Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B021805.437ON41840621920.0
KAFR0E038205.437ON3963938511e-110
YDR370C5.437ON4423967481e-94
NDAI0B056905.437ON4233867356e-93
ZYRO0F10098g5.437ON3733677316e-93
Kpol_1016.45.437ON4134037294e-92
Skud_4.6395.437ON4424087308e-92
Suva_2.5425.437ON4424387169e-90
Smik_4.6365.437ON4463807081e-88
NCAS0F034005.437ON4154236894e-86
SAKL0G02596g5.437ON4003726241e-76
TBLA0A028005.437ON4534335767e-69
TPHA0J026005.437ON4413135731e-68
KNAG0C048905.437ON4053845535e-66
KLTH0F15994g5.437ON3903605464e-65
CAGL0A02860g5.437ON4023445222e-61
Kwal_55.214155.437ON3893225046e-59
KLLA0E02245g5.437ON4033615056e-59
AER404C5.437ON3863814662e-53
KLLA0E12893g3.570ON3843091444e-09
Skud_7.213.570ON389127960.002
Suva_7.153.570ON389127940.005
NDAI0I032603.570ON37744890.019
YGL246C (RAI1)3.570ON387128880.023
Smik_7.153.570ON387126860.049
NCAS0E002403.570ON380126820.15
SAKL0F00726g3.570ON383126800.22
Skud_7.5745.85ON987122800.29
CAGL0C01925g3.570ON40075770.51
KLTH0G00660g3.570ON38373741.2
Kwal_47.192763.570ON386139731.8
KNAG0G018908.237ON77365722.9
AFR262CsingletonON775253713.2
Suva_5.3058.237ON77762713.7
Skud_5.3108.237ON77562713.8
Smik_5.3438.237ON77562713.9
YER171W (RAD3)8.237ON77862714.0
Kwal_23.4609singletonON328167704.1
Kwal_33.14289singletonON328167704.1
Kwal_47.19306singletonON328167704.1
TPHA0A019208.237ON773124704.4
ZYRO0E09592g3.570ON380105694.9
Smik_12.2948.415ON70347695.9
KAFR0B025708.237ON77958696.2
Kpol_414.14.45ON154854696.9
NDAI0B022708.237ON77165687.0
TPHA0D037406.311ON231777688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02180
         (418 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   848   0.0  
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   332   e-110
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   292   1e-94
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   287   6e-93
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   286   6e-93
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   285   4e-92
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   285   8e-92
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   280   9e-90
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   277   1e-88
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   270   4e-86
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   244   1e-76
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   226   7e-69
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   225   1e-68
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   217   5e-66
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   214   4e-65
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   205   2e-61
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   198   6e-59
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   199   6e-59
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   184   2e-53
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    60   4e-09
Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON} Y...    42   0.002
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    41   0.005
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     39   0.019
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    39   0.023
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    38   0.049
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    36   0.15 
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    35   0.22 
Skud_7.574 Chr7 complement(945547..948510) [2964 bp, 987 aa] {ON...    35   0.29 
CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {...    34   0.51 
KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON...    33   1.2  
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    33   1.8  
KNAG0G01890 Chr7 (421365..423686) [2322 bp, 773 aa] {ON} Anc_8.2...    32   2.9  
AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON} S...    32   3.2  
Suva_5.305 Chr5 (494912..497245) [2334 bp, 777 aa] {ON} YER171W ...    32   3.7  
Skud_5.310 Chr5 (512188..514515) [2328 bp, 775 aa] {ON} YER171W ...    32   3.8  
Smik_5.343 Chr5 (526697..529024) [2328 bp, 775 aa] {ON} YER171W ...    32   3.9  
YER171W Chr5 (527082..529418) [2337 bp, 778 aa] {ON}  RAD35' to ...    32   4.0  
Kwal_23.4609 s23 complement(785074..786060) [987 bp, 328 aa] {ON...    32   4.1  
Kwal_33.14289 s33 (604076..605062) [987 bp, 328 aa] {ON} [contig...    32   4.1  
Kwal_47.19306 s47 (1181820..1182806) [987 bp, 328 aa] {ON} [cont...    32   4.1  
TPHA0A01920 Chr1 complement(387645..389966) [2322 bp, 773 aa] {O...    32   4.4  
ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} simila...    31   4.9  
Smik_12.294 Chr12 complement(548629..550740) [2112 bp, 703 aa] {...    31   5.9  
KAFR0B02570 Chr2 (511567..513906) [2340 bp, 779 aa] {ON} Anc_8.2...    31   6.2  
Kpol_414.1 s414 (1989..6635) [4647 bp, 1548 aa] {ON} (1989..6635...    31   6.9  
NDAI0B02270 Chr2 (564974..567289) [2316 bp, 771 aa] {ON} Anc_8.2...    31   7.0  
TPHA0D03740 Chr4 complement(784729..791682) [6954 bp, 2317 aa] {...    31   8.9  

