1250
             R KL ++++   N     ++H++IM QLNQ+NLLRESN+TLRN  N ++EK   LQ +L
Sbjct: 1168 TRAKLTEIRQQYENTKISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQLQEDL 1227

Query: 1251 NHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKL 1310
              L+ K+LPL +E +  ++ I+E +Q++    +E +RWK+RS DIL +H+KIDP E+ KL
Sbjct: 1228 ETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKL 1287

Query: 1311 EEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKM 1370
            E EI+ LK+ L  K KEN +LNDRF R+KKQAHE+LN+SK  Q  L  ++ +L+     +
Sbjct: 1288 EAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHI 1347

Query: 1371 EEILKETQTKVLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLT 1430
            + +L+  +  + N E+   + + +S +   LR +L++AL   KE E K   +V SS+ ++
Sbjct: 1348 QSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEIS 1407

Query: 1431 SQLNEEINSLKEQVRIFKE-KENDSTLEGSQGLSNVVESMXXXXXXXXXXXXXXXXXXYN 1489
            S LN+ I+SL  ++   KE K N++T+ G   LSNVVE M                  + 
Sbjct: 1408 SHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEFK 1467

Query: 1490 KKFEEEKAKLSSENGSPAEPVSAP--DVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRM 1547
            +K  EE  ++ ++          P  D+++ ++QWE+EYE I  +RI++AEENLK+RIR+
Sbjct: 1468 EKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRL 1527

Query: 1548 PTEERIKKVLDKRKTELEEEFQRRLKENNLQPEGGDAKER----EELKKQLESEFEAKYK 1603
            PTEE+I  V+ K+K ELE+E+  ++  N    E   ++E     E+LK  ++ E E    
Sbjct: 1528 PTEEKINSVIQKKKNELEKEYDEKV--NQRAKELLSSEENKTFIEDLKNDIKKELERNID 1585

Query: 1604 EILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNNPTPE--------KAAATSV 1655
            + L + K KAFEEGKQQA MK+T LE+KISKLESQL  SN             K  +   
Sbjct: 1586 QELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLKTPSDEN 1645

Query: 1656 GLPTKIDESRTE------NMATGTPAFGEKVLKL--SDKPAFSFQPSSKSNPFTSALPGN 1707
             +P+K +E+ ++       +A    + G   L L  S  P+     S  SNPFTS     
Sbjct: 1646 NVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSNPFTSPFQQT 1705

Query: 1708 NNVFGMKPTFSFTPGSSQP 1726
             N   +       P  +QP
Sbjct: 1706 KNDANI-------PAVTQP 1717

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  857 bits (2213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1762 (35%), Positives = 1027/1762 (58%), Gaps = 97/1762 (5%)

Query: 20   IAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDSL 79
            IA FL +    ++ +  +  L D +++K +EF  LQS+NLR +  ++E KA  +SK + L
Sbjct: 9    IATFLNVERSNVESLAQE--LKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKL 66

Query: 80   KKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFE---LQNTIEQKNVLK 136
            K+E + ++ +N   +     L E+V  L       L ++  +K     LQN I++ N   
Sbjct: 67   KEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRAN--- 123

Query: 137  SNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELE 196
               +E+    +EK++ELE  + E +EL    K L  +++E + + Q  + + L  KSELE
Sbjct: 124  ERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSELE 183

Query: 197  IVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSRE 256
               Q++ +L K+ EWLE+E+T+K +  + YR++ D  +  ++  V +LK+D ++EKSS+E
Sbjct: 184  RNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSSKE 243

Query: 257  FLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXXSFKEELR 316
             L KK  E ++ LQN L E K L D L  EKQEF +E+S              S +  L 
Sbjct: 244  ILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTL- 302

Query: 317  LTEEKHNSTEADNLQSTQQARFM-DDLAQVRQQLEESNHERLRLQAVVNEVMGD------ 369
              ++K  + EA+   S++  + + ++L+   ++L++   + +RL+++++    D      
Sbjct: 303  --QQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTK 360

Query: 370  --------------SEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFV 415
                          S+E      +++S+ ++ GDI +LK+QL++E+ QKE LQ Q+ESFV
Sbjct: 361  GRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFV 420

Query: 416  VELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIK----QLE 471
            +ELE+K+PVINS +ER+  LEKEL+D ALLLEH + E E KT EL+S   KI     QLE
Sbjct: 421  IELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLE 480

Query: 472  INTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSI 531
            I    L+RQR+DLA Q+Q+LL N ++ ND+   L  DE+ FIK ++ N+N ++ +DSQ +
Sbjct: 481  I----LLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKV 536

Query: 532  ITERLVEFKDIATLQERNTELLKTARTLADRLEEEEK----NSNIRIDSLERKTIDEAKE 587
            I+E L++FKDI  LQE+N EL+KT RTLA +LEE E+     SN  +D  + +   EAKE
Sbjct: 537  ISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDE-DNEIFAEAKE 595

Query: 588  AIITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQE----NQELI 643
            AI+TL++ N  +E  +  + KERDA+K ++S+  +   N   ++ +    E    N+ ++
Sbjct: 596  AILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRER--NFKSSNSVHKYHELKSYNETVV 653

Query: 644  KSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTL 703
            K LE++L+ LT +++ +++ L +E+  L++  +QL +  EK RS+++LAE+RLK+ Q+++
Sbjct: 654  KDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSM 713

Query: 704  EMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXX 763
            E+   EN +L  RS  L+  L +Q+    +T + Y+   SK S LE    NL+ E     
Sbjct: 714  ELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLK 773

Query: 764  XXXXXXRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELK 823
                  + E+   + E+  L +MVTQLQ+LQSERE LL+  Q+  K  I+++     +L 
Sbjct: 774  DREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLD 833

Query: 824  TEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLK 883
             ++S + +EI   E  + AQ +W+Q+KIDE S    +I+ +L TK   + +L L+   L+
Sbjct: 834  KQLSERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLE 893

Query: 884  KKIEESDSRIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEET 943
            K++E +  RI +Y+T+N   +    +  + K+LEKT IEL  AYSQ EEFK +S  +E+ 
Sbjct: 894  KELEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDA 953

Query: 944  LKNLSNEFEERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNE 1003
            LK L+  F  +    +   +    EK ++E     LK+ ++ + NE  +Q   +E E+  
Sbjct: 954  LKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKR 1013

Query: 1004 ILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKI 1063
            + + +  L+ +   + +VKK +++KL +L+ DLE+QT YAN AQKNYE+ELQ+HA+VSK 
Sbjct: 1014 LTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKT 1073

Query: 1064 ISQLRSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQ 1123
            IS+LR + Q  +++ + L A  Q  ++ +   EK   +++ E    ID  ++++D+I+ Q
Sbjct: 1074 ISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQ 1133

Query: 1124 NKLLFSQVELLSKSEREFENKL---LPGSSELLISLRRERDILETKLTVSKREEKLLHQK 1180
            N+LL++Q++LL+++E   EN       GS+ L++SLRRERDIL+TK+ V + E+  L QK
Sbjct: 1134 NQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQK 1193

Query: 1181 QVALEDELAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQ 1240
               +++EL   ++    L+   S HSD+   ++ I   L Q+NLLRESNVTLRN +  A 
Sbjct: 1194 LDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQAL 1253

Query: 1241 EKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHE 1300
            ++   +  +L   ++++LPL S L      I+EKD +I    DE+ RWK R  +++ +H+
Sbjct: 1254 DEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQ 1313

Query: 1301 KIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEV 1360
            K++ ++Y KLEE ++  K+ L+ K +E  +LNDRF RLKKQAHEKLN SK  Q++L  ++
Sbjct: 1314 KVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQI 1373

Query: 1361 NELQGTKTKMEEILKETQTKVLNLEKLLTERDS--ESANN-EDLRHELDDALERCKEIEV 1417
            + L   K   ++I K+   K     +LL+E ++  E  N+ E LR EL+  + + +E+EV
Sbjct: 1374 SNLISEK---DDIRKQLDVKTEENSELLSELNNFREKQNDLETLREELNKEISKSEELEV 1430

Query: 1418 KLGETVGSSEGLTSQLNEEINSLKEQVRIFKEKENDSTLEGSQGLSNVVESMXXXXXXXX 1477
            KL   + SS   +   N+EI  L++ +   K +   ++ +  +  +  VE++        
Sbjct: 1431 KLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFENQK 1490

Query: 1478 XXXXXXXXXXYNKKFEEEKAKLSS---ENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRI 1534
                      +NK+  EE  K+ +   EN  P   ++  DV +L+KQWEE+ E + Q+RI
Sbjct: 1491 TKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNV-DVEALRKQWEEDSEELIQKRI 1549

Query: 1535 QEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKE--NNLQPEGGDAKEREELKK 1592
             EAE+NLKKRIR+P+EE+I K+++KR++ELE EF +++++   +L       +   ELK+
Sbjct: 1550 AEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSNEFNNELKE 1609

Query: 1593 QLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLN-------SSNNP 1645
             LE E + ++++ L + +KKAFEEGKQQA MK+TLLERKI KLESQ+         + + 
Sbjct: 1610 ALEKELKERFEDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDV 1669

Query: 1646 TPEKAAATSV-GLPTKIDESRTENMATGTPAFGE----KVLKLSDKPAFSFQPSSKSNPF 1700
             PE+ +  SV  +P        E + +   +FG     KVL    KP+  F  +S  N  
Sbjct: 1670 KPEENSTPSVKKIP--------ETLNSSDTSFGNSNNVKVL----KPSSPFGATSAFNNP 1717

Query: 1701 TSAL-----PGNNNVFGMKPTF 1717
             +       P   + F   PTF
Sbjct: 1718 FTFNNNGNPPAFASAFA--PTF 1737

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/1734 (34%), Positives = 1002/1734 (57%), Gaps = 109/1734 (6%)

Query: 16   LSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSK 75
            ++ R+A FL + D +L   + + VL   +  KL++    +S NLR+ AT+D+LK+   +K
Sbjct: 6    IASRVADFLQV-DQQLIQDINNDVLGR-IEEKLEDLRKQKSENLRITATLDQLKSQSENK 63

Query: 76   VDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVL 135
            ++S K    +L +  +  K  R   EE+  +L +  +    ++  ++ E++   +QK + 
Sbjct: 64   LESFKIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQKELA 123

Query: 136  KSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSEL 195
             ++KQ++ + L EKI EL ++K +  E    NK LRQ+++ T+ E+QT +   L  KSE+
Sbjct: 124  DASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEI 183

Query: 196  EIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSR 255
              ++Q++ +L ++N+WL  ++ +KT QL ++R+   +ELQ S  +V+ ++++ ++ ++S 
Sbjct: 184  LRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSN 243

Query: 256  EFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXXSFKEEL 315
            + L +    + + L+ KL E K++ DE N  KQE ++EMS              S K+E+
Sbjct: 244  QKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEM 303

Query: 316  RLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEV-----MGDS 370
              T+   N+ ++      ++   +++L  V+ +L+ S    ++L+  ++E+     + DS
Sbjct: 304  DATK---NNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDS 360

Query: 371  EEFDLDSTANVS---IPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINS 427
            E  +  +++  S   IPKLYGD+G+LKKQL+ E+ QK+ L+ Q+E+FVVELE+K+PV+NS
Sbjct: 361  EVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNS 420

Query: 428  LKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQ 487
             KERS  LE+EL+++ +LLE T  ++++K+ +L+     +K  E    +L +QR DLA Q
Sbjct: 421  FKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQ 480

Query: 488  VQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQE 547
            +Q+LL N +++++  GPL+A+E+ F+K +  ++  +  SD+Q IIT+RLVEF+ +  LQ+
Sbjct: 481  IQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQ 540

Query: 548  RNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIE 607
            +N+ELL T R LAD LE  E  +  +I  LE +T+ EAKE I+TL +    +E+++  + 
Sbjct: 541  KNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILS 600

Query: 608  KERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKNNELLNQE 667
            KERDAYKA LS  + S  N   A     S +N + +K LE +L+ +  E   N +  + E
Sbjct: 601  KERDAYKA-LSVNASSGTNTPKAITYP-SPDNDDKVKDLETRLTAVIQEAENNAKEWSSE 658

Query: 668  IRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQ 727
              NL +   +++++ E E++SRTLAEDRL LLQSTLE++K +  EL +RS +LQ IL+KQ
Sbjct: 659  NSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQ 718

Query: 728  EARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVERNSLNLMV 787
            + R  ETV+  I  +S LS +++  + L +EK          + E ++ S E     +++
Sbjct: 719  DKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLI 778

Query: 788  TQLQTLQSERENLLKESQASHKAAIAQLEVQTS---ELKTEISSKDNEIKASEDAKRAQT 844
             QLQTLQ ERE LLKE+Q S+K  + +LE++ S   E   EI      I ++   K  Q 
Sbjct: 779  AQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASN---KEHQY 835

Query: 845  KWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGN 904
             WFQEKID+++S+A + +  L  K A + +++  +N+   K++E+++R  SY  L++  +
Sbjct: 836  NWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDD 895

Query: 905  GETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEK 964
             +     LR++LEK  ++L  +YSQ E  K ++  + +++  +S  FEE  +  +     
Sbjct: 896  AQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIIT 955

Query: 965  YLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKE 1024
               E+ QL+  V+ L   +  LNNE   QK+  + E+N  ++++  L+  + S+ + K +
Sbjct: 956  LENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKAD 1015

Query: 1025 YDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKAS 1084
            Y++K+  +QKDLE QT YAN +Q++YE ELQKHA+VSK I+ LR+E QS +S+++ LK  
Sbjct: 1016 YEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQ 1075

Query: 1085 EQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENK 1144
             Q A E L+N EK W  QKTE +  +  L+++V  +S+QNKLL+ Q+ELL+K+E + +N 
Sbjct: 1076 SQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTE-DRDNS 1134

Query: 1145 LLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSN 1204
                SS+LLISLRRERD+LETKL V+  E+ +L Q+    + E+ +   +L +++ + S 
Sbjct: 1135 --HDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSE 1192

Query: 1205 HSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSEL 1264
             + + +Q E+IM++L+Q++LLRESNVTLR+  ++ +++  +L+S+L     ++ PL S +
Sbjct: 1193 SAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSI 1252

Query: 1265 SECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAK 1324
            S  +  I+ K+Q +I   +EA+RWK RS DIL ++E+IDPEE+ KL+EEI+++K EL+  
Sbjct: 1253 SSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTT 1312

Query: 1325 S-------KENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKET 1377
                     E  D   +F R++ QA ++LNASK  + +LS+E+N++   K+++E  L + 
Sbjct: 1313 KDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKC 1372

Query: 1378 QTKVLNLEKLLTERDSESANNED-LRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEE 1436
            +T    LE+ L     E+   E     +L    E    I+V++ E    +E   +  +E+
Sbjct: 1373 KTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQM-ENASKTEQNNADSDEK 1431

Query: 1437 INSLKEQVRIFKEKENDSTLEGSQG---------------LSNVVESMXXXXXXXXXXXX 1481
            I SL E V +   K  +   E S                   ++V+++            
Sbjct: 1432 IKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLI 1491

Query: 1482 XXXXXXYNKKFEEEKAKLSSENG--------------------------SPAEPVSAPDV 1515
                     KFE EK   S+ N                           SP++P    D+
Sbjct: 1492 KDKEKELRSKFEAEKE--SAWNSREEELRKQFEEREKRIREECEKTTVQSPSQPTLDIDI 1549

Query: 1516 NSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKE- 1574
            ++LK +WE+EYE  + ++I+ AEE LKKRIR+PT+++I K+++ RK  LEE F+ ++ E 
Sbjct: 1550 DALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEK 1609

Query: 1575 -NNLQPE-GGDA----KEREE---LKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKS 1625
               L  E G DA    K R E   LK  +  +FEA     LA  K+K+FEEGKQQ ++K 
Sbjct: 1610 AQKLAGEIGNDAITLEKHRAELNALKDSMRKQFEAD----LAEIKQKSFEEGKQQVSLKL 1665

Query: 1626 TLLERKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATG--TPAFG 1677
              LE KI  LE Q  S+  P                 E+ T NM+     P FG
Sbjct: 1666 KFLESKIRNLEQQ-KSTIKPV----------------ENDTSNMSAAFQAPVFG 1702

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1760 (33%), Positives = 985/1760 (55%), Gaps = 112/1760 (6%)

Query: 19   RIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDS 78
            R+A  LG+   +++ +     L   L  + Q F  L++ N RL  ++   ++ C   V++
Sbjct: 20   RLAARLGLEQGQVQQL--GEQLVRTLWGREQAFRQLEAENTRLKVSIGAAESACEHGVEA 77

Query: 79   LKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSN 138
            L++  ++L  E     Q+R + E   +      ++     E V+ +L+ T  +     S 
Sbjct: 78   LRERQQQLAAEAGA--QQRGQGEAGSAGRAGGPSVP----ERVQQQLEETERRVAAGDSA 131

Query: 139  KQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIV 198
            ++++ +LLEEKIS+L+AS+ E + ++  NK LR+  ME +  VQ+ +   L +++E++ +
Sbjct: 132  RRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRL 191

Query: 199  KQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFL 258
            +Q++ ++  + EW   ++  K +QL  YR++ + E+Q +  E+  +KN+ ++E ++   L
Sbjct: 192  QQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAAL 251

Query: 259  LKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXXSFKEELRLT 318
              KN E+S+ LQ+ L E K+L+D L++EKQEF+REM+              + K++L   
Sbjct: 252  RSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDL--- 308

Query: 319  EEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVM----------G 368
            E+ ++  +   +  +++ R ++DL   +++LE S     RL+  + E++           
Sbjct: 309  EKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRN 368

Query: 369  DSEEFDLDSTANVS-IPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINS 427
              E  ++ S +  S I  +YGD+  L+KQL++ER  KE LQ Q+ESFVVELE+K+PV+NS
Sbjct: 369  GIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNS 428

Query: 428  LKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQ 487
             K+R   LEK+L+ + LLLE T+ E++ K  +++    K+   E     L++QRSDLARQ
Sbjct: 429  FKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQ 488

Query: 488  VQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQE 547
            VQ LL + ++++DS GPLTA+EV F+KK+    + +  SD+Q+II+ RLVEFK +  LQ+
Sbjct: 489  VQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQ 548

Query: 548  RNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIE 607
            +N ELL   R LA +LE+EE  +  ++ SLE+ T++EAKEAI++LQE    +E ++ T+ 
Sbjct: 549  KNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVT 608

Query: 608  KERDAYKAILSQT-SQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKNNELLNQ 666
             ERD++K ++S+  + S  N   A  ++  QE  + I  LE +L  +  E+ ++ ++LN+
Sbjct: 609  TERDSFKLLVSEGKNNSLPNPVGAAALQ-PQEVADGIAHLEARLKAMAEESEQHAKMLNE 667

Query: 667  EIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSK 726
            EI+ LY+S +QL I  E+ERSSR LA+++L L+Q +LE+ K ENA+L  R+  LQ++L +
Sbjct: 668  EIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQALLLE 727

Query: 727  QEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVERNSLNLM 786
            Q+ R   T+ +++S +S+L  + ++   L +E+          ++E + ++ + N   L+
Sbjct: 728  QDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQLL 787

Query: 787  VTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKW 846
            + QL+T Q ER++L++E++  ++  I +L+ + S  K ++  K  E      +   Q KW
Sbjct: 788  ILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKW 847

Query: 847  FQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNGE 906
            FQ K+D +  + G  +  L  KT+ +  L+  +N    K+E +         + ++ +  
Sbjct: 848  FQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDHAS 907

Query: 907  TTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLS-NEFEERTEALKSNAEKY 965
              Q  L KDL++   +L  AYS+ E +K  S+  E    +LS N  ++  +  K  A   
Sbjct: 908  RVQS-LSKDLDEANRKLSSAYSEIERYKAASNATERP--SLSYNAVQDNKDGSKQAAISL 964

Query: 966  LAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEY 1025
             AE  +L   ++     I  L +E   ++     E++E+ +K+ +L + +  + + K +Y
Sbjct: 965  EAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADY 1024

Query: 1026 DQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKASE 1085
             QK+ QLQ DLE+Q +  N A+  Y+  LQK AE+S+ I  LR   +S +SEI + K++ 
Sbjct: 1025 QQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAA 1084

Query: 1086 QQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQV---ELLSKSEREFE 1142
            ++A++VLE  E++W  QK +++A++D   ++++ +S+QN+LL+ Q+        S  E +
Sbjct: 1085 EEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSSLEPD 1144

Query: 1143 NKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQEND 1202
             K+   + EL+++LRRERDILETK+ VSKREEK+L Q+    + EL   R +L + +   
Sbjct: 1145 TKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKGLV 1204

Query: 1203 SNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNS 1262
            +  +D ++  E++ E+LNQ+NLLRE N++LRN      E N  LQ+E+  LQ K+ P+  
Sbjct: 1205 TEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPMEE 1264

Query: 1263 ELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELE 1322
            ++     ++ EK+Q++ LL +E+DRWK+RS DIL ++E+IDPEEYRKL  EI  LK ELE
Sbjct: 1265 QIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAELE 1324

Query: 1323 AKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVL 1382
             KS E+ D  +RF +L+KQA+E+L+  K A+A + +E+      K+++E  L E + K+ 
Sbjct: 1325 RKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAREKIT 1384

Query: 1383 NLEKLLTERDSESANNEDLRHELDDALERCKEIEVKL----GETVGSSEGLTSQLNEEIN 1438
            +LE  LTER + S ++  + HEL++   + ++ E  +     E   S E    QL+E   
Sbjct: 1385 SLETQLTERPA-SEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLDE--- 1440

Query: 1439 SLKEQVRIFKEKENDSTLEGSQGLSN-------VVESMXXXXXXXXXXXXXXXXXXYNKK 1491
             L +Q+     ++N +   G    S+       V+E                       +
Sbjct: 1441 -LNKQLETI--QKNSAPSSGHSDPSSYHEQPTAVLEDFKKQVEEERRTLIESHQQELTAR 1497

Query: 1492 FEEEKAKLSSENGSPAEPV-----------SAPDVNSLKKQWEEEYEAISQQRIQEAEEN 1540
             E  +    +E     E +           ++ ++ +LKK+WEEEYE  + QRI+EAEE 
Sbjct: 1498 LEASRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEA 1557

Query: 1541 LKKRIRMPTEERIKKVLDKRKTELEEEFQRR--------LKEN--NLQPEGGD-----AK 1585
            LKKRIR+P+EERI +V+++++  LE+EF  +        LKEN  ++  +  D      K
Sbjct: 1558 LKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQK 1617

Query: 1586 EREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNNP 1645
            E  +LKK L  +FE +    L   KKKAFEEG+QQ  MK  LLE KISKLESQ       
Sbjct: 1618 EIVQLKKDLADKFEGQ----LVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAK----- 1668

Query: 1646 TPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTSALP 1705
                 A     +PTKI    T+ +A   P                     K +PF  A  
Sbjct: 1669 -----APLGTNVPTKIPLENTQPLAQQVPV--------------------KPSPFQLAYA 1703

Query: 1706 GNNNVFGMKPTFSFTPGSSQ 1725
                 FG  P F F   S Q
Sbjct: 1704 --QATFGNVP-FLFNKNSEQ 1720

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/1726 (33%), Positives = 964/1726 (55%), Gaps = 62/1726 (3%)

Query: 19   RIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDS 78
            ++A FL  S D ++ +  D  +   L N+  EFN++++  +++   ++  K    + +  
Sbjct: 23   KVASFLDTSPDVVQTL--DETILKSLNNRFDEFNHIENEQIKISTELEVTKKTNNTTIKK 80

Query: 79   LKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSN 138
            LK E   LI   ++  + +    +++++  ++K     ++E+   ++ +  E  + L+S 
Sbjct: 81   LKNELTELIDSYESVCKEKEDAYKKIAEEEEKKIDNRDELESKLIQIHSLEENVSELQSK 140

Query: 139  KQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIV 198
            KQE++K L+++I+EL   +   + L N+    R ++++ +NE Q LK N L  +++LE +
Sbjct: 141  KQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERL 200

Query: 199  KQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFL 258
             Q++  + K   WLE+ +  K EQ   YR+++  E Q    ++  +KN+    KS+   L
Sbjct: 201  SQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVL 260

Query: 259  LKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXXSFKEE---- 314
             ++  E+S  L++    +K +    N +K    +E++                + E    
Sbjct: 261  QERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNE 320

Query: 315  LRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHE---RLR----LQAVVNEVM 367
            L LT    + T + + + +   R ++DL      ++E N E   +LR      AV N   
Sbjct: 321  LSLT---VSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAVSNSTS 377

Query: 368  GDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINS 427
             D    DL +    S+ K Y DI VLKK+L  E+ Q+EN ++ +E F+ +LE ++P + +
Sbjct: 378  SD----DLRN----SLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLEA 429

Query: 428  LKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQ 487
             + R+   E+EL +  LLLE  + EK   + EL  A  +I+ +E     + +QRSDLA Q
Sbjct: 430  YRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQ 489

Query: 488  VQFLLFNGTLQNDSRGPLTADEVAFIKKII--ENENPSNESDSQSIITERLVEFKDIATL 545
            +QF L + ++ NDS GPLT +EV FI+ II  ++E    E+D+Q +I+ERL +FKDI  L
Sbjct: 490  LQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIEL 549

Query: 546  QERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVST 605
            Q++N ELLKT R LA +LEEE+K        +E +TI EAKEAI+TLQ  NS + +K++ 
Sbjct: 550  QQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAKIAA 609

Query: 606  IEKERDAYKAILSQTSQSFDNLGDADRMKDSQE--NQELIKSLEDKLSTLTTETSKNNEL 663
            + KE + YK +LS T  S     D D+ ++ +E  + +L+K LE +++++  E+ +N  +
Sbjct: 610  LTKELETYK-VLSNTEDS-STPADFDKQREQREIEHTQLVKELETRIASIIQESKENANI 667

Query: 664  LNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSI 723
            LN +I  L +    ++I   +E+S++ LAE+RLKLLQ +++MT  EN  L +R + L+++
Sbjct: 668  LNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNV 727

Query: 724  LSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVERNSL 783
            + +Q+ R  ET+N  I  +S+L+ +E +      E           + E+ +++ E+NS+
Sbjct: 728  VVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSM 787

Query: 784  NLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEIS-SKDNEIKASEDAKRA 842
             L+VT+LQTLQSERE+LL  +Q      +  LE   ++L+ ++  +++N     E+    
Sbjct: 788  KLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLMEETTEL 847

Query: 843  QTKWFQEK--IDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLN 900
            +  + Q+K  + E  S+  K   E+  K     + + E   L K+++E    I  YK  +
Sbjct: 848  KDDFRQKKKSLKEEMSNVEKRYSEIVEKER---ETKWENTRLTKQLKEKTELIEKYKAAS 904

Query: 901  DAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKS 960
            D          L+K+L+    EL  +YSQ E +++      +++ +++ +   +  A K 
Sbjct: 905  DDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKE 964

Query: 961  NAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQ 1020
               +    K  +    + LK  ID LNNE  +QK   E+EK    +    LE     L Q
Sbjct: 965  RITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQ 1024

Query: 1021 VKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQ 1080
             K++Y+ KL  L KDLE+Q  YAN AQ NYE+ELQ HA VSK ISQLR + Q  R+EI +
Sbjct: 1025 SKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAE 1084

Query: 1081 LKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSERE 1140
            L  S   AK +L   + SW  Q+ E +  I+  K++++  S QNK+LF Q +L +++  E
Sbjct: 1085 LTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDE 1144

Query: 1141 FEN------KLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKK 1194
             +N        + G ++L++SLR ERD+L+ +L V++ EEKLL ++  ++E +      +
Sbjct: 1145 -DNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLE 1203

Query: 1195 LFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQ 1254
            L K++E   N+ D+ +QH+ +M QL Q++LLRESN+TLRN     Q KN  LQ+E+ +L 
Sbjct: 1204 LQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLH 1263

Query: 1255 SKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEI 1314
             K+LPL +EL      IEEKD+++ +  +E++RWK+RS DIL ++++IDP E+  L EE 
Sbjct: 1264 DKLLPLETELQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEER 1323

Query: 1315 SNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEIL 1374
            + L+ +LE KSKEN +L +RF +LKKQAHEKLNASKI+Q +L+ ++N+L+  K ++   L
Sbjct: 1324 NRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQL 1383

Query: 1375 KETQTKVLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLN 1434
            +  +   L+LEK L      S +   ++ +L++AL + K+ E K   +V SS+ +   LN
Sbjct: 1384 ETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLN 1443

Query: 1435 EEINSLKE-----QVRIFKEKENDSTLEGSQ--------GLSN-VVESMXXXXXXXXXXX 1480
             EI  L+E     Q  +  EK   ST E           G+SN +VESM           
Sbjct: 1444 SEIKKLQEESSKLQEELAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKQSFEEEKIKF 1503

Query: 1481 XXXXXXXYNKKFEEEKAKLSSENGSP-AEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEE 1539
                   + KK + E  KL +E  +   EPVS  D N+++KQ EEEYE  + QRI+EAEE
Sbjct: 1504 IEEQTTEFKKKLQAEINKLKAEYETKQIEPVSI-DENAIRKQIEEEYEQATSQRIKEAEE 1562

Query: 1540 NLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQPEGGDAKER--EELKKQLESE 1597
            NLK+RIR+PTEE+I KV+DKR+T+LE EFQ +++    +   GD K    + +KK+++ E
Sbjct: 1563 NLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQEE 1622

Query: 1598 FEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQL-NSSNNPTPEKAAATSVG 1656
               KY+E L   KKKAF+EG+QQ  MK++ LE+KI+KLES L N+ +N         S  
Sbjct: 1623 LARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVSTD 1682

Query: 1657 LPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTS 1702
              TK + S  + +   T    +     +++   +  P +  NP  S
Sbjct: 1683 NETKYEGSDKKPVTINTNVVSDVGENNAERTPMNKFPRAIMNPLLS 1728

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1609 (32%), Positives = 868/1609 (53%), Gaps = 112/1609 (6%)

Query: 193  SELEIVKQQVGMLTK-----SNEWL-EKEVTSKTEQLIKYRQENDT-ELQKSLQEVARLK 245
            SE++ +KQ+V  L +     S +WL EKE  +K + L++    N T +L+++   +  ++
Sbjct: 168  SEIQRLKQEVTFLNENKSSLSEQWLKEKEEFNKAKLLLEKNLNNSTIKLEEATTTLKSME 227

Query: 246  NDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXX 305
                   +    L  KN ++++  +N ++EIK L D L   K + ++E++          
Sbjct: 228  -------AKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQ 280

Query: 306  XXXXSFKEELRLTEEKHNS-TEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVN 364
                S +EELR   E ++  T+  +L+S Q      D+  +  ++EE  +E   L +++N
Sbjct: 281  GQLSSTQEELRQNVELNSKFTKFPDLES-QNETLKSDIQDLTLKIEELQNENFNLNSMIN 339

Query: 365  EVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPV 424
            ++  +    +  S+ + ++P LY  I +LKKQ+ +E+ +K++LQ QIESF++ELE K+P+
Sbjct: 340  QMSNEQNNSNNSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPI 399

Query: 425  INSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDL 484
            I+S +E++  LE EL+++ LLL  TS+EK     +L +   K+   + N   LIRQR DL
Sbjct: 400  ISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDL 459

Query: 485  ARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESD--SQSIITERLVEFKDI 542
            A QV+ LL    ++NDS GPLT +E+ FI KI  N    N S+  SQ +I+ERLV F +I
Sbjct: 460  ANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNI 519

Query: 543  ATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESK 602
              LQ +N ELL + R+L++ LE  E N+N   +  + KTI +AKEAI+TLQ  N  +ESK
Sbjct: 520  EELQAKNMELLNSIRSLSENLENIE-NANSHKE-FQNKTIADAKEAILTLQYHNDILESK 577

Query: 603  VSTIEKERDAYKAILSQTSQSFDNLGDADRMKDS---QENQELIKSLEDKLSTLTTETSK 659
            V  +E ERD++K +L+  + S D+    D +  S   + N++ I+ L+  +  L  E  K
Sbjct: 578  VKVLEAERDSFKLLLNN-NVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKK 636

Query: 660  NNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHE 719
            N + L  +I +    K+ LTIS EKE+SS TL  +++ L +S  +M K EN EL +R   
Sbjct: 637  NKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFEN 696

Query: 720  LQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVE 779
            LQ+I+ KQE++ G+ +NKYI+ ++++S L+ + +   +EK            E+ K S E
Sbjct: 697  LQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEE 756

Query: 780  RNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDA 839
            +N L +M++QLQ+LQ+ER  LL ++Q    + I +LE    +L   + SK  EI+    +
Sbjct: 757  KNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSIS 816

Query: 840  KRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTL 899
              +Q  W+Q  ID++      I+ EL +K + ++       DL  KIE  +S+  +  T 
Sbjct: 817  NESQCTWYQNTIDDLKKINSAIKTELTSKNSLIS-------DLNTKIELLESQSYTIDTN 869

Query: 900  NDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALK 959
                +      Q+ KDL+ T + L  AY+Q EE+KQ+ ++ EE+LK L + FE     + 
Sbjct: 870  TRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMD 929

Query: 960  SNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLG 1019
                K L+E   L+       K I  L+ +   +KN+  EE  ++  ++  L   +    
Sbjct: 930  DKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSA 989

Query: 1020 QVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQ 1079
                EY++K+ +LQ  LE +  +A+ AQ+ YE  L K     + I + + +++     I 
Sbjct: 990  DTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIV 1049

Query: 1080 QLKASEQQAKEVLENGEKSWYNQKTELDAHIDDL---KRQVDNISSQNKLLFSQVELLSK 1136
             +++  ++   +L   E  W   K + DA I DL   K+++DN+++QNKL   Q+ELL+K
Sbjct: 1050 IIESDLEKKTSLLSENESLW---KKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNK 1106

Query: 1137 SEREFENKLLPGSSELLIS-LRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKL 1195
                 ++  L   ++ + + LR +RD+LETKL++++R+ K    K  +L DELA  + KL
Sbjct: 1107 DFSSMDSSQLSSETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKL 1166

Query: 1196 FKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQS 1255
               +     HSD+ + HE I+ +LNQ+ L +ESN TLRN V+   EKN  LQ++LN   S
Sbjct: 1167 ISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENS 1226

Query: 1256 KILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEIS 1315
            K+  L+ EL   ++S+ +K+  I+L+ +E+++W+ R+ ++  + +K+D +   KL  E+ 
Sbjct: 1227 KLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELD 1286

Query: 1316 NLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILK 1375
             LK + E K K+N +L +RF  LKKQAHE+LNASK  Q++L+ ++NEL+ + T +E  L 
Sbjct: 1287 ALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALS 1346

Query: 1376 ETQTKVLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNE 1435
              Q K ++L+  L      S N      +L +     K ++ +      SSE    +L +
Sbjct: 1347 SEQKKSMDLQNTL------SDNEVKYTQKLSNIESELKALKTENNSFKLSSEKEKMELTD 1400

Query: 1436 EINSLKE-------QVRIFKEKENDSTLEGSQGLSNVVESMXXXXXXXXXXXXXXXXXXY 1488
            E++SLK+       ++        DST+        ++ESM                   
Sbjct: 1401 EVDSLKKSLVEAQSKLSAIGSDSTDSTMNA------MIESMKKEFEEEKLKLLEDKTNEL 1454

Query: 1489 NKKFEEEKAKLSSE---------NGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEE 1539
              +++ EK KL  E         +    + +   +  SLKK+WEEEYE  + +RI+EA+E
Sbjct: 1455 EAQWKLEKDKLLKEYEEKIEDLQSARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKE 1514

Query: 1540 NLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKE-------NNLQPEGGD-AKEREELK 1591
             LKKRIR+P+E +I +V++KRK ELE E++ +L+E       N    E  D  K REE+K
Sbjct: 1515 TLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKLNEIEANRNSIETIDPGKLREEIK 1574

Query: 1592 KQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSS--NNPTPEK 1649
            ++++ +   K++  L   KKK+FEEGKQQ++MK+TLLERKISKLESQL+ +  N+   +K
Sbjct: 1575 EEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQLSEAIENDKQSDK 1634

Query: 1650 AAATSVGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFT-------- 1701
                    P   D ++T  +A+  P   +       KPAFSF   + +N           
Sbjct: 1635 N-------PIISDLAQTSTLASIQPPSAK-------KPAFSFGGFNTTNSLNANKGFSSS 1680

Query: 1702 ----------SALPGNNNVFGMKPTFS----FTPGSSQPESRPTFGSTG 1736
                      + +  N    G+  T S    F P SS   +   F   G
Sbjct: 1681 SNNTSQSSKDTEIVQNPFSLGVSQTSSSPMHFNPFSSSATTSNVFNQNG 1729

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  571 bits (1472), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 531/1760 (30%), Positives = 907/1760 (51%), Gaps = 161/1760 (9%)

Query: 16   LSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSK 75
            +  +I+ +L +    L+ V  ++ +   L  ++ +F   +    RL+  +DE+K+   ++
Sbjct: 1    MEDKISEYLHVPSKSLQGV--NYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTR 58

Query: 76   VDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFEL---QNTIEQK 132
            +  L +       E +  K+  +RL    + L  E++    +++ +  +L   +NTI + 
Sbjct: 59   ISKLNELLGESSEEKNVSKKELSRLH---NLLKNERSKCARKIDALNKQLNASKNTITKL 115

Query: 133  NVLKSNKQE--VVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLG 190
            N  +  K+E  V+K      +E + + +E   L ++NK LR++L+E +N +QT K N L 
Sbjct: 116  NDERGVKEEAEVLK------AEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLS 169

Query: 191  DKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQL 250
             K + + V Q+  ++ ++ +W+E++++ + E+ +       + +Q   +++ R +NDY+ 
Sbjct: 170  LKLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYES 229

Query: 251  EKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXXS 310
              ++ +FLL +N+++S  ++ K+ EIK L D +N EK +FS+EM+              S
Sbjct: 230  VSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTS 289

Query: 311  FKEELRLT-EEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMGD 369
            F++   L+  EK N    D  +++Q A  +D L   + QLE+S  E  RLQ +V + + +
Sbjct: 290  FEKNYSLSAREKDND---DPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCI-E 345

Query: 370  SEEFDLDSTANV--SIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINS 427
             +E   D+T NV  S+ K++ DI  LK+QLIKER+QK  LQ Q+ESF+ ELE K P + S
Sbjct: 346  EDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELIS 405

Query: 428  LKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQ 487
             KER+ +LE+EL +   LLE  S  K +  +EL S   KI   E N H+L++QR DLARQ
Sbjct: 406  FKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQ 465

Query: 488  VQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQE 547
            V+ LL N +       PL+ DE+  +KK++E+ +  NE DSQ IITERLVEF +   LQE
Sbjct: 466  VKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQE 525

Query: 548  RNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIE 607
            +N ELL   R LAD+LE  E   +  +  LE +TI EAK+AII L+  NS +ES++  + 
Sbjct: 526  KNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILS 585

Query: 608  KERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKNNELLNQE 667
            +ERD+YK + S          DA   K    N + IK LE +LS    E S   + LN+E
Sbjct: 586  RERDSYKLLASANGNKI--YADAAN-KTEAANLKKIKELESELSLTKVENSAVVQRLNKE 642

Query: 668  IRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQ 727
            +    +S++   I+ ++  + + LA ++  LLQ+              R  +L++ L KQ
Sbjct: 643  LLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQT--------------RIDDLKTKLEKQ 688

Query: 728  EARNGETVNKYISCQ--------SKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVE 779
             +    +++  I  +        +K   L    +NL  +            R++++   E
Sbjct: 689  RSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESLTRDLERCCKE 748

Query: 780  RNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDA 839
            +  L + +T+ +T  +E++      Q  +   I  LE    EL   + SK  EI+  + +
Sbjct: 749  KMQLQMKLTESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELNNRLHSKVQEIETLQTS 808

Query: 840  KRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTL 899
            K +Q KW Q  ID+   +   +  +L+ K  T+ +L LE+ DL  +IE   +++  YK L
Sbjct: 809  KNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDL--EIELQKTKL-QYKLL 865

Query: 900  NDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALK 959
            N++ +  T +  L+K+LE++ I+LK A+SQ E +++I ST E TLK L+++  +  E LK
Sbjct: 866  NNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELK 925

Query: 960  SNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLG 1019
              ++    E    E+ +S L++ +D +     LQ    E         L  ++ SE    
Sbjct: 926  VKSQSLDEENNAKEEEISFLRRELDEIR---GLQPKLKE-------GALRLVQQSEKLGN 975