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/406 (100%), Positives = 406/406 (100%)

Query: 13  LEVHLLGNKLNSLGLQDSPHGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFE 72
           LEVHLLGNKLNSLGLQDSPHGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFE
Sbjct: 13  LEVHLLGNKLNSLGLQDSPHGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFE 72

Query: 73  GCEEVATYQNGYLFMKDSSKKPLYPCLQMFAALIAENRGPKNKLPYIGCDLYQGHERYKP 132
           GCEEVATYQNGYLFMKDSSKKPLYPCLQMFAALIAENRGPKNKLPYIGCDLYQGHERYKP
Sbjct: 73  GCEEVATYQNGYLFMKDSSKKPLYPCLQMFAALIAENRGPKNKLPYIGCDLYQGHERYKP 132

Query: 133 LPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSIICT 192
           LPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSIICT
Sbjct: 133 LPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSIICT 192

Query: 193 NIGKGKLIFSGDRSKEERNGLNSKNSMTRKICYSGFALEDKLTTSHDERMGPFYSIVEGK 252
           NIGKGKLIFSGDRSKEERNGLNSKNSMTRKICYSGFALEDKLTTSHDERMGPFYSIVEGK
Sbjct: 193 NIGKGKLIFSGDRSKEERNGLNSKNSMTRKICYSGFALEDKLTTSHDERMGPFYSIVEGK 252

Query: 253 INERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLII 312
           INERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLII
Sbjct: 253 INERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLII 312

Query: 313 GTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVM 372
           GTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVM
Sbjct: 313 GTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVM 372

Query: 373 KNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLTKVPRHVQIPRAFR 418
           KNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLTKVPRHVQIPRAFR
Sbjct: 373 KNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLTKVPRHVQIPRAFR 418

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  332 bits (851), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 172/393 (43%), Positives = 244/393 (62%), Gaps = 18/393 (4%)

Query: 32  HGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYLFMKDSS 91
           HG S    K Q  K  +  PF +F+H  + YFP+  A+FF+   EVATY +G ++  + +
Sbjct: 14  HGLSLGSGKTQ--KTPIVSPFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNET 71

Query: 92  KKPLYPCLQMFAALIAENRGP----KNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEY 147
            + + P L    + IA+        K K+ YIG DLYQG E ++ +   ELDS++ CF Y
Sbjct: 72  SQDILPLLNKDISKIAQGVSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAY 131

Query: 148 IKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSII-CTNIGKGKLIFSGDRS 206
           IKKWE     K   + K TI+S RHH+V+L+M++F   + +I+  T +G G L FS D S
Sbjct: 132 IKKWEAHHHCKYTENKKYTIVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTS 191

Query: 207 K--EERNGLNSKNSMTRKICYSGFALEDKLTTSHDERMGPFYSIVEGKINERLSLLLRCE 264
                  G+ +KN   +KICYSGFALED LT S  E   P +SI E ++++ ++LLLRCE
Sbjct: 192 DPMTMNEGIFTKNKNLKKICYSGFALEDLLTKSQKE---PLFSITENQLDDNITLLLRCE 248

Query: 265 MDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLED 324
           MDAYN +   YTELKC+  L +    HR+KLLKTW+Q G++P SDL+ G R    G+L D
Sbjct: 249 MDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLD 308

Query: 325 LTWYSRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYP 384
           + WYSR  LY++FNN ++  N K LNFNANIAVEW  HCI++IC+L+  N     D P  
Sbjct: 309 IEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDN--LQGDAP-- 364

Query: 385 KYESFKVIVDKSHNIIVKKLTKVPRHVQIPRAF 417
             ++F++ VD   NI ++ L+K+P++ QIPR +
Sbjct: 365 --QAFQIKVDTFRNISIRNLSKIPQNAQIPRQY 395

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  292 bits (748), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 163/396 (41%), Positives = 240/396 (60%), Gaps = 21/396 (5%)

Query: 34  PSKQRRKQQSGK-RTVCIPFSKFEHSDL-DYFPDDTADFFEGCEEVATYQNGYLFMKDSS 91
           PS+QR   +  + + +CIP++ F H+ + ++      D F   +EVA + NG  +     
Sbjct: 49  PSQQRDNYRKRRPKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYT--IL 106

Query: 92  KKPLYPCLQMFAALIAEN---RGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYI 148
           +K L P L+   A + E+      K K+PY+G DL+   + + P+  SELDS   CF YI
Sbjct: 107 RKDLIPNLKESIAELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYI 166