Query: 1020 QVKKEYDQKLYQLQKDLEQQTAYANIAQK----NYEEELQKHAEVSKIISQLRSEVQSGR 1075
            Q      Q++  + + +++ T    + Q+     Y+ +L+ + ++S ++ +L +EV   +
Sbjct: 976  QT-----QRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQ 1030

Query: 1076 SEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLS 1135
            +E+++ K+S    +E+L+  E+ W  +K + +  +     Q +++  +N  L  +++   
Sbjct: 1031 TELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSALVEKID-DG 1089

Query: 1136 KSEREFENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKL 1195
              E   + + L   S L  SLR ER+ LETKLT  KR+  L  QK   LE  + + ++  
Sbjct: 1090 TGENNGDKEYLKLVS-LFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTH 1148

Query: 1196 FKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQS 1255
               +++    +DI  + EDIM+++ Q+N+L+E+N  L+ ++    EKN  +  E   LQ 
Sbjct: 1149 LVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQY 1208

Query: 1256 KILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEIS 1315
            +I  L  +L++ ++ +     ++++   E ++WK+R  ++ ++ ++   +E  KL  EIS
Sbjct: 1209 EISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEIS 1268

Query: 1316 NLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILK 1375
            +LK +L      N DLND+F RLKKQAHEKL+ASK  Q  L+ EV+EL+  K ++EE L 
Sbjct: 1269 DLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDMKNELEESLH 1328

Query: 1376 ETQTKVLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQ--- 1432
              ++KVL                               E+E KL + +  +EG++     
Sbjct: 1329 SEESKVL-------------------------------ELEAKLKKHLVQAEGVSKDQEE 1357

Query: 1433 -----LNEEINSLKEQVRIFKEKENDSTLEGSQGLSNVVESMXXXXXXXXXXXXXXXXXX 1487
                 L EEI  LK ++++FKE  +DS        S+ +E M                  
Sbjct: 1358 DTSKPLMEEIELLKRELQVFKET-SDS--------SDTIEKMKEIMEAEKNKIIEEKTTE 1408

Query: 1488 YNKKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRM 1547
            + +K EE   K     G+  E  +  ++  LKKQW ++YE  + +RI+EAEENLKKRIR+
Sbjct: 1409 FERKLEEATGK---NTGATIE--NGENMEELKKQWLKQYEEETMRRIKEAEENLKKRIRL 1463

Query: 1548 PTEERIKKVLDKRKTELEEEFQRRLKENNLQPE-GGDAKEREELKKQLESEFEAKYKEIL 1606
            P+EERI+K++ KRK ELE+EFQR+LK N+       D KE            E   ++ L
Sbjct: 1464 PSEERIQKIISKRKEELEQEFQRKLKANSGSFTLSSDKKEN-----------EVNAEDDL 1512

Query: 1607 ASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNNPTPEKAAATSVGLPTK------ 1660
             ++  K      ++ ++ + L+ +K   L+ QL +     P+K   ++   PT       
Sbjct: 1513 WNSPSKG---NSEKPSVVTNLIRQKNLILQEQLKN-----PKKGIISNDSRPTSSNKEND 1564

Query: 1661 IDESRT-ENMATGTPAFGEKVLKLSDKPAF-SFQPSSKSNPFTSALPGNNNVFGMKPTFS 1718
            I  S T EN A     FG K L  S+  +F SFQ     NPFT A    N   G+ P F+
Sbjct: 1565 IPGSTTAENKAPLAFNFG-KPLFPSNTSSFQSFQ-----NPFTPAATSFNT--GVSPVFN 1616

Query: 1719 FTPGSSQPESRPTFGSTGFN 1738
              P  +   +  TF + G N
Sbjct: 1617 IKPALAVDATVDTFKTPGLN 1636

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  560 bits (1444), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 523/1733 (30%), Positives = 922/1733 (53%), Gaps = 130/1733 (7%)

Query: 60   RLHATVDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQ-M 118
            RL+AT+D  K+  +S+ D++K + E L +E +   Q + +LE +  Q   E+  A  Q +
Sbjct: 42   RLNATIDNFKSKMSSQFDTVKNDLELLQKEKELLIQDKKQLESKCIQW--EQQYAQHQDI 99

Query: 119  ENVKFELQNTIEQKNVLKSNKQEV---VKLLEEKISELEAS----KVESQELVNDNKNLR 171
                    + I++    K + Q +   +  L +K+S  +A+         EL NDN ++R
Sbjct: 100  SKTDLASDDVIKENETFKRDHQLLTSDLMNLSKKLSSCDAALEKKSTAYLELQNDNIDIR 159

Query: 172  QQLMETQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQEND 231
             QL   ++E + LK        + E +K     +    E   KE++  + +    +  + 
Sbjct: 160  TQLNNFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSS 219

Query: 232  TELQKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFS 291
             EL+ +   +  L+  Y+L     +   ++N E++  + ++L++ K L ++LN  K+ F+
Sbjct: 220  NELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFT 279

Query: 292  REMSXXXXXXXXXXXXXXSFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEE 351
            REM+                K   + T    ++ E D        R + +L  +++ LE+
Sbjct: 280  REMTLTQHENDLLKEHIEYLKNTTKETTGGTSTLEKD--------RLLHELVDIKKSLEK 331

Query: 352  SNHERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQI 411
            S  E + L   + + + ++EE    ST++        ++ +LK+QLIKE+ QK+ LQ Q+
Sbjct: 332  SELENVHLNDFIEQYLTENEE----STSD-------NELVLLKEQLIKEKRQKDYLQEQV 380

Query: 412  ESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLE 471
            E FV+ELE ++P +NSLK+R+ TLE+EL  I  LLE T  E + + +EL +   ++K+  
Sbjct: 381  ELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQT 440

Query: 472  INTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSI 531
             N + L+ QR DLA QVQFLL N  L+   +  LT DE+ F++KII++ N  N+SDSQ I
Sbjct: 441  ENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKI 500

Query: 532  ITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIIT 591
            I+ERLV+F DI+ LQ++N ELL T R LA++LE  +        S+++ T +E+KE I  
Sbjct: 501  ISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSD------TKSVQKITRNESKEKIAK 554

Query: 592  LQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDS----QENQELIKSLE 647
            LQE  + + SK+  ++KE+DAYK +      S  N G+    ++     Q+ +E +  LE
Sbjct: 555  LQESINGLTSKLEKLQKEKDAYKLL------SLQNTGEQTPTEELRSQLQKKEEQLTKLE 608

Query: 648  DKLSTLTTETSKNN-ELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMT 706
             ++S+L +  ++   ++LNQ I  L + K  L  +  KE S R +AE + K+L+ +LE+ 
Sbjct: 609  -RMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELL 667

Query: 707  KNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXX 766
              +    +++    +++L+   A N +   +  + Q+K+S+L+     +++ K       
Sbjct: 668  HKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKE---IESYKQNLLQYS 724

Query: 767  XXXRREIQKISVERNSLNLMVTQLQTLQSERE---NLLKESQASHKAAIAQLEVQTSELK 823
                  + K++        + ++L T+++E E   NL++E +  +K   +  E    + K
Sbjct: 725  KDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHDSISERLLKKSK 784

Query: 824  TEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLK 883
             ++  K  E+K  E  K +Q  W+Q+++D +++   K++ EL  +   +    L+++DL+
Sbjct: 785  IQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKISDLE 844

Query: 884  KKIEESDSRIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEET 943
            K             TL+   NG ++  ++ +D EK   ELK    +  +++ + + AEET
Sbjct: 845  K-------------TLSQNTNGSSSLPRVDQDFEKLKNELKEKQLEINQYRDLLNLAEET 891

Query: 944  LKNLSNEFEERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNE 1003
               L  +  ++ + +    E     K QL+Q ++ L +    +N+    QK + E+++  
Sbjct: 892  KNRLQKDLNKQRQIVDDAMEG----KEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKI 947

Query: 1004 ILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKI 1063
            I  K    E+ ++SL  +    + K+  L+ ++ ++T      +  Y+E+L K +E S +
Sbjct: 948  IQDKATETENLKNSLSSL----ENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTL 1003

Query: 1064 ISQLRSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQ 1123
            I ++ +E ++ ++ +  LKA+    ++ +    +   ++K   +  +D+ K  +DN++ Q
Sbjct: 1004 IEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQ 1063

Query: 1124 NKLLFSQVELL----SKSEREFENKLLPGSS---ELLISLRRERDILETKLTVSKREEKL 1176
              +   +   +    S +  + +  ++  +S   EL+++LRRERD L+ KL +S+RE   
Sbjct: 1064 IHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILALRRERDGLDIKLDISQREVYS 1123

Query: 1177 LHQKQVALEDELAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAV 1236
            L ++   L++ L E R+    L+   S      +QH++ ++QLN++N L+E+N  L+  +
Sbjct: 1124 LREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKL 1183

Query: 1237 NAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDIL 1296
                ++N+ + ++L  L++++ PL  ++   + SI EKDQ++ LL +E +RWK RS +IL
Sbjct: 1184 RENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREIL 1243

Query: 1297 RRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANL 1356
             + +++D EE+ KL EE+S LK +L+ K+K+N DLNDRF RLKKQAHEKL+A+K   A+L
Sbjct: 1244 MKRQQVDLEEHNKLMEELSTLKTQLDTKTKDNEDLNDRFNRLKKQAHEKLDAAKAQNASL 1303

Query: 1357 SAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLRHELDDALERCKEIE 1416
            +AE+ +L   K+K+E  L E + ++  +E  L ++         L  EL D++E  K+IE
Sbjct: 1304 TAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVITALEKELSDSVENSKKIE 1363

Query: 1417 VKLGETVGSSEGLTSQLNEEINSLKEQVRIFKEKEN-----DSTLEGSQGLSNVVESMXX 1471
              L ETV SS  L  +L EE+NSLK Q+   K +       D +   S+ ++++ ES   
Sbjct: 1364 ENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQNGVISVADGSAINSETIAHLKESFEV 1423

Query: 1472 XXXXXXXXXXXXXXXXYNKKFEEEKAK-----LSSENGSPAEPVSAPDVNSLKKQWEEEY 1526
                              ++ ++   +       S+    +EP+   D+  +K +WEE+ 
Sbjct: 1424 EKTELITTLKEEFKKQLEEEKKKLLEEKEKEYYDSKPTGGSEPI---DIEKMKSEWEEKQ 1480

Query: 1527 EAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQPEGGDAKE 1586
            E I  QRI +AEENLKKRIR+P+EE+I +V++KR+ ELEEE++++LK   L  E      
Sbjct: 1481 EEIIMQRIADAEENLKKRIRLPSEEKINRVIEKRRKELEEEYEKKLKRQGLTTETAI--- 1537

Query: 1587 REELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNNP- 1645
             EEL+K++E E   K+   LA  KKKAF EGKQQ+ MK+TLLERK+SKLESQ + S  P 
Sbjct: 1538 EEELRKEVERELRVKFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPD 1597

Query: 1646 -------TPEKAAATSVGLPTKID-----ESRTENMATGTPAFGEKVLKLSDKPAFSFQP 1693
                     E A  T++G P+KI+      S T++        GEKVL+++ +   S +P
Sbjct: 1598 LESSQKENTEGATKTTLG-PSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRR---SLEP 1653

Query: 1694 S-SKSNPFTSALPGNNNVFGMKPTFSFTPGSSQ--------PESRPTFGSTGF 1737
            S   SNPFT  LP  N     KP F F   +          P ++  F +T F
Sbjct: 1654 SFGSSNPFT--LPTQN-----KPAFLFASNNHSQTKKQDGLPINKSPFQTTLF 1699

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  505 bits (1301), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 508/1769 (28%), Positives = 881/1769 (49%), Gaps = 175/1769 (9%)

Query: 16   LSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSK 75
            +  +I+ FL +  + L+ +   H     L  K+ EF   +    +L+  VDE+K+   ++
Sbjct: 1    MEDKISEFLHVPSESLRGI--KHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTR 58

Query: 76   VDSLKKETERLIRENDTEK----QRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQ 131
            +  L K    L+ E+  EK    +  NRL++Q   L +E++    +++ +  +L  +   
Sbjct: 59   ISKLTK----LLNESSEEKVINSKVMNRLQDQ---LKEERSRHTRKIDALNKQLNAS--- 108

Query: 132  KNVLKSNKQEVVKLLEEKISELEASKVESQELVND----------NKNLRQQLMETQNEV 181
                     E +K LE++    E +      L ND          NK L+++L+E +N +
Sbjct: 109  --------HETIKKLEDEEGAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENIL 160

Query: 182  QTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEV 241
            Q  K N +  + + +   Q+  +  ++ +W E+ ++S  ++ +       + LQ   +++
Sbjct: 161  QVCKSNAVSLQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKL 220

Query: 242  ARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXX 301
             + + + +   +  +FLL +N+++S  ++ KL EIK L D  NTEK EFS+EM+      
Sbjct: 221  NQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMN 280

Query: 302  XXXXXXXXSFKEELRL-TEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQ 360
                    SF+    L  +EK +     N +    A   ++L   + +LE+S  E   L+
Sbjct: 281  DLLRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVA---EELIDAKLKLEKSKEECQLLK 337

Query: 361  AVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEY 420
             +V++ + ++      +TA  ++ KL+ +I  LK+QL+KER QK  +Q Q++ FV+ELE+
Sbjct: 338  NIVSDCIEENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEH 397

Query: 421  KVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQ 480
            K P + S KER+  LE EL     LLE  S  K +  ++L S   KI   E N H+L+RQ
Sbjct: 398  KTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQ 457

Query: 481  RSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFK 540
            R DLARQV+ LL N +    +  PL+ DE+  ++K++E+EN  NE DSQ IITE+LVEFK
Sbjct: 458  RLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFK 517

Query: 541  DIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIE 600
            +I  LQE+N ELL   R LAD+LE  E  ++  +  +E +TI EAKEAII ++  NS++ 
Sbjct: 518  NIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLA 577

Query: 601  SKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQE-LIKSLEDKLSTLTTETSK 659
             +V+ + +ERD+YK + S      DN   AD    ++   E  I+ L+ KLS+   E+S 
Sbjct: 578  LRVNILTRERDSYKLLASAN----DNKTHADTEGITEATYEKKIRELQSKLSSTRVESSA 633

Query: 660  NNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHE 719
              + LN ++    +S+T   I+ ++  + + L  ++  +LQ               R + 
Sbjct: 634  IIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQ--------------ERINH 679

Query: 720  LQSILSKQEARNGETVNKY--------ISCQSKLSVLEARAANLDAEKXXXXXXXXXXRR 771
            L++ L KQ       V  Y           ++K+  L+   +NL  E            R
Sbjct: 680  LKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTR 739

Query: 772  EIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDN 831
            ++++   E+  L++ +++ +T  +E+  +    +  +   I  LE    EL   + SK+ 
Sbjct: 740  DLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQ 799

Query: 832  EIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDS 891
            EIK  + +K +Q KW Q  ID+   +   +  EL+ K  T+ +L LE+ +L  ++  +  
Sbjct: 800  EIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTK- 858

Query: 892  RIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEF 951
                YK L++  +  T +  LRK+L++T IELK A+SQ + +++I ST E  LK L+ E 
Sbjct: 859  --LQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGEL 916

Query: 952  EERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSL 1011
            ++  E  ++  +    EK   E+ +S+L+K +D +     LQ    E     +L+     
Sbjct: 917  KKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIR---CLQPKLREGASYLVLQ----- 968

Query: 1012 ESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQK----NYEEELQKHAEVSKIISQL 1067
              SE    Q      Q++ +++  +++  A     QK     Y+ EL+ + ++S+ + +L
Sbjct: 969  --SEKVGDQA-----QRIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMRL 1021

Query: 1068 RSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLL 1127
              E    ++E+++ K S    +E+L+  EK W  +K + +  +     Q +++  +N +L
Sbjct: 1022 EKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVL 1081

Query: 1128 FSQVELLSKSEREFENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDE 1187
              +++  ++     E  L   S  L  +LR ER  LETKLT  KR+  LL QK  +LE  
Sbjct: 1082 IEKIDGATEGSNSNEKYLELVS--LFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKS 1139

Query: 1188 LAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQ 1247
            + + ++     +      + I  ++E I++++ Q+N+LRE+N  L  ++    EKN  + 
Sbjct: 1140 IGDLQRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIY 1199

Query: 1248 SELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEY 1307
             EL ++Q +I  L   L + ++ +     +++    E ++ K+R  D+ ++ +     E 
Sbjct: 1200 KELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNET 1259

Query: 1308 RKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTK 1367
             KL   I +L+ +L      N DL ++F RLKKQAHEKL+ASK  Q  L+ E+NEL+ TK
Sbjct: 1260 EKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETK 1319

Query: 1368 TKMEEILKETQTKVLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSE 1427
             K+EE L   ++KV++LE                         + KE  +++GE     +
Sbjct: 1320 DKLEENLHNEESKVVDLEL------------------------KLKEHGLQVGEVSKDHD 1355

Query: 1428 GLTSQ-LNEEINSLKEQVRIFKEKENDSTLEGSQGLSNVVESMXXXXXXXXXXXXXXXXX 1486
             +  +   EEI SLK+++++F+   ND+        S+  E +                 
Sbjct: 1356 SIAFKPFVEEIESLKKELQVFRNA-NDA--------SDAFEKIKNNMEEEKNKIIDEKTK 1406

Query: 1487 XYNKKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIR 1546
             + KK ++   K S  N S  E  ++  + +LKK+W +EYE  + +RI+EAEENLKKRIR
Sbjct: 1407 DFEKKLQDAVNK-SKSNESEVE--NSEHIEALKKEWLKEYEEETVKRIKEAEENLKKRIR 1463

Query: 1547 MPTEERIKKVLDKRKTELEEEFQRRLKENN--LQPEGGDAKEREELKKQLESEFEAKYKE 1604
            +P+EERI+K++ KRK ELE+EF+R+LKENN  L   G + +E E+              E
Sbjct: 1464 LPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSGSNEEEAED--------------E 1509

Query: 1605 ILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNNPTP-----EKAAATSVGLPT 1659
            +  S  K + E    + ++ + L+++K  KL+ QL +  N         K+      +P 
Sbjct: 1510 LWNSPSKGSSE----KPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSENKENNIP- 1564

Query: 1660 KIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPS---SKSNPFTSALPGNNNVFGMKPT 1716
              D +  +N      +FG        KP FS   S   S  NPFT +   N +  G  PT
Sbjct: 1565 --DSAAADNRVPSAFSFG--------KPLFSSNTSSFQSFHNPFTPS-AANFSTDGSLPT 1613

Query: 1717 FSF-------TPGSSQPESRPTFGSTGFN 1738
            F+        T G++   S P   + G N
Sbjct: 1614 FNIKSAFAAGTAGNTLKTSDP--ANVGIN 1640

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  501 bits (1289), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 488/1729 (28%), Positives = 892/1729 (51%), Gaps = 135/1729 (7%)

Query: 16   LSQRIAGFLGISDDELK----PVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKAL 71
            +  +I+ FL +  + L+    PVL        L  K+ +F   +    +L+  VDE+K+ 
Sbjct: 1    MEDKISEFLNVPFESLQGVTYPVLRK------LYKKIAKFERSEEEVTKLNVLVDEIKSQ 54

Query: 72   CTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQ 131
              S++  LK+  +    + +T K+  N L++Q   L +E++    +++ +K +L   +  
Sbjct: 55   YYSRISKLKQLLDESSEQKNTAKEELNGLKDQ---LNEERSRYRREIDALKKQLH--VSH 109

Query: 132  KNVLKSNKQEVVKLLEEKISELEASKVESQELVND-----NKNLRQQLMETQNEVQTLKC 186
            + + + N ++ VK  EE   ++  S+ +  + +ND     NK LR++LME +N +Q  K 
Sbjct: 110  EAMREVNDEKRVK--EE--YDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKS 165

Query: 187  NGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKN 246
            N +  + + +   Q+  ++ +S + +E++++S +++ +       + ++   +++ ++++
Sbjct: 166  NAISLQLKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQS 225

Query: 247  DYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXX 306
            +Y+   +  +FLL +N+++SQ ++ K+ E+K L D  + EK EFS+EM+           
Sbjct: 226  NYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRS 285

Query: 307  XXXSFKEELRLTE-EKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNE 365
               S +++  L   EK++     N + T     +D+L   + +LE+S +E  RLQ +V +
Sbjct: 286  QLTSLEKDCSLRAIEKNDDNSCRNPEHTD---VIDELIDTKLRLEKSKNECQRLQNIVMD 342

Query: 366  VMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVI 425
               + E     S  + ++ KL+ DI VLK+QLIKER+QK  LQ Q+E F++ELE+K P +
Sbjct: 343  CTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPEL 402

Query: 426  NSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLA 485
             S KER+ +LE EL     LLE  S  K ++ RE+ S   KI   E N H+L++QR DLA
Sbjct: 403  ISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLA 462

Query: 486  RQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATL 545
            RQV+ LL N +   ++  PL+ DE+  ++KI+E+ N  NE+DSQ+IITERLVEF ++  L
Sbjct: 463  RQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNEL 522

Query: 546  QERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVST 605
            QE+N ELL   R LAD+LE  E   +  +  +E +TI EAK+AII L+  N+++E++++ 
Sbjct: 523  QEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINI 582

Query: 606  IEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKNNELLN 665
            + +ERD+YK +L+ T ++  N      M+ ++E +  I+ LE +LS+   E S   + L 
Sbjct: 583  LLRERDSYK-LLASTEENKANTNSVTSMEAAREKK--IRELEAELSSTKVENSAIIQNLR 639

Query: 666  QEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILS 725
            +E+    +S+ +   + E   + + LA+++ ++L+  ++  K   AEL ++   + S + 
Sbjct: 640  KELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLK---AELEKQKSWVPSYIH 696

Query: 726  KQEARNGETVNKYISCQSKLSV--LEARAANLDAEKXXXXXXXXXXRREIQKISVERNSL 783
             ++ R    ++     QS++ +  LE   + L  E            R+ ++   E+  L
Sbjct: 697  VEKERASTELS-----QSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKEL 751

Query: 784  NLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQ 843
             + + + +   +E +      +  +KA I +LE     L++++ SK  EI++    K +Q
Sbjct: 752  QMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQ 811

Query: 844  TKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAG 903
             KW Q  ID+       +  EL+ K  T+ +L  E+ +L K++ ++  +   YK L+   
Sbjct: 812  LKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQNS 868

Query: 904  NGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAE 963
            +  T +  LRK+LE+  ++LK A SQ + +++I S+ E  L  L NE  +  E   +  E
Sbjct: 869  DASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIE 928

Query: 964  KYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKK 1023
                EK   E+ +S L+  +  +    ALQ    E         L  ++ SE    +V  
Sbjct: 929  LEKKEKWAREEDLSRLRGELGEIR---ALQPKLKE-------GALHFVQQSEKLRNEV-- 976

Query: 1024 EYDQKLYQLQKDLEQQTAYANIAQKN----YEEELQKHAEVSKIISQLRSEVQSGRSEIQ 1079
               +++ ++ + +E+ +    + +K     Y+  ++++ ++S+++ +L  +    ++E+ 
Sbjct: 977  ---ERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELT 1033

Query: 1080 QLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSER 1139
            + K+S   A+++L+  E+ W  +K + +  +     Q +++  +N +L  +V+  + +  
Sbjct: 1034 KTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVDDTAANNG 1093

Query: 1140 EFENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQ 1199
            + ++  L     L  +LR ER+ LETKLT  KRE   + QK  +LE  + + ++     +
Sbjct: 1094 DKDHLKLVS---LFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSE 1150

Query: 1200 ENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILP 1259
            +     + I  + +DI +++ Q+N+L+E+N  L+ ++    EKN ++  +LN  Q +I  
Sbjct: 1151 KEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISR 1210

Query: 1260 LNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKK 1319
            L  +L + ++ +     +I++   E ++ K+R  D+ ++ +    ++  KL  EIS+LK 
Sbjct: 1211 LQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKG 1270

Query: 1320 ELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQT 1379
            +L +    N DL ++F RLKKQAHEKL+ASK  QA L+ E+NEL+  K K+E+ L     
Sbjct: 1271 KLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENA 1330

Query: 1380 KVLNLEKLLTERDSESANNEDLR--HELDDALERCKEIEVKLGETVGSSEGLTSQLNEEI 1437
            KV++L+  L   + +S   ED+   HE D                          L EEI
Sbjct: 1331 KVIDLDTKLKAHELQS---EDVSRDHEKDTY----------------------RTLMEEI 1365

Query: 1438 NSLKEQVRIFKEKENDSTLEGSQGLSNVVESMXXXXXXXXXXXXXXXXXXYNKKFEEEKA 1497
             SLK++++IFK          +   S+  E +                  + KK +E   
Sbjct: 1366 ESLKKELQIFK---------TANSSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQE--- 1413

Query: 1498 KLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVL 1557
             L+    S AE   + D+ +LKK+W +EYE  + +RI+EAEENLKKRIR+P+EERI+K++
Sbjct: 1414 TLNKSTSSEAE--YSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKII 1471

Query: 1558 DKRKTELEEEFQRRLKENN-----LQPEGGDAKEREELKKQLESEFEAKYKEILASTKKK 1612
             KRK ELEEEF+++LKEN      L  +G      EEL          +   +     +K
Sbjct: 1472 SKRKEELEEEFRKKLKENAGSLTFLDNKGSGEDAEEELWNSPSKGNSERPSAVAGFINQK 1531

Query: 1613 AFEEGKQQAAMKSTLLERKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATG 1672
                 K Q  +K+   +   +  +S + +  N   + +AA +  +PT          + G
Sbjct: 1532 NL---KPQEQLKNVKNDVSFNDSQSMVTNKENNIVDSSAAGNKAIPT---------FSFG 1579

Query: 1673 TPAFGEKVLKLSDKPAFSFQPSSKSNPFTSALPGNNNVFGMKPTFSFTP 1721
             P F      L      SFQ     NPFT++   N N      T +  P
Sbjct: 1580 KPFFSSNTSSLQ-----SFQ-----NPFTAS-QSNINTNAPLRTLNIQP 1617

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  497 bits (1279), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 484/1699 (28%), Positives = 872/1699 (51%), Gaps = 171/1699 (10%)

Query: 97   RNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEAS 156
            R++LE  V  L KEK             L++TIE+      NK   +K LE++I+ L  +
Sbjct: 28   RSKLESSVDNLIKEK-----------LNLKSTIEETESTYKNK---IKNLEDEINILAKT 73

Query: 157  K----------VESQELVNDNK--NLRQQLMETQNEVQTLKCNGLGDKSELEIVKQQVGM 204
            +          VE+Q   N     N+  +++  Q E++  K   L  +SE E   +Q  +
Sbjct: 74   RDISGPIRITGVEAQAPNNATSISNINDEILTLQRELERAKSEHLISQSEAERSLKQSEL 133

Query: 205  LTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLLKKNQE 264
            + + N+WLE+ +   TE+L+  +Q +  ++++  QE+  L+++  + K + + LL KNQE
Sbjct: 134  VREHNQWLEEHLVKTTEELMTQKQ-SILKMEEKDQEIDNLRHEVSILKKNNDLLLGKNQE 192

Query: 265  ISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXXSFKEELRLTEEKHNS 324
            +S+++Q KL EIK+ SD+ +T++QEF  E+               S + +L+  +++ + 
Sbjct: 193  LSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINS-------SLETQLKEIQQEKSI 245

Query: 325  TEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMGD-SEEFDLDSTANVSI 383
               DN    +  + M+ L   R+QL++S +E  RL++ VNE + D + E+   S+     
Sbjct: 246  QNEDNTSRAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFINDVNGEYSSSSSLLKKE 305

Query: 384  PKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDIA 443
                           K + QK+ L+ Q+E+F+ ELE KVPVI+SL++++  LEKELSD+ 
Sbjct: 306  LL-------------KVKEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVT 352

Query: 444  LLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRG 503
             L++  S E+E   +E +S   K +  +    TL  QRSDLA Q+QFLL     Q  +  
Sbjct: 353  SLVDRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNA 412

Query: 504  PLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNTELLKTARTLADRL 563
             L+ DE  FI+++ EN+  +  +DSQSII+ERL++F DI  LQ++N ++L T R LA +L
Sbjct: 413  LLSKDETDFIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQL 472

Query: 564  EEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQS 623
            EE+EK       ++ERKT++EAK+A++ LQE  + +E K+ T  KERD YK +    S S
Sbjct: 473  EEQEKLRQADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSPS 532

Query: 624  FDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHE 683
             +   + + + D     +L   L+     LT E  K    L +  +++   K +L  S +
Sbjct: 533  SNKPSECNDI-DKHTTGKLQNELQQTREYLTKEIEK----LTRTNKDILNKKKELEYSMK 587

Query: 684  KERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQS 743
            K  S++  AE + +L+++ L M +     ++ ++  LQ +LS++EA+  E         S
Sbjct: 588  KMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTS 647

Query: 744  KLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVERNSLNLMVTQLQTLQSERENLLKE 803
            + ++L+ R  +  ++           ++E+ ++  E+N+L + + +L+  ++E + +   
Sbjct: 648  QYNLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQAT 707

Query: 804  SQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRD 863
             +      + + ++   +L   I  ++++I+  E  +  +  W+Q+              
Sbjct: 708  VELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNF------------ 755

Query: 864  ELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNGET------TQGQLRKDLE 917
                 T T  ++ L V D+KK  E    R ++  TL    +G        T   +RK   
Sbjct: 756  ----PTQTETEIGLPV-DMKK--EGETGRQSNRDTLESQKSGSPGFTDLGTDSSVRKSTS 808

Query: 918  KTMIELKHAYSQNEEFKQISSTAEET-LKNLSNEFEERTEALKSNAEKYLAEKVQLEQCV 976
              ++++     +++E K+  +  + + +  L     ++ + L +  E+  ++K +L+  +
Sbjct: 809  LPVMQVGRTEEESKEAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSL 868

Query: 977  SNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDL 1036
              ++     L+++  L+KN  + EK  +  +L  +  + +SL +V K+       L+ DL
Sbjct: 869  QAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMEN-NSLTEVAKK------SLEDDL 921

Query: 1037 EQQTAYANIAQKNYEEELQKHAEVSKIISQ-------LRSEVQSGRSEIQQLKASEQQAK 1089
                      +   EEE QKH E +  +S+       +  E+   R E+   K++E Q  
Sbjct: 922  HD-------VEMKLEEERQKHEETNATLSEKELLCEKMIEEISGYREELS--KSAEMQVD 972

Query: 1090 EVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPGS 1149
                           EL+  +D   +++D++ +QN LL  Q+      E + +NK     
Sbjct: 973  ----------IQHTRELEDLLDLANKRIDDLCTQNNLLHEQLNATLDLE-DTQNK--DDI 1019

Query: 1150 SELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIA 1209
             ++++ ++RERD L+ KL + +RE ++L ++   L+ EL    K     Q ++   S++ 
Sbjct: 1020 KDIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAVSK---GQQWHNLPLSNLL 1076

Query: 1210 KQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQ 1269
              HE I+++L +++LLRE+NV+L   VN  +  N  L  EL+ ++    PL  + +   +
Sbjct: 1077 TGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTER 1136

Query: 1270 SIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENT 1329
              +EKDQ I L  DE +RWK+R   ++ R +     E    + EI +LK  +E ++KE  
Sbjct: 1137 YFKEKDQEISLYKDEIERWKKRWQQMVHRQDDTLGLEAN-FKNEIDSLKGLIEERTKEKE 1195

Query: 1330 DLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLT 1389
             L+++F  LKKQAHEKL+A+KI    L+ +++E++ +  ++EE++KE   K+  +E  L 
Sbjct: 1196 KLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLK 1255

Query: 1390 ERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQVRIFKE 1449
            E   +   +E L  E     +  KE E KL +T+   + L   LN+E+ SL+E++ + ++
Sbjct: 1256 ENLEKFDKDEKLVSE-----KTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRK 1310

Query: 1450 KENDSTLEGSQGLSNVVESMXXXXXXXXXXXXXXXXXXYNKKFEEEKAK-LSSENGSPAE 1508
            K++++        + ++ +M                   N+KFE  + + LS ++ +   
Sbjct: 1311 KDDET--------NQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTN 1362

Query: 1509 PVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEF 1568
              +  +V+ LK++  +++E  + QRI+EA+ENLK+ IR+P+EE+I+++++KR+ ELE +F
Sbjct: 1363 DNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDF 1422

Query: 1569 QRRLKEN----------NLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGK 1618
             +R++E           ++ P+    K R EL+  +E + +AK    L + + KAFEEGK
Sbjct: 1423 DKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDLQAK----LETIRTKAFEEGK 1478

Query: 1619 QQAAMKSTLLERKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGE 1678
            +QA MK+TLLERK+SKLESQ+ + +N +  K   +  GL TKID +  +     T    E
Sbjct: 1479 RQAEMKTTLLERKLSKLESQV-AKDNESGSKVRKSISGL-TKIDVNSPQLYKDNTGTRTE 1536

Query: 1679 KVLKLSDKPAFSFQP----SSKSNPFTSAL--------PGNNNVFGMKPTFSFTPGSS-- 1724
             VLKL  +P          S+ SNPFTS          P    +  M PTFSFTPG S  
Sbjct: 1537 AVLKL--RPTAKVDSGKDVSNDSNPFTSPTQELSKSNSPAALPIVHMAPTFSFTPGKSTG 1594

Query: 1725 ------QPESRPTFGSTGF 1737
                     ++ TFG+  F
Sbjct: 1595 TVNKELNKTAQATFGAPTF 1613

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  494 bits (1273), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 494/1728 (28%), Positives = 882/1728 (51%), Gaps = 134/1728 (7%)

Query: 16   LSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSK 75
            +  +I+ FL +  + L+ +  ++ +   L  K+  F   +    RL+  VDE+K+   S+
Sbjct: 1    MEDKISEFLHVPFESLQGI--NYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSR 58

Query: 76   VDSLKKETERLIRENDTEKQRRNR-LEEQVSQLTKEKTLALGQMENVKFEL---QNTIEQ 131
            +  L K    L+ E+  +K   ++ L     QL +++     +++ +  +L   ++ I++
Sbjct: 59   ISKLSK----LLNESSEQKNIASKELSHLQDQLMQDRERCRRKIDALNKQLDSSRDAIKR 114

Query: 132  KNVLKSNKQEVVKLLEEKISELEASKVESQELVND--NKNLRQQLMETQNEVQTLKCNGL 189
             N  K  K+E +      I + +   V S + V D  NK LR++LME +N +Q  K N +
Sbjct: 115  LNDEKDAKEESM------IRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSV 168

Query: 190  GDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQ 249
              + + + + Q+  ++ ++ +W E++++S   + +       + ++   +++ + + D +
Sbjct: 169  SLQLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRE 228

Query: 250  LEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXX 309
               S  + LL +N+++S  ++ K+ EIK L D    EK EFS+EM+              
Sbjct: 229  SALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLA 288

Query: 310  SFKEELRLTEEKHNSTEA----DNL-QSTQQARFMDDLAQVRQQLEESNHERLRLQAVVN 364
            SF       E  H+S E     DNL +        D+L   + Q ++S  E  RLQ +++
Sbjct: 289  SF-------ERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIIS 341

Query: 365  E-VMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVP 423
            + V  D    D +  A+ ++ KL+ DI VL+KQLIKER QK  LQ Q+E F++ELE+K P
Sbjct: 342  DFVQEDKATVDTNG-ASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTP 400

Query: 424  VINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSD 483
             + S KER+ +LE EL     LLE  S  K +  REL S   KI   E N H L++QR D
Sbjct: 401  ELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLD 460

Query: 484  LARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIA 543
            LARQV+ LL N +    +  PL+ D++  ++KI+E+ +  NE+D+Q+II+ERLVEF +I 
Sbjct: 461  LARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNIN 520

Query: 544  TLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKV 603
             LQE+N ELL   RTLAD+LE  E   +  +  +E++TI EAK+AII L+  N ++ES++
Sbjct: 521  ELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRI 580

Query: 604  STIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKNNEL 663
            + + +ERD+YK +L+ + ++  N+   +  + S E +  IK LE +LS+   E+S   + 
Sbjct: 581  NILLRERDSYK-LLASSKENNVNVNAKNFTEISHEKK--IKELEAELSSTKVESSAVIQN 637

Query: 664  LNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSI 723
            L +E+    +      I+ +   + + LA+++  +L++ +    N   +L ++   + S 
Sbjct: 638  LRKELTTYKKLLCDKKIASQDFENFKMLAKEKESILETRV---NNLKTDLEKQKLSVPSF 694

Query: 724  LSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVERNSL 783
            +   + R+     + +  ++K  +L    ++L  E            R++++   E+  L
Sbjct: 695  VQDNKVRDS---TELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEKIQL 751

Query: 784  NLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQ 843
             + + + +   +E++         + A I QLE     L+ E+ SK  EIK+ + +K +Q
Sbjct: 752  QMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLERLRIELKSKAQEIKSLQSSKDSQ 811

Query: 844  TKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAG 903
             KW Q  ID+       +  EL+ K  TV  L  ++ +L  ++ E+  +   Y+ LN+  
Sbjct: 812  LKWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLK---YEFLNNTS 868

Query: 904  NGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAE 963
            +  T Q  LRK+LE+T +ELK A+SQ   +++I ST E+ LK L+++     E   +  E
Sbjct: 869  DASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDYDARIE 928

Query: 964  KYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKK 1023
                EK+  E+ +S L++ +D +    +LQ  + +E    ++K+   L +    + ++K 
Sbjct: 929  LECKEKLANEEELSLLRRELDEIR---SLQP-KLKEGTVCLVKQSEKLRNQAEKIQEMKA 984

Query: 1024 EYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKA 1083
            + D+  + +Q        Y       ++  ++ + E+S+++++L  E    + E+++LK+
Sbjct: 985  KIDKMNWNVQ-------VYKKEKTSQFQSIMKANKELSELVTRLEKEATDSQMELKKLKS 1037

Query: 1084 SEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFEN 1143
            S  + +++L+  EK W  +K + +  +     Q +++  +N +L  ++  +++     E+
Sbjct: 1038 SLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEGSDGNED 1097

Query: 1144 KLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDS 1203
             L   S     +LR ER+ LETKLT  KR+  L+ QK  +LE  + + +      Q    
Sbjct: 1098 YLKLVS--FFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTELQ 1155

Query: 1204 NHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSE 1263
              + I  +  DI +++ Q+NLL+E+N  L+ ++    EKN ++  EL   Q ++  L S+
Sbjct: 1156 CSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQLKSD 1215

Query: 1264 LSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEA 1323
            L + ++ +     +I++   E D+ K+R HD+  +  ++  +   KL  EIS+ K +L  
Sbjct: 1216 LIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLD 1275

Query: 1324 KSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLN 1383
                 T+L ++F RLKKQAHEKL+ASK  Q  L+ E+ EL+  + K+E+ L     K ++
Sbjct: 1276 AENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTVD 1335

Query: 1384 LEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTS-QLNEEINSLKE 1442
            L       D+E                  KE  V+ G+ +   E + S  L EEI SLK 
Sbjct: 1336 L-------DTEP-----------------KEHTVQSGDLLRDQEKVASLPLIEEIESLKR 1371

Query: 1443 QVRIFKEKENDSTLEGSQGLSNVVESMXXXXXXXXXXXXXXXXXXYNKKFEEEKAKLSSE 1502
            ++++FK   N          S+  E +                  + KK EE  +K S  
Sbjct: 1372 ELQVFKNANNS---------SDAFEKLRDNMEEEKNKIINERTKEFEKKLEEIVSK-SKS 1421

Query: 1503 NGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKT 1562
             G  A+  ++ ++ +LKK+W +EYE  + +RI+EAEENLKKRIR+P+EERI+K++ KRK 
Sbjct: 1422 TGKVAD--NSENIETLKKEWLKEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKE 1479

Query: 1563 ELEEEFQRRLKEN-NLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQA 1621
            ELEEEFQR+LKEN +      D KE  +              E L ++  K      ++ 
Sbjct: 1480 ELEEEFQRKLKENASSLTFSCDRKETND-----------DPDEDLWNSPSKG---NSERP 1525

Query: 1622 AMKSTLLERKISKLESQLNSSNNPTPEKAAATSV-----GLPTKIDESRTENMATGTPAF 1676
            ++ +  +++K  K++ QL  + N      + +S          K+++ +    A  T +F
Sbjct: 1526 SVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSMNKENSALVKVNDDK----AASTFSF 1581