Query: 149 KKWERRKISKSFNSGK-VTIISPRHHVVDLVMALFH--DDEVSIICTNIGKGKLIFSGDR 205
           + W      K F  GK  T+++ RHH+VDL M LF+  + + S+I T +G G L F  + 
Sbjct: 167 ENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNV 226

Query: 206 SKEE---RNGLNSKNSMTRKICYSGFALEDKLTTSHD--ERMG---PFYSIVEGKINERL 257
            K+    + G+ S +   +KICYSGF  E+ +T +    +  G   P +S+VE K++E +
Sbjct: 227 KKDSQMSKEGIYSNDPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEI 286

Query: 258 SLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDT 317
            LL+RCEMDA+NP+    TELKCF  L++ ++ HRRKLLKTWVQ GL+P+SD++IG RD+
Sbjct: 287 GLLIRCEMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDS 346

Query: 318 QVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSLS 377
             GQL D+ WYSR  L KKFN+P +  N K LN+NA IAVEWC +CIE+IC LV  N   
Sbjct: 347 HSGQLLDIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEAN--- 403

Query: 378 SPDDPYPKYESFKVIVDKSHNIIVKKLTKVPRHVQI 413
             D    K ESF++ +D ++ I++ KL   PR+V++
Sbjct: 404 ISDYSSTKPESFEIGIDTNNAIVITKLKTTPRNVEL 439

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  287 bits (735), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 154/386 (39%), Positives = 228/386 (59%), Gaps = 27/386 (6%)

Query: 50  IPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYLFMKDSSKKPLYPCLQMFAALIAE- 108
           IPF +F+H  +  +P   + FFE  ++VA Y N  L+  D +   L P L+   A +A  
Sbjct: 39  IPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTN--LIPQLEPAIAKLANP 96

Query: 109 ----NRGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGK 164
               N     KLPY+G DLY G+E + P+   ELDS   CF+YI+ WE +         K
Sbjct: 97  SCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNK 156

Query: 165 VTIISPRHHVVDLVMALFHDDEVSIICTNI-----GKGKLIFSGDRSKEERNGLNSKNSM 219
            TI+S RHH+V++ M +F+  ++     N+       G L+FS D +K++  G+ SK+ +
Sbjct: 157 FTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKDGV 216

Query: 220 TRKICYSGFALEDKLTTSHDERMG------------PFYSIVEGKINERLSLLLRCEMDA 267
            RKI YSGFALED LTT+ ++                 ++I+E K+N+ +SLLLRCEMD+
Sbjct: 217 VRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMDS 276

Query: 268 YNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTW 327
           YNP+   +TE+KCF +L + +  HRRKLLK WVQ G+IP+SD++IG RD   G+L D+ W
Sbjct: 277 YNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEW 336

Query: 328 YSRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYE 387
           +SR +LY++ NN ++      LN+NA IAV+W  HCI+SIC LV +   S         +
Sbjct: 337 FSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDE---SIDKTRLNTSQ 393

Query: 388 SFKVIVDKSHNIIVKKLTKVPRHVQI 413
           SF++ ++ S  I +KKL  VP +V +
Sbjct: 394 SFQIRINASRAIQIKKLKSVPNNVTM 419

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  286 bits (731), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 145/367 (39%), Positives = 228/367 (62%), Gaps = 13/367 (3%)

Query: 50  IPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYLFMKDSSKKPLYPCLQMFAALIAEN 109
           +PF++F+HS    FP +  + F   +E + Y  G L   DS    +   L+     ++ +
Sbjct: 16  VPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQL--HDSISDSI--GLKSPGNKLSHD 71

Query: 110 RGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIIS 169
           R   NK  ++G DLYQG E + PL    LDSS  C+++I KWE    +         +IS
Sbjct: 72  RSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFVVIS 131

Query: 170 PRHHVVDLVMALFHDDEVSIICTNIGKGKLIFSGDRSKEERNGLNSKNS-MTRKICYSGF 228
           PRH++V+L M LF   + SI+CT++G GK++ S   + ++ +   S+N+ MT+KI +SG+
Sbjct: 132 PRHYLVELTMQLFQQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNTTMTKKILHSGY 191

Query: 229 ALEDKLTTSHDERMGPFYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQD 288
           ALED LT        PF++I+E +++  +SL+LRCE+D+YN +   +TELKC+  LN+ +
Sbjct: 192 ALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYAPLNMHN 251

Query: 289 TAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKY 348
             HR KLLKTW+Q+ + P  DL+IG R+T +G L+DL +++   LY+K N+ ++ ++ K 
Sbjct: 252 AYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKR 311

Query: 349 LNFNANIAVEWCFHCIESICDLVMKN-SLSSPDDPYPKYESFKVIVDKSHNIIVKKLTKV 407
            N+NA++AV+WC HCI SIC LV +N   SSP       + FK+ +D+SH I ++KL  V
Sbjct: 312 FNYNADLAVQWCQHCIRSICKLVGENVDRSSP-------QCFKLTIDESHKIQLEKLKHV 364