Query: 1677 GEKVLKLSDKPAF-----SFQPSSKSNPFTSALPGNNNVFGMKPTFSF 1719
            G        KP F     SFQ  S  NPFT +   +N    + PTF+ 
Sbjct: 1582 G--------KPLFPSTTTSFQ--SFQNPFTQSTIDSNTGVSL-PTFNI 1618

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  430 bits (1105), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 462/1663 (27%), Positives = 827/1663 (49%), Gaps = 181/1663 (10%)

Query: 116  GQMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLM 175
            G+ME +       +E+  +LKS+  ++ +++ E+  E+   + E   +      LR +L 
Sbjct: 48   GRMELI-------VEENRLLKSSNLDMSRIVTERAEEIGRLRDEVSTVTGQTSALRAELE 100

Query: 176  ETQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQEN-DTEL 234
              QN+++ LK   L  +SE +     +  L   N  L  E+  + ++L   RQ + + +L
Sbjct: 101  NLQNDLELLKDKDLALQSERDSTVALLDGLKLENSALRAEI-EQAKELASIRQHDYEADL 159

Query: 235  QKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREM 294
                  +   + + +L KS R  L+ + + +SQ+L  +  +I++L D     + E++ E+
Sbjct: 160  DSKTGALVSKEEELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEI 219

Query: 295  SXXXXXXXXXXXXXXSFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNH 354
            +                K   RL +E+  S E       ++A+ +    +   ++     
Sbjct: 220  NLQ--------------KHRARLLQEQVASLE-------KEAKLVGHETEPEYEIPPPGE 258

Query: 355  ERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESF 414
            E + LQ   + +  DS     D T++ S+ +L  +I +L  +L +E   K+ L++Q+  F
Sbjct: 259  E-VALQQRSHSISMDSLLTGNDETSH-SMSELNNNISILSNRLKRETLSKQKLEKQVHKF 316

Query: 415  VVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINT 474
            V ELE   P+I S K++S   + ++  + L LEH + +KE   +E+E    +++Q+    
Sbjct: 317  VTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQD 376

Query: 475  HTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENP----SNESDSQS 530
              L R+R DLARQ+Q+LL NG ++ DS  PLT+ E ++IK+I+ N +P    ++ +DSQ 
Sbjct: 377  KILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKEIL-NTDPEEGNTSSTDSQL 434

Query: 531  IITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAII 590
            II++R+++FK I  LQ++N  LL   RTL+DR E  E+      DS+E   I+EAK+ ++
Sbjct: 435  IISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLE-SGDSIE--AINEAKQTLL 491

Query: 591  TLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKL 650
             LQ+ NS +E+KV ++  +  A        ++ F ++GD +       +   I++L++K 
Sbjct: 492  DLQQYNSSLEAKVESLTNKLKA--------NEHFTSIGDGEFGNSDLSDGNNIQALKNKY 543

Query: 651  STLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNEN 710
             +L  E+S+    L  +I NL QSK+ L    E   +S+ L EDRLK+ Q  L+++KNEN
Sbjct: 544  DSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNEN 603

Query: 711  AELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXR 770
            + L  R       L ++E    +T+ KY+ C +KL V++ +  N   EK           
Sbjct: 604  STLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIE 663

Query: 771  REIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKD 830
             ++ +   ERN+   ++ QL+ LQ  ++  LK+ Q S +  I  LE++ +EL+ +I +K+
Sbjct: 664  NKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKE 723

Query: 831  NEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESD 890
                ++    +A+ +W+Q K D +S     + +++    +T+  L ++   L   ++E++
Sbjct: 724  TSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEAN 783

Query: 891  SR---IASYKTLNDA----GNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEET 943
            S+   + + +T++D     G  ET     R  L  T  EL           +ISS    T
Sbjct: 784  SKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSREL-----------EISSN---T 829

Query: 944  LKNLSNEFEERTEALKSNAEKYLAEK-VQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKN 1002
            ++   +E             K L E+  +LE    +L+  I  L +E        E EK 
Sbjct: 830  IRQYQSEI------------KVLNERQSELENENKHLRDEIAILRDELTHNGGEFEREKE 877

Query: 1003 EILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEV-S 1061
             ++KKL +LE  +  L +++++Y  ++ +L+ DL++Q       +  ++EE++   EV +
Sbjct: 878  ALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVR---EVQN 934

Query: 1062 KIISQLRSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNIS 1121
            +     R+E++    EI+Q K   ++ KE LE+  K   N++ ELD      K ++   S
Sbjct: 935  RNTETYRNELE--LVEIRQTKVFVEKEKE-LESRIK-ILNEQIELD------KERMKQFS 984

Query: 1122 SQNKLLFSQVELLS--KSEREFENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQ 1179
             +  LL  QV+LL+  K+    +  + P  ++L+  L  E+  LE+KL  S+ E+  L +
Sbjct: 985  DEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNRLRE 1044

Query: 1180 KQVALEDELA-------EARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTL 1232
            +    E E+A       +A+K++     N+S  ++         E + Q+  L+ESN++L
Sbjct: 1045 QLTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAE---------EHIAQLESLKESNMSL 1095

Query: 1233 RNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERS 1292
             N V  AQ +N ++ +ELN L++K   + S+L E R  +  KD +++ L  E  R K  S
Sbjct: 1096 TNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATS 1155

Query: 1293 HDILRRHEKIDPEE-YRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKI 1351
            HD+ +   K    E    L+  ++ L ++++     NT+L DRF RLK+QA E+L+ASK+
Sbjct: 1156 HDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKV 1215

Query: 1352 AQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLRHELDDALER 1411
               +L   V  L   KT ++++++ ++ ++  L   + E    SA  ++L+ EL   + +
Sbjct: 1216 TINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSK 1275

Query: 1412 CKEIEVKLGETVGSSEGLTSQLNEEINSLKEQVRIFKEKENDSTLEGSQGLSNVVESMXX 1471
             K+IE +L ET  SS  LT+ LNEEI SLK +V+  KE  + +  +G++ +S VVESM  
Sbjct: 1276 NKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEA-SSAEPQGNEEMSGVVESMRK 1334

Query: 1472 XXXXXXXXXXXXXXXXYNKKFEEEKAK---------------------LSSENGSPAEPV 1510
                               +  EE+ K                     L  EN +  +  
Sbjct: 1335 AFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENTALMKAR 1394

Query: 1511 S-APDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQ 1569
            S  PD+ +L+KQWE                  K+R+ +  +E+  +++  +  ELEE+FQ
Sbjct: 1395 SDVPDIETLQKQWEASN---------------KERLVLLYKEKSDQMMRAKMDELEEQFQ 1439

Query: 1570 RRLKENNLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLE 1629
             R++           KE   LK ++E + +  +++ L + KK+AFEEGKQQA MK ++LE
Sbjct: 1440 NRVR--------NKEKELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILE 1491

Query: 1630 RKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAF 1689
            RKI+KLE++  ++ + +     + S   P  +  +  +      P         +    F
Sbjct: 1492 RKIAKLEAESKATKSGSD---MSVSEDAPRFVTPNNNKVQQANQPFLA------TAGSGF 1542

Query: 1690 SFQPSSKSNPFTSALPGNNNVFGMKPTFSFTPGSSQPESRPTF 1732
            S Q SS+SNPFT+ +             + T  SSQ +  PTF
Sbjct: 1543 SVQ-SSESNPFTTPVSRG---------AAHTNASSQSKFAPTF 1575

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  336 bits (861), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 428/1565 (27%), Positives = 750/1565 (47%), Gaps = 235/1565 (15%)

Query: 234  LQKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSRE 293
            L +SL E+  L++       S   LL   + I+++L +K    K LSD+L++++ +F RE
Sbjct: 162  LDQSLSEIKALRD-------SNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERE 214

Query: 294  MSXXXXXXXXXXXXXXSFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESN 353
            ++              S   EL    E     E ++  + Q ++  ++++  ++Q+EE  
Sbjct: 215  LATRDKLNAVLKKQVNSLHSELGNGGETPAHAEPNDQFAKQSSQHEEEISNYKEQVEE-- 272

Query: 354  HERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIES 413
                     +  ++G                     I  L+K L+KER +  +L++Q+ES
Sbjct: 273  ---------LLGILGQG----------------APSIAHLRKLLLKERKENVSLKKQMES 307

Query: 414  FVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEIN 473
            FV+ELE+++P +  L++++  ++++L      +   S  K R  REL S+  K+  L   
Sbjct: 308  FVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQI 367

Query: 474  THTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIIT 533
             H L  QRSDLA Q+QFLL      N S   L   E++FIK IIENEN     DSQ I++
Sbjct: 368  FHKLRVQRSDLAHQIQFLL----TVNSSDTVLPPSELSFIKTIIENENWDAYKDSQRIVS 423

Query: 534  ERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQ 593
            +RL+ F +I  LQE+N +L+ T R+L D++E  E +++  +      T++ AK  I  L+
Sbjct: 424  DRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLE 477

Query: 594  ERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQ------ENQELIKSLE 647
            + N+++ES+V         ++A++       + L D D + DS+      E Q+ I+ LE
Sbjct: 478  QSNAQLESEVKN-------WEALM-------ETLKDGDSL-DSKINVTMVEQQKKIEELE 522

Query: 648  DKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTK 707
             KL+ +     +   +LN+ I      + Q TI+   E+   T+  D     +S L   K
Sbjct: 523  SKLTDVGESHVQKINVLNKTI-----DRNQSTINMLNEQIKNTVKSDMNA--KSELIACK 575

Query: 708  NENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAAN-----------LD 756
             EN  L ++    Q+ L +  +++ +    Y    ++LSV    AAN           L 
Sbjct: 576  RENLSLTQQISTKQNELDELNSKSAQKERDYQLKIAELSV----AANKCKSWENSFHLLT 631

Query: 757  AEKXXXXXXXXXXRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLE 816
             EK            +IQ+ S +   L     +L+   S +E   K S+ +  + I  L 
Sbjct: 632  EEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLS 691

Query: 817  VQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMS-------------SDAGKIRD 863
             +   L  +++ K+ E+K   +    Q KW+Q+ IDE+S             +D  ++  
Sbjct: 692  EENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLRLLS 751

Query: 864  E--LATKTATVA----QLELEVNDLKKKIEESDSRIASYKTLNDAGNGETTQGQLRKDLE 917
            E  L+ K   V     +L+ E+N +K  +E S+S+   YK   +          L    +
Sbjct: 752  EKSLSNKPYPVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTL--SFQ 809

Query: 918  KTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYLAEKVQLE-QCV 976
             T+ EL+   S+NE      S   ETL+N   E E +++             +QLE Q +
Sbjct: 810  NTISELQ---SKNEAL----SKQHETLQNQITETENQSKG------------IQLEHQTI 850

Query: 977  SNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDL 1036
                  ID L +E           K  + +KL SL  SE  + ++K EYD ++ +++ +L
Sbjct: 851  ------IDRLTSE-----------KTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNL 893

Query: 1037 EQQTAYANIAQKNYEEEL-QKHAEVSKI---ISQLRSEVQSGRSEIQQLKASEQQAKEVL 1092
            + Q+      + N+E  L  K  E++     I QL +E+    S+I  L    +      
Sbjct: 894  KIQSD----TRLNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAALTEPAE------ 943

Query: 1093 ENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPGSS-- 1150
                K+   ++  L   +    ++++++++QN +L+     +   + + E    P     
Sbjct: 944  --ARKTLIKERDSLGQELKLANQRIESLAAQNSILYDTFSGMRHVDADAE----PNEDLR 997

Query: 1151 ELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIAK 1210
             L+I+LR ERD+ +++ T ++R+ KLL +    + ++LA    ++ +    + +   +  
Sbjct: 998  NLVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTV 1057

Query: 1211 QHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQS 1270
             HE IM +L  +   +E N+ L  ++ +  E    LQ E++ L+      + EL++   S
Sbjct: 1058 THEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQEEVSRLRE-----SEELAKKNSS 1112

Query: 1271 I---EEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKE 1327
                +E  Q+I     E+++WK     + ++  +    E + L++++   K +++ K++E
Sbjct: 1113 AISEQEWQQKIETYQQESEKWKL----MCQQMSENTATEIQNLQQQLETFKADIQLKTQE 1168

Query: 1328 NTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKL 1387
            N DLNDRFTRLKKQAHEKLNASK    +L+ E++EL+     ++E L   +T  +     
Sbjct: 1169 NDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSV----- 1223

Query: 1388 LTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQVRIF 1447
                DSES  N  L  +L +  ++ K +E++L  +V SSE L + + +E+ +LKE     
Sbjct: 1224 ----DSES--NAALILQLKEENKQAKSLELELRHSVDSSEKLIADMTKELTTLKE----- 1272

Query: 1448 KEKENDSTLEGS---QGLSNVVESMXXXXXXXXXXXXXXXXXXYNKKFEEEKAKLSSENG 1504
                  + ++GS   +  ++ +E +                    ++FE EK +L + N 
Sbjct: 1273 ------NPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFEREKKELMNNNA 1326

Query: 1505 SPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTEL 1564
                     ++  L+K  EEE+E  + QRI+EA+ENLKK IR+PTEE+I++V+ KRK +L
Sbjct: 1327 ---------NLEELRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQL 1377

Query: 1565 EEEFQRRLKE--NNLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAA 1622
            EE+FQ ++ E  N L+      K  +EL+K++  E + + +E     KKKAFEEG+QQA+
Sbjct: 1378 EEQFQTKVAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQAS 1437

Query: 1623 MKSTLLERKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLK 1682
            MK+TLLERKI+KLE++L     P         + + + +       M  G P   E V  
Sbjct: 1438 MKTTLLERKIAKLEARLQGGTGPLKSANGLNKINIDSPL-------MVAG-PLTNEPV-- 1487

Query: 1683 LSDKP-AFSFQPSSK-SNPFTSALPGNNNVFGMKPTFSFTPGSSQP----ESRPTFGSTG 1736
            L +KP AF+   ++  S P ++    + N F    +F+     +QP     ++P F    
Sbjct: 1488 LDEKPNAFAGATTTTISQPTSTTAKDSANAF----SFNAQKVPAQPAFSSRAQPAFSFGS 1543

Query: 1737 FNTTA 1741
            FN T+
Sbjct: 1544 FNKTS 1548

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  286 bits (733), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 320/1147 (27%), Positives = 572/1147 (49%), Gaps = 82/1147 (7%)

Query: 139  KQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIV 198
            K E++KLLEE+I++++  K +  ++V +NKNL +   +   E++T K   L  +++L+ V
Sbjct: 74   KNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKV 133

Query: 199  KQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFL 258
               + +  K  +  E E  SK +    Y+   + E Q  ++ +  + N+ ++       L
Sbjct: 134  TFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAEL 193

Query: 259  LKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXXSFKEELR-L 317
             K+N+E+S+DL+ K+ EIK L + L T   +F  E                + +E+L  L
Sbjct: 194  FKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESL 253

Query: 318  TEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMG-----DSEE 372
            ++EK +      L   +  R + +L    ++LE S  ERL L   + E         S  
Sbjct: 254  SDEKFDDPGTQKLDKHELLRQIKNL---NEKLEISERERLSLVHSMEEFQNIPEEESSSV 310

Query: 373  FDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERS 432
                S  N S   L GD+ +L+K  +KER QK  L+ Q+   + ELE  +P ++S KERS
Sbjct: 311  SSHASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSYKERS 370

Query: 433  YTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLL 492
              LEKEL+   +LLEH   E   K+ ELE    +   L  + ++L  QR+ LARQV++LL
Sbjct: 371  TFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLL 430

Query: 493  FNGTLQNDSR--GPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNT 550
                +QN+      L   ++  + + +        SDS+ I+ ERL +FK++  LQ RN 
Sbjct: 431  L--IIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNM 488

Query: 551  ELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKER 610
            +LL+ +R LA + E+ EK +  +I S E +TI++AKEAI+ LQE + ++ES++  +    
Sbjct: 489  QLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELS--- 545

Query: 611  DAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKN---------- 660
                          D L    + K  +E+   +  +ED  S+ T +  K           
Sbjct: 546  --------------DELAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKD 591

Query: 661  -NELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHE 719
              + LN EI NL+Q+ T + IS +KE+S+R LAEDR  LL+  + + K+E  EL    ++
Sbjct: 592  IIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNK 651

Query: 720  LQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVE 779
            LQ  +  +E +   +   YISC+SKLS  EA   +L AE           R + + +  E
Sbjct: 652  LQQNILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNE 711

Query: 780  RNSLNLMVTQLQTLQSERENLLKESQASH--KAAIAQLEV-QTSELKTEISSKDNEIKAS 836
            RN+L + VTQ+ +L +E + LLKE+++ +  K  I+ L+  QT+     +  + +E+K+ 
Sbjct: 712  RNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQ 771

Query: 837  EDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASY 896
             D   ++ KW++  ID++ ++  ++ +EL  K   + +    + +++ ++  ++S+  S 
Sbjct: 772  ND---SEIKWYKATIDDLKANVFELNEELKQKEEKIEEFSKTLENVQNELTLANSKDVS- 827

Query: 897  KTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTE 956
                +    E    +++  LEK+ +E+K       E++ + ST++ + +N S ++E+R +
Sbjct: 828  ---EEKRALEKELSEVKSQLEKSNLEVK-------EYENVISTSKRSFENKSIQYEDRIK 877

Query: 957  ALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEH 1016
            AL S  +  L E+  L++ +S L+  +    +E     N            L  L  S  
Sbjct: 878  ALASKLDSELRERTTLQENLSTLQARMVVQQDELTSNNN-----------TLSELRVSYD 926

Query: 1017 SLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRS 1076
            SL   +K +  K  +L+  +  +T   +   K+YE  +Q+++E+SK++  LR EV+  R+
Sbjct: 927  SLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREEVK-NRT 985

Query: 1077 EIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSK 1136
               + +   +  + +++ G+  W  +K   +  I +L  ++  +  +N+ L +++E   K
Sbjct: 986  SNGEKEGDLEDTESIIKKGQDVWDEEKKVFEVQITNLNERLSELLEENESLLARLESQDK 1045

Query: 1137 SEREFENKL-LPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKL 1195
                   +    G+ E L +LR ER  L  KLT +++EE+ +  K    E  L+E   +L
Sbjct: 1046 GNNSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKLRETEHALSENAFEL 1105

Query: 1196 FKLQENDSNHSDIAKQHEDIMEQLNQMNLLRE--------SNVTLR--NAVNA-AQEKNS 1244
             K++      S + +   DI+  L  +   RE        +N  +   N V   AQEK  
Sbjct: 1106 KKIKSQIFELSSLPQNEHDILRHLVHLKEQREEKNKDALGTNKYMEQPNKVTTEAQEKIQ 1165

Query: 1245 DLQSELN 1251
            DL+ +LN
Sbjct: 1166 DLEEQLN 1172

 Score = 92.0 bits (227), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 94/152 (61%), Gaps = 10/152 (6%)

Query: 1492 FEEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEE 1551
            FE+EK+ L S+     E ++  +     ++  E YE   Q+++ +AEENLKKRIR+PTEE
Sbjct: 1195 FEKEKSSLLSQQEQEIEKLTDNE-----RKLREFYEEEIQKKVSQAEENLKKRIRLPTEE 1249

Query: 1552 RIKKVLDKRKTELEEEFQRRLKE--NNLQPEGGDAKEREELKKQLESEFEA---KYKEIL 1606
            +I  +++KRK+ELE  F++++KE   +L     D K ++  K+  ES  E    ++ E L
Sbjct: 1250 KINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDDKIKKIYKEIEESGRETLQQEFDEQL 1309

Query: 1607 ASTKKKAFEEGKQQAAMKSTLLERKISKLESQ 1638
               +KKAFEEGKQ   MKS  LERKIS LE Q
Sbjct: 1310 NIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  233 bits (595), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 195/634 (30%), Positives = 333/634 (52%), Gaps = 92/634 (14%)

Query: 1110 IDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPGSSELLISLRRERDILETKLTV 1169
            ++D K +V N+++QN+LL  ++E  +  E +          ++ +SLR ERD L  ++  
Sbjct: 728  LEDTKVRVQNLATQNRLLLEKLERSANLEVD----------DIFVSLRYERDTLSDQVVN 777

Query: 1170 SKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIAKQH-------EDIMEQLNQM 1222
             +++ +++     +++ EL  A  ++   +    N   + + H       E ++E+L ++
Sbjct: 778  YEKDMQVILADLESVQSELNAANSQILNFE----NQRAMVQDHKKGNVNEETLIEKLTEL 833

Query: 1223 NLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLI 1282
            + L+E N+ L   ++A  E N  L+ +L     ++ PL +++SE    IE+KD  I +  
Sbjct: 834  DELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSN 893

Query: 1283 DEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQA 1342
            ++A+ WK R +++    +  D        E++ NL+K++E KSKEN +L+DRF RLKKQA
Sbjct: 894  EKAENWKTRFNELTLSAKNND-------NEDLINLQKQVEEKSKENEELSDRFNRLKKQA 946

Query: 1343 HEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLR 1402
            +E+L+ASK+AQ NL+ + NEL+   T +E  L E   +   LE  ++ +D E  +  DL+
Sbjct: 947  NERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLK 1006

Query: 1403 HELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQVRIFKEKENDSTLEGSQGL 1462
             +L +AL++ K+ E +L +TV  SE L S L  EI SL E++   K KE+   L+ S+  
Sbjct: 1007 EQLANALDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKL---KSKESSVGLQESE-- 1061

Query: 1463 SNVVESMXXXXXXXXXXXXXXXXXXYNKKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQW 1522
               +E+                    + K +EE   L +                     
Sbjct: 1062 ---IENAKKILIAELEEKLNKTKSELDLKHKEELKVLKT--------------------- 1097

Query: 1523 EEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQPEGG 1582
              EYE   Q+R+ EAEE LK++IR+P+EE+I  +++ +  +LEE+++++     L+    
Sbjct: 1098 --EYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKK-----LETVSA 1150

Query: 1583 DAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSS 1642
            ++ + E++K++ E          L + KKKAFEEGKQQA+MK+  LE KI+KLESQL ++
Sbjct: 1151 ESTDIEKIKQEFEDN--------LVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQNN 1202

Query: 1643 NNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTS 1702
             +   +K A           E +T +     P       K   KP+F+F P   SNPFT+
Sbjct: 1203 ESDVTDKEA-----------EVKTTDNEKSNPELD----KQEAKPSFTFSPPPNSNPFTT 1247

Query: 1703 ALPGNN--NVFGMKPTFSF--TPGSSQPESRPTF 1732
                ++  +VFG+KPTFS    P    P + P+F
Sbjct: 1248 TQDTDSPVSVFGIKPTFSLGANPFKISPVA-PSF 1280

 Score =  177 bits (449), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 140/464 (30%), Positives = 253/464 (54%), Gaps = 34/464 (7%)

Query: 403 QKENLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELES 462
           Q   L+  I++++ ELE ++P+I + K     L+  L+   L++E   ++K+   + ++S
Sbjct: 210 QNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDS 269

Query: 463 ATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENP 522
               I +   +   L  QR+DLA Q+Q+LL + ++QND+ GPL+  E+ F++ +I  +  
Sbjct: 270 MKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQ 329

Query: 523 SNESDSQSIITERLVEFKDIATLQERNTELLKTARTLADRLEEEE---KNSNIRIDSLER 579
              SD QS+I++RL++FKDI +LQE+N EL K+ R LA  LE +E   KNS    D+   
Sbjct: 330 RLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDN--- 386

Query: 580 KTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQEN 639
            TI+EAKE I++LQE N+ ++ ++ T++ +       +S+   S  N  ++++ +    +
Sbjct: 387 DTINEAKETILSLQEYNNVLKLEIGTLQSK-------ISELQSSIPNSKESEK-QHFNYH 438

Query: 640 QELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLL 699
             L+K LE KLS L+  +    E LN++I+NLY  +T + I+ EKE+SS  LA ++L LL
Sbjct: 439 SNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLL 498

Query: 700 QSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEK 759
           Q++ ++   EN EL  ++  L+  L+++E      +N YI C++ L     R   L+  K
Sbjct: 499 QNSYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLLNNNK 558

Query: 760 XXXXXXXXXXRREIQKISVERNSLNLMVTQLQTLQSERENL---LKESQASHKAAIAQLE 816
                     ++EI+              Q++ L S+ ++L   L+   + +   + +LE
Sbjct: 559 LGLEEENNSLKQEIKS----------NYEQIKDLDSKSKHLEQSLENEISKYTDKVKELE 608

Query: 817 VQTSELKTE-------ISSKDNEIKASEDAKRAQTKWFQEKIDE 853
           +  S+L  +       + +K+ EI     +   Q  W+Q+K+D+
Sbjct: 609 LNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQ 652

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score =  215 bits (547), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 179/499 (35%), Positives = 274/499 (54%), Gaps = 44/499 (8%)

Query: 1213 EDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIE 1272
            E++ME   ++  L ESN  L   V    + N  L S+L  +Q K+ PL  E++E +  + 
Sbjct: 1060 EEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVA 1119

Query: 1273 EKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLN 1332
            EK+Q + +  +E +RWK RS  IL++ + ++ E + K  E+I  L+++LE    EN  L 
Sbjct: 1120 EKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLT 1179

Query: 1333 DRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERD 1392
            DRF RLKKQAHEKL+A+K  Q NL+ ++NEL  TK  +E+ L++             E++
Sbjct: 1180 DRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE-----------IEKN 1228

Query: 1393 SESANNED--------LRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQV 1444
            ++S N           LR EL+ +     E+E K+ +          +   EI SLK ++
Sbjct: 1229 NQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVED--------AKKFKNEIESLKSEL 1280

Query: 1445 RIFKEKENDSTLEGSQGLSNVVESMXXXXXXXXXXXXXXXXXXYNKKFEEEKAKLSSE-- 1502
            +  K  EN ST+      S +++ +                  +  K E+EK  + ++  
Sbjct: 1281 QSVKAYEN-STVN-----SKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRK 1334

Query: 1503 NGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKT 1562
            N   A    + ++  LKK+WEEE EA+  +RI EAEENLKKR+R+P+EE+I  V++KR+ 
Sbjct: 1335 NNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRK 1394

Query: 1563 ELEEEFQRRLKENNLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAA 1622
             LE+EF+ +L+E  L  +G       + + Q+E E   K+   LA  KKKAFEEGKQQ+ 
Sbjct: 1395 VLEQEFETKLRELGLNADGNGV--VTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSM 1452

Query: 1623 MKSTLLERKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLK 1682
            MKSTLLERK+SKLESQ  S   PT +   +    +P+KI+ S   N+ + +P  GEKVL+
Sbjct: 1453 MKSTLLERKLSKLESQTLS---PT-KNNDSNETQVPSKINLS---NINSSSPPLGEKVLQ 1505

Query: 1683 LSDKPAFSFQPSSKSNPFT 1701
            L+       +  +  NPFT
Sbjct: 1506 LNYGANVVAETDNDDNPFT 1524

 Score =  206 bits (524), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 161/474 (33%), Positives = 276/474 (58%), Gaps = 28/474 (5%)

Query: 153 LEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWL 212
           LE SK+E Q+ + +N  L++Q+   + ++ ++        +E + ++  + +L ++N +L
Sbjct: 145 LEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYL 204

Query: 213 EKEV--TSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQ 270
           E +   T K ++L     E+ + LQ  LQ V+      + E ++ +++   N+ +S DLQ
Sbjct: 205 EIKCKETDKNKKLYS-SAEDASRLQDQLQIVSSEILSLKSEIATLKYM---NESLSTDLQ 260

Query: 271 NKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXXXXXXSFKEEL-RLTEEKHNSTEADN 329
            KL+ IK L D LN+ KQEF++E++              S+K+++ RLT        + N
Sbjct: 261 RKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLT--------SKN 312

Query: 330 LQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGD 389
           L+ T + + + +L  ++++L  S  E   L++ V++ +   E+  +    N   PK    
Sbjct: 313 LE-TPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGN---PKKL-- 366

Query: 390 IGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHT 449
           I +L++QL+KE+  K+ LQRQ+ESF+VELE K+P+I+S KER+ +LE+EL  I   LE T
Sbjct: 367 IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEET 426

Query: 450 SHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADE 509
           + E++ K REL +   KI   E     L+RQRSDLA QVQ+LL    L  D++ P T  E
Sbjct: 427 AKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLL----LCIDNKSPFTEKE 482

Query: 510 VAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNTELLKTARTLADRLE--EEE 567
              +KKI+ NEN  N++DS  II++RL+ F+++  LQ++N ELL+T R L   LE  E+E
Sbjct: 483 ATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQE 542

Query: 568 KNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTS 621
           +   +RI     K ++ AK   + L++    +ESK++ I +ERD+YK +++ ++
Sbjct: 543 QQKTLRITD-NNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVTNST 595

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  129 bits (325), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 165/724 (22%), Positives = 333/724 (45%), Gaps = 67/724 (9%)

Query: 185 KCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARL 244
           KCN L  K ELE +      L   N  LE ++++  +       E   + Q   +EV  L
Sbjct: 95  KCNNLHTKLELEKMSITYNSLESKNRELESDLSAMNDNENTLHDEEQYKNQCLNREVINL 154

Query: 245 KNDYQLEKSSREFLLKKNQEISQDLQNKLYEI----------KKLSDELNTEKQEFSREM 294
           KND  + ++  + LLK   +   +L+ K+ E+           KL DE+  EK      +
Sbjct: 155 KNDILILETKYDKLLKGYNDTKDNLKEKISELLALDTSFKSETKLKDEIIEEKDYLIANL 214

Query: 295 SXXXXXXXXXXXXXXSFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNH 354
           +              S   ++ +   K++S   D     +  R +++     ++++E + 
Sbjct: 215 TNEIESLKNREINEHS--SDINIEYGKNSSIIVD---KQEYQRLLNEALINNEKIDEYDL 269

Query: 355 ERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESF 414
           +  RL A VNE       F   +  N      + D  +LKK++ K   Q++ LQ ++E  
Sbjct: 270 KVARLTATVNE-------FQSKTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYL 322

Query: 415 VVELEYKVPVINSLKERSYTLEKELSDIALLL---EHTSHEKERKTRELES----ATGKI 467
           + ELE   P +N+  ++       ++++ LLL   ++TS   +   +E+E+       ++
Sbjct: 323 IHELENHAPELNNQYDK-------INELELLLSKEKNTSEHFKTTIKEIENEKKNIISRL 375

Query: 468 KQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIE--NENPSNE 525
           K  +    TL  + +DL  Q+QF+L + ++QND  G LT +E+ FIK + E   E   NE
Sbjct: 376 KLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNE 435

Query: 526 -SDSQSIITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDE 584
             +SQ II++RL+ F+ + +LQ++N EL+KT R +  +L+ +E     + ++     ++E
Sbjct: 436 LYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLDNQEHELRAKWEAENDDVLNE 495

Query: 585 AKEAII-------TLQERNSEIESKVST---IEKERDAYKAILSQTSQSFDNLGDADRMK 634
           AKE I+        L+E+ SE++ +++    +  E++ ++++L++         + DR+ 
Sbjct: 496 AKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLAENKL----YTEGDRL- 550

Query: 635 DSQENQELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAED 694
                  ++  L++ +   T + S    +   ++ +LY    +LT    K   SR + + 
Sbjct: 551 -------ILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITQK 603

Query: 695 RLKLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAAN 754
           +L LLQ   +     N +L      ++  + +++     T+  ++ C++ L  +     +
Sbjct: 604 KLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNS 663

Query: 755 LDAEKXXXXXXXXXXRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQ 814
           L  +            R   ++ +ER  L + +  ++T+Q + +    E +AS  + I  
Sbjct: 664 LMTKYDELKYLKDQQSRITNELKMEREQLKMELLNIKTVQIQSDLESAEYKASVASKIND 723

Query: 815 LEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKI------RDELATK 868
           LE+  S L  ++ +K+ E++     K  +  W+Q+K D  S+   ++       D++  K
Sbjct: 724 LEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFDIFSTMLKRVAEGNDNNDDIPVK 783

Query: 869 TATV 872
           T  +
Sbjct: 784 TENI 787

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 21/110 (19%)

Query: 1642 SNNPTPEKAAATSVG-LPTKIDESRTENMATGTPAF--GEKVLKLSDKPAFSFQPSSKSN 1698
            +NNP  E     S    P+K++   T    T  P+F   + + + S   +F+F P +  N
Sbjct: 1137 NNNPVKESVDMLSNEESPSKMESDTT----TTKPSFLPNQNLTQPSVTSSFTFSPLAMEN 1192

Query: 1699 PFTSALPGN----NNVFGMKPTFSF--TPGSSQPE------SRPTFGSTG 1736
            PFTS  P N     + FGMKP FSF   P +S         S P   STG
Sbjct: 1193 PFTS--PNNAKTPTSSFGMKPAFSFGSNPFTSNTNSLGTKMSTPDSNSTG 1240

 Score = 39.7 bits (91), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%)

Query: 1315 SNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQ 1364
            S+ K++ E KSKEN +  DRF RLKKQA+ +L++SK  Q  L+ +++ L+
Sbjct: 971  SDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLK 1020

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score =  105 bits (262), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 138/533 (25%), Positives = 261/533 (48%), Gaps = 85/533 (15%)

Query: 388 GDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVI--NSLKERSYTLEKELSDIALL 445
            +I  +K +LIKE+++K  L+++   F+ ++E K+P +  NS++  +    K + +  ++
Sbjct: 281 NNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNK-IEEQKII 339

Query: 446 LEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQN-DSRGP 504
            EH S + E ++ ++     K+   E    TL++QRSDL  Q+ +LL   +  N D+   
Sbjct: 340 HEHDSLKLENQSLKI-----KLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKI 394

Query: 505 LTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNTELLKTARTLADRLE 564
           LT +E+ FI+ ++     +  +++Q+II+ERL++F +++ L  +N +L+   R L +++E
Sbjct: 395 LTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKME 454

Query: 565 EEEKNSNIRIDSLER--KTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQ 622
             EK ++ +   LE   K+IDEAK+ +I L+E N           K +D    I+S+   
Sbjct: 455 SIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEENV----------KNKDIINQIISEK-- 502

Query: 623 SFDNLGDADRMKDSQENQELIKSLEDKLSTL---TTETSKNNEL----------LNQEIR 669
                                K LEDK+  L    TE +K+ E+          L +  +
Sbjct: 503 ---------------------KLLEDKIHGLNSTVTELNKSMEIKREPTLKNLELQKTNQ 541

Query: 670 NLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQEA 729
           +L +   QL+I      +   + +++  LL  +    K   +E+   ++   S++SK   
Sbjct: 542 SLLEKNNQLSIEISNASNENKILKEKFDLLIKSYTELKELKSEI--STYTKSSVISK--- 596

Query: 730 RNGETVNKYISCQSKLSVLEARAANLDAEKXXXXXXXXXXRREIQKISVERNSLNLMVTQ 789
            +G    K     S+L  L+A+  NL  EK            EI+  +V ++ L  ++++
Sbjct: 597 -DGNETAKI----SELVDLKAKCKNL--EKSFKDRESKFQELEIENNNV-KDELKKVLSE 648

Query: 790 LQTLQSERENLLKESQASHKAAI-----AQL---EVQTSE-----LKTEISSKDNEIKAS 836
             T +S R  +   +Q  +   I      QL   E+ T +     L+ +I  ++N+IK  
Sbjct: 649 YNTFKSTRGTIDSFNQNKNSIGINENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKIL 708

Query: 837 EDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQL--ELEVNDLKKKIE 887
            +  ++Q KW+Q+KIDEM++        LA+   + A L  + E+++LKK+IE
Sbjct: 709 IEKYKSQIKWYQDKIDEMNTTMEVKISNLASSAESAAMLKNKNEIDELKKQIE 761

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 121/447 (27%), Positives = 208/447 (46%), Gaps = 83/447 (18%)

Query: 1313 EISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEE 1372
            EI  LKK++E KSKE T+  DRF RLKKQA +KLN  K  +  L  +  +L+ +K ++E+
Sbjct: 752  EIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKNELEQ 811

Query: 1373 IL-------KETQTKVLNLEKLLTERDSESANN----EDLRHELD--DALERCKEIEVK- 1418
             L       K  Q +++ ++  L   ++E  NN    E+LR+E +  + L + KE E++ 
Sbjct: 812  RLLLLESSEKSLQEEIVKMKDELMTSNNELDNNQRSQEELRNEYEKQNKLYKIKEEELES 871

Query: 1419 ------LGETVGSSEGLTSQLNEEINSLKEQVRIFKEKENDSTLEGSQGLSNVVESMXXX 1472
                  L E   S+  L S  ++ +  LKE V+   E END  L+               
Sbjct: 872  ALNQLMLKENQNSALDLESLPDDVMLKLKEMVKKDIEIENDIILKAKL------------ 919

Query: 1473 XXXXXXXXXXXXXXXYNKKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQ 1532
                             K+ E+  AK   +  + +  +S  +++++K+ WE+EY+ I + 
Sbjct: 920  -----------------KEIEKNSAK---DVNTDSIELSDDNISTMKEAWEKEYQHILKI 959

Query: 1533 RIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQPE--GGDAKEREEL 1590
            RI++AE     R R   E+  ++ L K   +L +++  +LK+ +L  E    D K   EL
Sbjct: 960  RIEDAENQAMARTRKELEKEYEERLSKESEKLSDQYNNKLKD-DLSEELLKIDKKYAMEL 1018

Query: 1591 KKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNNPTPEKA 1650
            + +L++E             KK F++       K+ +L +KI  LE+Q+    +   +  
Sbjct: 1019 ETKLKNE---------TDESKKEFQDALGTEQTKNKILSKKIEFLETQIKELKDEQTKHH 1069

Query: 1651 AATSVGLPTKIDE--SRTENMATGTPAFGEK-VLKLSDKPAF------SFQPSSKSNP-- 1699
            +      P K DE    T N++T   AFG+   +  + + A+      S  P S++ P  
Sbjct: 1070 SN-----PMKSDEKIPSTTNLSTNF-AFGQNPFVSNASQNAYMSNVFLSGSPFSRNAPEK 1123

Query: 1700 -FTSALPGN-NNVFGMKPTFSFTPGSS 1724
             F  + P N N+   ++PT +F    S
Sbjct: 1124 AFKHSTPDNTNSSITVQPTLTFNTDFS 1150

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 73.6 bits (179), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 127/452 (28%), Positives = 204/452 (45%), Gaps = 117/452 (25%)

Query: 1214 DIMEQLNQMNLLRESNVT-LRNAVNAAQEKNSDLQSELNHLQSK-ILPLNSELSECRQSI 1271
            D++   NQ   +  SN++ L N +N   +KNS + +EL+ L SK IL L +E ++  + +
Sbjct: 549  DLLADENQKIKMENSNLSSLLNKINT--DKNS-ISNELSDLHSKEILELETEKTKLLEQL 605

Query: 1272 EEKDQRIILLIDEADRWKERSHDILRRHEKIDP--EEYRK------LEEEISNLKKELEA 1323
            EE ++++       +  ++ +  I     KID   EE  K      L+ +  NLKK  E 
Sbjct: 606  EEGERKL------KETNEKHNEQIKWFQNKIDNFNEETTKNQFNNALKNDYENLKKSFEE 659

Query: 1324 KSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLN 1383
            KSKE  + ND+F+RLK+QA+E+LNASK  Q  LS  V  L+  +T  +E + + +  + N
Sbjct: 660  KSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINN 719

Query: 1384 LEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQ 1443
            L   L E + + +  E+L++E +   +    + +K+ +          QLNE+  +LKE+
Sbjct: 720  LNNALVEAEKKLS-EENLKYETER--QTGSTLRLKIDDL---------QLNED--NLKEK 765

Query: 1444 VRIFKEKENDSTL-------EGSQ----GLSNVVESMXXXXXXXXXXXXXXXXXXYNKKF 1492
            V+    +EN+STL       EG++    G  +V++S                        
Sbjct: 766  VKNL--EENESTLKDKIKMIEGNEDDLMGKISVLQSNEILL------------------- 804

Query: 1493 EEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEER 1552
               K KL+  N   +      DV  LKK WE+EY  I ++RI+ AE  L+KR+       
Sbjct: 805  ---KDKLNDLNSKSSNNSELVDVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRL------- 854

Query: 1553 IKKVLDKRKTELEEEFQRRLKENNLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKK 1612
                    K+E+E E   ++K                                    + K
Sbjct: 855  --------KSEMEREMDDKMK----------------------------------VVEMK 872

Query: 1613 AFEEGKQQAAMKSTLLERKISKLESQLNSSNN 1644
             FE GK  +     LLE K+S LE Q N  +N
Sbjct: 873  GFESGKASSEKTLNLLEHKLSLLEKQNNEKSN 904

 Score = 62.4 bits (150), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 157/706 (22%), Positives = 294/706 (41%), Gaps = 124/706 (17%)

Query: 192 KSELEIVKQQVGMLTKSNEWL-EKEVTSKTEQLI-----KYRQENDTELQKSLQEVARLK 245
           K E++ +  +  +L  + +WL E+ V  +   LI     KY  +ND +L  S  ++  L+
Sbjct: 21  KREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKLLELQ 80

Query: 246 NDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSXXXXXXXXXX 305
                    +EFL+  N+              KLSD LN    EF+ + +          
Sbjct: 81  ---------KEFLISHNE--------------KLSDRLNENSIEFNDKFNSVVIDNLNNE 117

Query: 306 XXXXSFKEELRLTEEKHNSTEAD-------NLQSTQQARFMDDLAQVRQQLEESNHERL- 357
                F+++L L  E+++    D       ++ +++   F     ++ +Q   SN + + 
Sbjct: 118 KNLILFEKKLNLLNERYSIIIKDQKDVIDNDINNSKYLEFKSLNEKIIKQ--NSNMKSME 175

Query: 358 ----RLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIES 413
               +L A+++  + D  EFD ++T   S+     D  VLKK L+ E++    LQ ++ S
Sbjct: 176 SKIEKLNAIIHNFI-DINEFDNENTNKYSLD--LNDNKVLKKLLVHEKNSNLKLQEELNS 232

Query: 414 FVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEIN 473
            ++EL +K+P + SLKE+++ L+    +I    E    +    T ++ S   KI   E +
Sbjct: 233 ILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYEQS 292

Query: 474 THTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIIT 533
              L+ QR++L   +  LL    L +     L+  E   I+ +  N              
Sbjct: 293 LKQLLSQRTNLISYILNLLNVINLNSKYLN-LSESEGCLIQNLFNN-------------- 337

Query: 534 ERLVEFKDIATLQERN---TELLKTARTLADRLEEEEKNSNIRIDSLERKTI-------D 583
           ER+  F     LQE+N   TE+     T+           +I  ++  R  I        
Sbjct: 338 ERIQRF-----LQEKNLTLTEIFDNLNTV-----------DITFNNFNRSDIKVLPPTES 381

Query: 584 EAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFD-----NLGDADRMKDSQE 638
            +KE II  +       +++  +E   DAYK IL     + D      +  + RM +  E
Sbjct: 382 ASKEEIINYK-------NEIILLENNCDAYKMILYNNGITEDLDEKLKIESSSRMTELNE 434

Query: 639 NQELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKL 698
               I+ LE K+  L +  +K NE             ++   S  K  SS +   ++  L
Sbjct: 435 KNSRIQMLESKIDELNSIVTKLNE-----------KNSRFMASINKNNSSESTILEKYNL 483

Query: 699 LQSTLEMTKNENAELIRRSHELQS-ILSKQEARNGETVN---KYISCQSKLSVLEARAAN 754
           L  + +        L+     L+S     ++A    T++   K +  +S ++ L +   +
Sbjct: 484 LNQSYKT-------LLEAYKSLKSNATDNKKAVLTSTLDDTKKIVEFKSTINYLNSTIKS 536

Query: 755 LDAEKXXXXXXXXXXRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQ 814
           L A+             E QKI +E ++L+ ++ ++ T   ++ ++  E    H   I +
Sbjct: 537 LSAKLVSIQESNDLLADENQKIKMENSNLSSLLNKINT---DKNSISNELSDLHSKEILE 593

Query: 815 LEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGK 860
           LE + ++L  ++   + ++K + +    Q KWFQ KID  + +  K
Sbjct: 594 LETEKTKLLEQLEEGERKLKETNEKHNEQIKWFQNKIDNFNEETTK 639

>TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.604
            YOR195W
          Length = 781

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 81/164 (49%), Gaps = 21/164 (12%)

Query: 1293 HDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIA 1352
            HD+  R+  ++ +   KL EEIS+LK+ L  K       N    RL+KQ  E ++A K A
Sbjct: 411  HDVTTRNTMLE-DHNEKLREEISDLKERLTTK-------NGELERLQKQLDETISAGKGA 462

Query: 1353 QANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLRHELDDALERC 1412
               + AE+NE+   +  +E            LE L   R +  A+   LR +L +A+ R 
Sbjct: 463  NDEVLAELNEVIAQRANLE----------AELEAL---RVASEADGNKLRDQLHEAVTRS 509

Query: 1413 KEIEVKLGETVGSSEGLTSQLNEEINSLKEQVRIFKEKENDSTL 1456
              + +++ E    S+GL + LN  ++ +++  +  +E  +D+ +
Sbjct: 510  NLMVLEVQELKDHSDGLQAGLNARVSEIEQMSKKIEELNDDAEI 553

>TPHA0F01250 Chr6 (286089..289925) [3837 bp, 1278 aa] {ON} Anc_2.253
            YIL115C
          Length = 1278

 Score = 42.7 bits (99), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 69/163 (42%), Gaps = 35/163 (21%)

Query: 1612 KAFEEGKQQAA-MKSTLLERKISKLESQLNSSNNPTPEKAAATSVG-------------- 1656
            KA +EGK     +K+ L  R+   +E     +N PTPEK   +S+               
Sbjct: 404  KAMKEGKYNIDNLKNRLHTRENFSIEEATKVNNLPTPEKTDDSSLALKLDTDDDLDISSK 463

Query: 1657 LPTKIDESRTENMATGT----PAFGEKVLKLSD-KPAFS---FQPSSKSNPFTSALPGNN 1708
            L   ++  + +N+ + +    PAFG      +D KPAF    F  +     F S   G+ 
Sbjct: 464  LSLDVNNDQPDNVKSHSIFENPAFGSTGFGSTDSKPAFGSTGFGSTDSKPAFGSTGFGST 523

Query: 1709 N---VFG--------MKPTFSFTPGSSQPESRPTFGSTGFNTT 1740
            +    FG         KP F  T G    +S+P FGSTGF +T
Sbjct: 524  DSKPAFGSTGFGSTDAKPAFGST-GFGSTDSKPAFGSTGFGST 565

 Score = 42.0 bits (97), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 46/105 (43%), Gaps = 16/105 (15%)

Query: 1646 TPEKAAATSVGLPTKIDESRTENMATGT------PAFGEKVLKLSD-KPAFS---FQPSS 1695
            T  K A  S G  +   +S+    +TG       PAFG      +D KPAF    F  + 
Sbjct: 495  TDSKPAFGSTGFGST--DSKPAFGSTGFGSTDSKPAFGSTGFGSTDAKPAFGSTGFGSTD 552

Query: 1696 KSNPFTSALPGNNNVFGMKPTFSFTPGSSQPESRPTFGSTGFNTT 1740
                F S   G+ +    KP F  T G    +S+P FGSTGF +T
Sbjct: 553  SKPAFGSTGFGSTD---SKPAFGST-GFGSTDSKPAFGSTGFGST 593

>Klac_YGOB_Anc_8.398 Chr4 complement(1565442..1567220) [1779 bp, 592
            aa] {ON} ANNOTATED BY YGOB -
          Length = 592

 Score = 41.6 bits (96), Expect = 0.023,   Method: Composition-based stats.
 Identities = 37/128 (28%), Positives = 60/128 (46%), Gaps = 26/128 (20%)

Query: 1636 ESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAF---SFQ 1692
            ++ L  +NN T   A++++ G  +     RT + A G+P+FG+       +PAF   S Q
Sbjct: 323  QTSLQPTNNTTTGMASSSAFGQSSNEPAFRTTSGAFGSPSFGQSAF---GQPAFGNNSSQ 379

Query: 1693 PSS----KSNPFTSALPGNN----NVFGMKPTFSFTPGSSQ-----------PESRPTFG 1733
            P++     S P  SA  G +    + FG +PTF    G+ Q           P  +P+FG
Sbjct: 380  PAAAAANSSRPAQSAAFGQSTFGQSAFG-QPTFGKPSGTGQSAFGSTTSGQPPFGQPSFG 438

Query: 1734 STGFNTTA 1741
             T F  ++
Sbjct: 439  QTSFGQSS 446

 Score = 33.5 bits (75), Expect = 5.7,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 45/107 (42%), Gaps = 15/107 (14%)

Query: 1638 QLNSSNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKS 1697
            QL ++     + + A +    T + +S  +   T   +FG        KPAFS Q     
Sbjct: 273  QLQNNAGKNAQNSNAQTPPFGTNVSQSPAQ---TNFSSFGSTTSPFG-KPAFSNQ----- 323

Query: 1698 NPFTSALPGNNNVFGMKPTFSFTPGSSQPESRPT---FGSTGFNTTA 1741
               TS  P NN   GM  + +F   S++P  R T   FGS  F  +A
Sbjct: 324  ---TSLQPTNNTTTGMASSSAFGQSSNEPAFRTTSGAFGSPSFGQSA 367

>NCAS0B03040 Chr2 (524519..526291) [1773 bp, 590 aa] {ON} Anc_8.398
            YDR192C
          Length = 590

 Score = 41.2 bits (95), Expect = 0.029,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 1670 ATGTPAFGEKVLKLSDKPAFSFQPSSKSNPF--TSALPGNNNVFGMKPTFSFTPGSSQPE 1727
            A G PAFG      +   AF     +  +PF   S   G ++ FG  P F     +SQP 
Sbjct: 326  AFGKPAFGATPQSTNTTSAFGTATQTTGSPFGSMSQTAGTSSAFG-NPAFGTGSTASQPA 384

Query: 1728 SRPTFGSTGFNT 1739
            +   FGST F T
Sbjct: 385  TASAFGSTAFGT 396

>TDEL0C04080 Chr3 (717789..722240) [4452 bp, 1483 aa] {ON} Anc_2.253
            YIL115C
          Length = 1483

 Score = 39.7 bits (91), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 39/79 (49%), Gaps = 14/79 (17%)

Query: 1670 ATGTPAFGEKVLKLSD-KPAF---SFQPSSKSNPFTSALPG---NNNVFGMKPTFSFTPG 1722
            A GTPAFG      SD KPAF   SF  S   + F +   G   + + FG  P+F    G
Sbjct: 505  AFGTPAFGTPAFGASDAKPAFGQTSFGSSDTKSAFGAPAFGTLDSKSPFGA-PSF----G 559

Query: 1723 SSQPESRPTFGSTGFNTTA 1741
            SS  +S+P FG+  F  + 
Sbjct: 560  SS--DSKPAFGTPSFGGSG 576

>Ecym_3291 Chr3 complement(548039..552241) [4203 bp, 1400 aa] {ON}
            similar to Ashbya gossypii ADL248C
          Length = 1400

 Score = 38.9 bits (89), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 34/70 (48%), Gaps = 11/70 (15%)

Query: 1672 GTPAFGEKVLKLSDKPAF-----SFQPSSKSNP-FTSALPGNNNVFGMKPTFS-FTPGSS 1724
            G PAFG    +   K  F     SF  S+   P FTS LP   + FG KP F+   P + 
Sbjct: 550  GKPAFGNATPR---KEQFGSNTLSFTGSAFGKPKFTSDLPSTESAFG-KPVFTPVVPSAG 605

Query: 1725 QPESRPTFGS 1734
             P  +P+FGS
Sbjct: 606  SPFGKPSFGS 615

>KLLA0F03531g Chr6 complement(328830..333227) [4398 bp, 1465 aa] {ON}
            some similarities with uniprot|P40477 Saccharomyces
            cerevisiae YIL115C NUP159 Subunit of the nuclear pore
            complex that is found exclusively on the cytoplasmic side
            forms a subcomplex with Nup82p and Nsp1p
          Length = 1465

 Score = 38.5 bits (88), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 38/96 (39%), Gaps = 38/96 (39%)

Query: 1670 ATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTSALPGNNNVFGMKPTFSFTPGSSQPES- 1728
            A G PAFGE       KPA S QP+S  + F  A       FG  PTF   P SSQP S 
Sbjct: 558  AFGQPAFGEPAFG---KPASS-QPTSGQSAFGQA------AFG-PPTFG-KPASSQPTSG 605

Query: 1729 -------------------------RPTFGSTGFNT 1739
                                     +PTFGST F T
Sbjct: 606  QPAFGQPAFGQPVSDQSAPSKPAFGKPTFGSTSFGT 641

>ZYRO0C08030g Chr3 (616547..618682) [2136 bp, 711 aa] {ON} similar to
            uniprot|P34237 Saccharomyces cerevisiae YKL179C
          Length = 711

 Score = 38.1 bits (87), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 93/385 (24%), Positives = 175/385 (45%), Gaps = 57/385 (14%)

Query: 1051 EEELQKHAEVSKIISQLRS-EVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAH 1109
            E++L K+A+   + S+L   E  S  +  ++L A EQ+        +++W  ++T     
Sbjct: 131  EDKLAKYADYDNLKSRLLDLEQNSAVTTAKRLSAKEQEINSTWNERQRNWNQRET----- 185

Query: 1110 IDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPGSSELLISLRRERDILETKLTV 1169
              DL +Q+++++S NK L S++      + EF       SSE      R    +E+K   
Sbjct: 186  --DLTKQLESLTSNNKALESKIS----KQVEFGG----ASSE---ETNRTNGAMESKNYT 232

Query: 1170 SKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESN 1229
               E  LL Q       EL  +  ++ +L++ +   + +  +     EQ +Q+   RE+ 
Sbjct: 233  DSSEYNLLAQ-------ELESSHSRVLQLEKRNEELNGLLAKATSTAEQESQLQS-RETK 284

Query: 1230 VTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWK 1289
            +         + +N+ L + L   +S    L +ELSE  +S++           E   +K
Sbjct: 285  I------KHLESENALLSASLERERSSHTKLQTELSEQLKSLQA----------ETTYYK 328

Query: 1290 ERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNAS 1349
                +I  R +  +  +Y KL+EE+S L++       E+ + N   T      H+K+ +S
Sbjct: 329  TEVSNI--RMKLDNYADYNKLKEELSALRRIEFGADDEDGETNGDDT----NTHDKVESS 382

Query: 1350 KI-AQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLRHELDDA 1408
             I A   L A + +L+   +  EE +   +TKV +LEK +TE        E L ++L+  
Sbjct: 383  LISANKKLQANLADLRVKCSNYEENVTSLETKVNHLEKKVTEL-------EQLNNKLELD 435

Query: 1409 LERCKEIEVKLGETVGSSEGLTSQL 1433
            L++ +E++    +T     G+T Q+
Sbjct: 436  LQKIEEVDAGFNDTNSMISGITRQV 460

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
            complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 92/176 (52%), Gaps = 17/176 (9%)

Query: 1281 LIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDL----NDRFT 1336
            L+DE +  KE+  +     +K + E   K E+E S+  KEL++    N +L    ND  T
Sbjct: 186  LLDEVNIIKEKISNNYTIVKKNNDEADSKFEQEKSSWLKELDSNISSNEELKKKYNDEVT 245

Query: 1337 RLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEE---ILKETQTKVLNLE-KLLTER- 1391
             L    ++ LN        L++++++L+  K K++E   I+ E +  V ++E  L+ +R 
Sbjct: 246  NLTNDLNDNLNPK------LNSQISKLESLKCKLDELKSIMNEKKKHVSDIELNLINKRQ 299

Query: 1392 DSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQVRIF 1447
            D ++AN + L  EL+  +E  +   +++GE +   E +   L+ ++  L+  +R+F
Sbjct: 300  DIKNANEKKL--ELEKYIETTENELIQIGEILIKEETMRRSLHNDLQELRGNIRVF 353

>KNAG0E01860 Chr5 complement(383152..387651) [4500 bp, 1499 aa] {ON}
            Anc_2.253 YIL115C
          Length = 1499

 Score = 37.4 bits (85), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 38/76 (50%), Gaps = 9/76 (11%)

Query: 1666 TENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTSALPGNNNVFGMKPTFSFTPGSSQ 1725
            T+N +T T AFG        KPAF   P+S +  F S+  G+   FG   T +    SS 
Sbjct: 542  TDNNSTETAAFG--------KPAFGAAPASTAPAFGSSTFGSG-AFGGNSTSNDNTSSST 592

Query: 1726 PESRPTFGSTGFNTTA 1741
               +P FGSTGF + A
Sbjct: 593  AFGKPAFGSTGFASVA 608

>TBLA0D04030 Chr4 complement(1000884..1005638) [4755 bp, 1584 aa]
           {ON} Anc_8.287 YDR127W
          Length = 1584

 Score = 36.6 bits (83), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 49/109 (44%), Gaps = 7/109 (6%)

Query: 516 IIENENPSNESDSQSIITERLVEFKDIATLQERNTEL-LKTARTLADRLEEEEKNSNIRI 574
           I+ N   +  SD   I       F DI ++ E   +L L++ +  AD +  +E+ S++R 
Sbjct: 215 IVNNSKMTKNSDGDDI------TFTDINSMLEHTYKLVLESVKVKADVVSSDERESSLRN 268

Query: 575 DSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQS 623
                 TI  A EAI+T Q  + E  S     E E   Y  ILS T  S
Sbjct: 269 LLNFGHTIGHAYEAILTPQALHGECVSIGMVKEAELSRYLGILSPTQVS 317

>Skud_4.457 Chr4 complement(810243..811535) [1293 bp, 430 aa] {ON}
            YDR192C (REAL)
          Length = 430

 Score = 36.2 bits (82), Expect = 0.79,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 35/89 (39%), Gaps = 17/89 (19%)

Query: 1670 ATGTPAFGEKVL------KLSDKPAFSFQPSSKSNPFTSALPGNNNV-----FGM----- 1713
            A G P+FG   +           P F    S+  N   SA  G NN      FG      
Sbjct: 36   AFGQPSFGASTMAGGAGSSTFGVPQFGASTSNTGNATASAFNGINNAAQSSAFGTPAFGS 95

Query: 1714 -KPTFSFTPGSSQPESRPTFGSTGFNTTA 1741
              P  +  P +S     P+FGS+GF +TA
Sbjct: 96   SAPANTNAPSTSSAFGAPSFGSSGFGSTA 124

>CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} similar to
            uniprot|P32380 Saccharomyces cerevisiae YDR356w NUF1
          Length = 872

 Score = 36.2 bits (82), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 121/272 (44%), Gaps = 35/272 (12%)

Query: 847  FQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASY---------K 897
              EK  E  S   ++ +E+ T  +T+   +  +++ K+K+  ++ ++AS          K
Sbjct: 260  LDEKKQEFESSTARLNEEIHTLKSTIDDKDATISEFKRKLGNAEDQLASIDDQNGNQNQK 319

Query: 898  TLNDAGNGETTQGQLRKDL---EKTMI-----------ELKHAYSQNEEFKQISSTAEET 943
             L+D    E     L++D+   E  ++           +LK + S+  E ++     +  
Sbjct: 320  LLHDLKEREDAIDGLKEDIIEKENAIVHYKEEIQDKQNQLKESESKYAEVQKEFEDFKRE 379

Query: 944  LKNLSNEFEERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNE 1003
            LK  + EFE+  ++     ++   EK+QLE+ V NL+  I+ L  ++ L    ++ E + 
Sbjct: 380  LKKQTFEFEDGKKSTSRQLQELSVEKIQLEKQVCNLRGQIEKLEQQHRL----TQSENDG 435

Query: 1004 ILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLE---QQTAYANIAQKNYEEELQKHAEV 1060
            +  KL  +ES    L   K   + K+  L  DLE   +    AN   K    E+ K+A  
Sbjct: 436  LRTKLKHIES---DLKNEKSRTEVKIKDLTSDLEDARKNLGEANNTIKELHHEIIKNATK 492

Query: 1061 SKIISQLRSEVQSGRSEIQQLKASEQQAKEVL 1092
            SK   QL  EV     EI QLK   Q+  E L
Sbjct: 493  SK--DQLSEEVVEKDKEIDQLKHRVQRLDEEL 522

>Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON}
            similar to Ashbya gossypii AER045C
          Length = 1366

 Score = 36.2 bits (82), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 82/163 (50%), Gaps = 14/163 (8%)

Query: 30   ELKPVLADHVLSDCLVNKLQE-FNNLQSN-------NLRLHATVDELKALCTSKVDSLKK 81
            ++KP  + H   + L+ KL E   +L +N       N  L   +DE ++  + ++ SLK 
Sbjct: 900  DIKPRFSSH---EMLIPKLTEKLKSLATNCKELEIKNNSLKKQLDEARSTSSLEIASLKS 956

Query: 82   ETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSNKQE 141
            E E L+ E     Q+ N LE Q+ ++ +E  LA  ++E+ K +L    ++ + L  N + 
Sbjct: 957  EIETLVAEKSILDQKSNNLEVQLGKIQRELELAKVEVEDSKTKLS---DENSRLHENLKN 1013

Query: 142  VVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTL 184
            +   L    SE +  K++S+ L  D   +  ++ + QN+ ++L
Sbjct: 1014 LKDQLSSITSERDQQKLKSESLAGDLTKVSAEIKKLQNDYESL 1056

>ADL248C Chr4 complement(262457..267043) [4587 bp, 1528 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL115C
            (NUP159)
          Length = 1528

 Score = 35.8 bits (81), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 44/97 (45%), Gaps = 26/97 (26%)

Query: 1665 RTENMATGTPAFGEKVLKLSDKPAFSFQPSSKS-------NPFTSALPGNNNVFGMKPTF 1717
            ++E  A G PAFG        KPAF   P +KS        PF + LP +++ FG     
Sbjct: 674  KSEESAFGKPAFGANAF---GKPAFGESPFNKSIPGSPFAKPFGAGLPASSSPFG---NL 727

Query: 1718 SFTPG-----------SSQPESRPT--FGSTGFNTTA 1741
            S TP            S+ PE++    FG T F+++A
Sbjct: 728  SSTPFGKISSSPFGQLSASPEAKAVSPFGKTAFSSSA 764

>ZYRO0A01694g Chr1 complement(137498..141925) [4428 bp, 1475 aa] {ON}
            similar to uniprot|P40477 Saccharomyces cerevisiae
            YIL115C NUP159 Subunit of the nuclear pore complex that
            is found exclusively on the cytoplasmic side forms a
            subcomplex with Nup82p and Nsp1p required for mRNA export
          Length = 1475

 Score = 35.4 bits (80), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 40/95 (42%), Gaps = 21/95 (22%)

Query: 1662 DESRTENMATGTPAFGEKVLKLS--DKPAFSFQPSSKSNPF------TSAL--------P 1705
            D S +   + G P+FG+     S   KPAF  Q SS  +PF      T A         P
Sbjct: 467  DSSTSNQPSFGKPSFGQSSFGQSSFGKPAFG-QSSSDQSPFGQSSFGTPAFGQSSSGQSP 525

Query: 1706 GNNNVFGMKPTFSFTPGSSQPESRPTFGSTGFNTT 1740
               + FG KP F     SS   S P FG T F T+
Sbjct: 526  FGQSAFG-KPAFG---QSSSESSAPAFGKTSFGTS 556

>CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} similar
            to uniprot|Q08581 Saccharomyces cerevisiae YOR195w
            involved in control of spindle dynamics
          Length = 816

 Score = 35.0 bits (79), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 81/173 (46%), Gaps = 18/173 (10%)

Query: 1290 ERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAK-SKENTDLNDRFTRLKKQAHE---K 1345
            +RSHD +      D ++   +  EI    +EL  +  K NTDLND   +L+  ++E    
Sbjct: 274  QRSHDTVNSEYNTDIDKAHSVSLEILRRNEELANEVHKTNTDLNDCLMKLENLSYEFQKH 333

Query: 1346 LNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSE----SANNEDL 1401
               S + Q  L+ +  EL+ +  K+  + +E  T V NLEK L E+  E    + N   L
Sbjct: 334  KEQSLVDQERLTEKTEELEDSLEKLTVLREELSTNVANLEKQLHEKQDEIKMLNQNQSIL 393

Query: 1402 RHELDDALE---RCKEIEV-------KLGETVGSSEGLTSQLNEEINSLKEQV 1444
            +H  D  LE   + +E  +       K  E + + +G   +L  EI +LK Q+
Sbjct: 394  QHNFDKKLEDEQKAREEYIIIQNEKDKAIEDLRNCKGKVEELESEIITLKTQI 446

>KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {ON}
            Anc_5.414 YDR356W
          Length = 905

 Score = 35.0 bits (79), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 94/204 (46%), Gaps = 32/204 (15%)

Query: 824  TEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLK 883
            ++I    N++KA+E+ K    +  +++++E   +  K++++     + V +L+ ++ND  
Sbjct: 608  SDIKDLQNKLKATENEKLTLLERHEKEVEEWRHELDKLQED----ASQVVKLKEDLNDKS 663

Query: 884  KKIEESDSRIASY-----KTLNDAGNGETTQGQLRKDLEKTMIELKHAY-----SQNEEF 933
             KIEE  + +  +     K  ND        G+LRK + ++   +   Y      +NE+F
Sbjct: 664  TKIEELHASLIKHQKENSKIRNDMQKLTAQYGELRKSMNESQKLIDEYYELKSTRRNEDF 723

Query: 934  KQISSTAEETLKNLSNEFEERTEALKSNAEKYLAEKVQLEQCVSNLKKN----------- 982
            KQ     EE L  L   +    + LK   +    E  +LEQ + N K+N           
Sbjct: 724  KQ-----EEKLNELERNYNSNLQNLKKYVKSLENENTELEQLLKNFKQNDIRNSIETKMS 778

Query: 983  --IDFLNNEYALQKNRSEEEKNEI 1004
              +++ ++ Y L+ NR  +  N++
Sbjct: 779  ETMEYRSDYYKLKYNREVKRNNDL 802

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 35.0 bits (79), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 65/130 (50%), Gaps = 9/130 (6%)

Query: 780 RNSLNLMVTQLQTLQSEREN--LLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASE 837
           + +L+L++  ++ +++  +    L ES+ +  A   +    T EL+TEI  K++EIK   
Sbjct: 402 KKTLDLLIDNMKVIENNYDQKITLLESELNKLADTVKKAKVTEELETEIVEKNDEIKKLR 461

Query: 838 DAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVND-------LKKKIEESD 890
           +     T+ F     + S D  KI   L  K  +VAQL+LE+         LK   E  D
Sbjct: 462 EQLETMTQLFNNIDPKESEDTKKIIQTLMEKCESVAQLQLELEGQLHENSILKGDGEIKD 521

Query: 891 SRIASYKTLN 900
           ++I + +T+N
Sbjct: 522 AKIRTLETMN 531

>ZYRO0F10714g Chr6 (871970..874096) [2127 bp, 708 aa] {ON} weakly
            similar to uniprot|Q08581 Saccharomyces cerevisiae
            YOR195W SLK19 Kinetochore-associated protein required for
            normal segregation of chromosomes in meiosis and mitosis
            component of the FEAR regulatory network which promotes
            Cdc14p release from the nucleolus during anaphase
            potential Cdc28p substrate
          Length = 708

 Score = 34.7 bits (78), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 97/210 (46%), Gaps = 39/210 (18%)

Query: 1242 KNSDLQSELNHLQSKILPLNSELSECRQSI------------------EEKDQRIILLID 1283
            +N DL ++L+HL   I   N  +S C  ++                  E++   +  +I 
Sbjct: 205  RNEDLVTQLHHLNRSI---NEVISSCDSTVGKYRRQIDSLRQDYESKLEDRMSEMASVIQ 261

Query: 1284 EADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAH 1343
            E++ +KER  +I RR      +E + + +  S L+ + E  + E            ++  
Sbjct: 262  ESNTYKER-FNIARRRVSETRDEIKMINQNQSILRNKYEGATAE-----------LEECR 309

Query: 1344 EKLNASKIAQANLSAEVNELQGTK-TKMEEILKETQTKVLNLEKL---LTERDSESANNE 1399
             KLN  +   + L +E +E  G K +++E + +E   +  NLE     + +  +ES    
Sbjct: 310  RKLNELEEENSKLKSESSE-NGIKFSRLENMYQEALRRTQNLETANQNVLDAQAESDRKL 368

Query: 1400 D-LRHELDDALERCKEIEVKLGETVGSSEG 1428
            D L HELDD  E C++++ +L ET+ + EG
Sbjct: 369  DALSHELDDRSEECQKLKAQLEETLAAQEG 398

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 34.3 bits (77), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 9/51 (17%)

Query: 1628 LERKISKLESQLNSSNNPTPEKAAATSVGLP---------TKIDESRTENM 1669
            LER +SK+ +  ++S + TP+ A   SVG P         T ID+ R+ NM
Sbjct: 112  LERSLSKVHASTSNSTSNTPDNAGIGSVGAPSPATNTTLHTPIDDKRSSNM 162

>Kwal_23.3864 s23 (465097..466368) [1272 bp, 423 aa] {ON} YBR130C
           (SHE3) - involved in cell polarity [contig 255] FULL
          Length = 423

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 86/167 (51%), Gaps = 25/167 (14%)

Query: 133 NVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDK 192
            ++ S K+  V+ LE+++++L+ S    +E   DNKN+RQQL  +      L+       
Sbjct: 109 GLMLSRKERRVRDLEQQLAQLKNSY---EEAAVDNKNMRQQLQSSDQRESVLE------- 158

Query: 193 SELEIVKQQVGML----TKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDY 248
           ++ + ++ Q   L    ++  E  E+E+ S  + L  ++Q+N+  + KS+Q +  + N+ 
Sbjct: 159 NQFQQLQVQYDALLDGQSRYREKYEQEIQSLKDALEHFKQDNEAYVTKSIQNI--VTNNA 216

Query: 249 QLEKSSREFLLKK------NQEISQDLQNKLYEIKKLSDELNTEKQE 289
            L+   +++ LK       NQE  Q+L     +++ ++ +LN  K E
Sbjct: 217 ALQDRVKQYSLKYKNLESLNQERMQELS---LDVESMATKLNLSKWE 260

>Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W
            (REAL)
          Length = 1795

 Score = 34.3 bits (77), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 94/192 (48%), Gaps = 21/192 (10%)

Query: 40   LSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDSLKKETERLIRENDTEKQRRNR 99
            L+D L +   ++ N+QS N  L   V+E K+  T ++ +L+ E + L R+ +     R  
Sbjct: 961  LTDKLKSLANDYKNMQSENESLIKAVEETKSEKTMQLSALQDEIDSLSRQKENFLTERES 1020

Query: 100  LEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVE 159
            LE+ + QL +     +  +E  K E    I + N  K N +  + LL E++     +K E
Sbjct: 1021 LEQSIKQLRE----TISAIEKAKEE---AISRFNSSKDNYESQLGLLREQLENTRNAKDE 1073

Query: 160  S----QELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSE-----LEIVKQQVGMLTKSNE 210
            S     EL+ ++KNL  +L ET   ++    +GL  K E     L+++K+    L +   
Sbjct: 1074 SVNRISELIQNSKNLEAEL-ETCRHLK----DGLEAKIETFEKALDVIKKSEQHLKEEKM 1128

Query: 211  WLEKEVTSKTEQ 222
             LEKEVT   +Q
Sbjct: 1129 QLEKEVTDTKQQ 1140

>NDAI0B03720 Chr2 (930486..934910) [4425 bp, 1474 aa] {ON} Anc_2.253
            YIL115C
          Length = 1474

 Score = 34.3 bits (77), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 46/96 (47%), Gaps = 16/96 (16%)

Query: 1653 TSVGLPTKIDESRTENMATGTPAFGEKVL----KLSDKPAFSFQPSSKSNPFTSALPGNN 1708
            T++G PT    S T+ ++T  PAFG        K  +KPA  F  ++  NPFTSA     
Sbjct: 488  TTIGKPTFSFGSETKPIST-PPAFGTPSFTSASKSENKPASLFGNTTIENPFTSA-DKTQ 545

Query: 1709 NVFG-------MKPTFSFTPGSSQPESRPTFGSTGF 1737
            + FG        K  F+F    +   + P+FG++ F
Sbjct: 546  SPFGQTNKDTETKQPFAF---GTNTATTPSFGTSAF 578

>TPHA0F01720 Chr6 complement(394469..396358) [1890 bp, 629 aa] {ON}
           Anc_2.174 YNL103W
          Length = 629

 Score = 33.9 bits (76), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 413 SFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEI 472
           SF   L+    VINSL +R  T+E ++  +++++ +   EK++  +  E+ T  I    I
Sbjct: 356 SFFPRLKVPTGVINSLTQRGLTME-QIDALSVIIAYHQQEKKKNPQNGETVTQIIDSQNI 414

Query: 473 NTHTLIRQRSD 483
           N   L+   SD
Sbjct: 415 NADYLVTLLSD 425

>TDEL0A07650 Chr1 complement(1331830..1334328) [2499 bp, 832 aa] {ON}
            Anc_6.350 YCR077C
          Length = 832

 Score = 33.9 bits (76), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 1/91 (1%)

Query: 954  RTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEY-ALQKNRSEEEKNEILKKLVSLE 1012
            R   L +  +K    + QL Q V++   N DF    Y  +Q+     E N+ L     LE
Sbjct: 316  RHSGLMTPRDKDFITRYQLSQIVTDDPYNEDFYFQVYKIIQRGGVVGESNKDLIARAYLE 375

Query: 1013 SSEHSLGQVKKEYDQKLYQLQKDLEQQTAYA 1043
             S H LG   K  D  L ++Q  +E+    A
Sbjct: 376  HSGHRLGGRYKRADVALQRMQSQVEKAVTVA 406

>TDEL0B07280 Chr2 complement(1282265..1283443) [1179 bp, 392 aa] {ON}
            Anc_2.634 YKL080W
          Length = 392

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 1052 EELQKH-----AEVSKIISQLRSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTEL 1106
            EEL KH       ++KI+  L    ++G +  + L  +     E LEN    W  +K +L
Sbjct: 66   EELAKHDTQIGGSIAKIVEILGGLSEAGTNAYKTLPINNVPVPEYLENFH--WQTRKFKL 123

Query: 1107 DAHIDDLKRQVDNISSQ 1123
            D  I+DL   + N ++Q
Sbjct: 124  DKSINDLMNLISNEAAQ 140

>KAFR0C04270 Chr3 complement(846716..847480) [765 bp, 254 aa] {ON}
           Anc_1.335 YJL048C
          Length = 254

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 51/99 (51%), Gaps = 7/99 (7%)

Query: 116 GQMENVKFELQNT---IEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQ 172
            Q  N++ +L N+   + + +++++N  ++ K L  KISE     ++  + +  +   R+
Sbjct: 148 AQFCNIRIKLPNSSLIVHEFDLIENNLNDIRKFLTSKISE---DNIDLNQFIFIHLRPRK 204

Query: 173 QLMETQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEW 211
              +  +E++TLK  G+ DK+ L +VK  +     S  W
Sbjct: 205 DFTKL-DEIKTLKSVGIDDKTTLYLVKHSIARRRLSFHW 242

>NCAS0A11030 Chr1 (2195054..2198188) [3135 bp, 1044 aa] {ON} Anc_3.340
            YPR055W
          Length = 1044

 Score = 33.5 bits (75), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 84/174 (48%), Gaps = 19/174 (10%)

Query: 916  LEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYLAEKVQLEQC 975
            L+ T + L H Y   +EF Q+ S     L+++ NE  +   A  ++  K +A   + ++ 
Sbjct: 69   LDDTSVGLGHRY---QEFNQLKSQIGAHLQDVVNEHSQVFNANVASYGKTVACITEAQEN 125

Query: 976  VSNLKKNIDFLNNEYALQKNRSEE--EKNEILKKLVSLESSEHSLGQVKKEYDQKL---- 1029
             S+LK+N++ +N    +QK    E  E N    + +S+ SS   L Q+ ++ +  +    
Sbjct: 126  TSHLKRNLNLVNENITMQKGSLMELNESNMKFSRTISVLSSVEELLQLPEKVEDHIRNEE 185

Query: 1030 YQ-LQKDLEQQTAYANIAQ-KNYEE--------ELQKHAEVSKIISQLRSEVQS 1073
            Y+ +QK LE+     N  + KN +         ELQ+H   + +I +L + + S
Sbjct: 186  YKDVQKSLERGFQLLNNEELKNLKPLKPIRQQLELQEHVLFNNLIEELHNIIYS 239

>TBLA0F04170 Chr6 complement(1028080..1030887) [2808 bp, 935 aa] {ON}
            Anc_6.350 YCR077C
          Length = 935

 Score = 33.1 bits (74), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 92/214 (42%), Gaps = 29/214 (13%)

Query: 928  SQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYLAE-------------KVQLEQ 974
            S N+  K  SS   +  + L+ E ++R +A  +  EK L               + QL Q
Sbjct: 357  SPNDSLKSTSSRGSQRREPLTAEEQKRLQARHAKVEKILKHSGLMTPRDKDFITRYQLSQ 416

Query: 975  CVSNLKKNIDFLNNEY-ALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQ 1033
             V+    N DF    Y  +Q+     E N+ L     LE S H LG   K  D  L ++Q
Sbjct: 417  IVTEDPYNEDFYFQVYKIIQRGGVIGESNKDLIARAYLEHSGHRLGGRYKRADVALQRMQ 476

Query: 1034 KDLEQQTAYAN-IAQKNYEEELQKHAEVSK--IISQLRSEVQSGRSEIQQLKASEQQAKE 1090
              +E+    A    QKN     + H   ++  ++ ++ + + S ++  +QL+       +
Sbjct: 477  NQVEKAVTVAKERPQKN-----KDHGSAAREGVLGRISTSMNS-KAPRRQLQIPSHIVND 530

Query: 1091 ---VLENGEKSWYNQKTELDAHIDDLKRQVDNIS 1121
               +++  EKS  N  +  D  +D++ R +DN+ 
Sbjct: 531  DTVIIDETEKS-SNHSSTPD--LDEVTRSLDNVG 561

>CAGL0M07029g Chr13 complement(713658..716174) [2517 bp, 838 aa] {ON}
            similar to uniprot|P25644 Saccharomyces cerevisiae
            YCR077c PAT1 topoisomerase II-associated protein
          Length = 838

 Score = 33.1 bits (74), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 57/134 (42%), Gaps = 2/134 (1%)

Query: 957  ALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYAL-QKNRSEEEKNEILKKLVSLESSE 1015
             L +  +K    + QL Q V+    N DF    Y L Q+     E N+ L     LE S 
Sbjct: 328  GLMTPRDKDFITRYQLSQIVTEDPYNEDFYFQVYKLIQRGGVAAESNKGLIARAYLEHSG 387

Query: 1016 HSLGQVKKEYDQKLYQLQKDLEQQTAYAN-IAQKNYEEELQKHAEVSKIISQLRSEVQSG 1074
            H LG   K  D  L ++Q  +E+    A    QKN + +  +   + KI + + S+    
Sbjct: 388  HRLGGRYKRADIALQRMQSQVEKAVTVAKERPQKNKDVDSVREGVLGKISTTMNSKAPRR 447

Query: 1075 RSEIQQLKASEQQA 1088
            +  I   K++E  A
Sbjct: 448  QLAIPSHKSNEDIA 461

>SAKL0A01034g Chr1 (105182..107737) [2556 bp, 851 aa] {ON} similar to
            uniprot|P25644 Saccharomyces cerevisiae YCR077C PAT1
            Topoisomerase II-associated deadenylation- dependent
            mRNA-decapping factor also required for faithful
            chromosome transmission maintenance of rDNA locus
            stability and protection of mRNA 3'-UTRs from trimming
            functionally linked to Pab1p
          Length = 851

 Score = 33.1 bits (74), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 1/91 (1%)

Query: 954  RTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEY-ALQKNRSEEEKNEILKKLVSLE 1012
            R   + +  +K    + QL Q V++   N DF    Y  +Q+     E N+ L     LE
Sbjct: 335  RHSGVMTPRDKDFITRYQLSQIVTDDPYNEDFYFQVYKIIQRGGVVGESNKGLIARAYLE 394

Query: 1013 SSEHSLGQVKKEYDQKLYQLQKDLEQQTAYA 1043
             S H LG   K  D  L ++Q  +E+    A
Sbjct: 395  HSGHRLGGRYKRADVALQRMQSQVEKAVTVA 425

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.122    0.310 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 181,746,172
Number of extensions: 8548342
Number of successful extensions: 82840
Number of sequences better than 10.0: 4054
Number of HSP's gapped: 68084
Number of HSP's successfully gapped: 10329
Length of query: 1810
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1686
Effective length of database: 39,262,815
Effective search space: 66197106090
Effective search space used: 66197106090
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 73 (32.7 bits)