Query: 408 PRHVQIP 414
           P HV++P
Sbjct: 365 PAHVELP 371

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  285 bits (729), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 168/403 (41%), Positives = 235/403 (58%), Gaps = 22/403 (5%)

Query: 28  QDSPHGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYLFM 87
           +D+P    KQ + +        IPF +F HS+   FP  T D F   + VA +Q   LF+
Sbjct: 19  EDNPSRKVKQNKSRPKKNVINIIPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFI 78

Query: 88  KDSSKKPLYPCLQMFAALIAEN---RGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIAC 144
             + +    P L+   A I+        K KLPY+G DLY   ++Y PLP   LDS   C
Sbjct: 79  --NVEDAALPLLKKDIANISGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPC 136

Query: 145 FEYIKKWERRKISKSFNS-GKVTIISPRHHVVDLVMALFHDDE---VSIICTNIGKGKLI 200
           F++I+ WE     + + +    TI+SPRHH+ ++VM+LF D++   V ++CT +  G ++
Sbjct: 137 FDFIRHWENEHRGEHYGAHADYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIIL 196

Query: 201 FSGDRSKEERN----GLNSKNSMTRKICYSGFALEDKLTTSHDERMGPFYSIVEGKINER 256
            S D +    N    GLNS N MTRKICYSGFA ED +     E   P +S+VE K+ E 
Sbjct: 197 LSKDDASSSSNSNTTGLNSSNPMTRKICYSGFAFEDLVLEDIAENARPIFSVVESKLTES 256

Query: 257 LSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRD 316
           ++LLLR E+D YN + N +TELKCF  L    +A  +++LKTWVQ GLIP+SD++IG RD
Sbjct: 257 INLLLRNELDGYNNVTNMFTELKCFAPLKCMFSA--KEVLKTWVQTGLIPESDIVIGIRD 314

Query: 317 TQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSL 376
           TQ G LEDL WY+R  L + FNNPS+     + NFNANIAVEW    +ES   +V   S 
Sbjct: 315 TQSGLLEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMES---IVSLVSS 371

Query: 377 SSPDDPYPKYESFKVIVDKSHNIIVKKLTKVPRHV--QIPRAF 417
           S  D  +P   SFK+ +D    I ++KL+++P+ V  QIP+ F
Sbjct: 372 SIADSNHPC--SFKLKIDNHKTISIQKLSRIPQTVQRQIPKEF 412

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  285 bits (730), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 161/408 (39%), Positives = 245/408 (60%), Gaps = 25/408 (6%)

Query: 24  SLGLQDSPHGPSKQRRKQQSG-KRTVCIPFSKFEHSDL-DYFPDDTADFFEGCEEVATYQ 81
           S+ +  S   PS Q+    +   R  C+P++ F H+ + D       D F+  +EVA + 
Sbjct: 39  SISITSSVKPPSPQKDDYWNRCSRFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFT 98

Query: 82  NGYLFMKDSSKKPLYPCL-----QMFAALIAENRGPKNKLPYIGCDLYQGHERYKPLPSS 136
           N   +   +++K L P L     +++ + + E R  + K+PY+G DL+   +++ P+  S
Sbjct: 99  NYQAYT--TARKDLIPSLRDGITELYESSLLEAR--RRKVPYLGHDLFANIDQFVPMTIS 154

Query: 137 ELDSSIACFEYIKKWERRKISKSFNSGK-VTIISPRHHVVDLVMALF--HDDEVSIICTN 193
           ELDS   C  Y++ W+     K+F  GK  TI+S RHH+VDL M  F   +   S+I T 
Sbjct: 155 ELDSISPCISYVENWKLSNHGKNFKIGKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTY 214

Query: 194 IGKGKLIFSGDRSKE---ERNGLNSKNSMTRKICYSGFALEDKLT-----TSHDERMGPF 245
           +G G + FS +   +    + G+ S +   +KICYSGF  E  +T     T  +    P 
Sbjct: 215 MGAGLISFSRNPKNDFQMSKEGIYSSDPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPI 274

Query: 246 YSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLI 305
           +S+VE K++E + LL+RCE+DA+NP+    TELKCF  L++ ++ HR+KLLKTW+Q GL+
Sbjct: 275 FSVVESKLSEDIGLLMRCEIDAFNPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLL 334

Query: 306 PDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIE 365
           P+SD++IG RD+  GQL D+ WYSR SLYKKFN+P +  + K LNFNA +AVEWC HCI+
Sbjct: 335 PNSDIVIGLRDSHSGQLLDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIK 394

Query: 366 SICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLTKVPRHVQI 413
           SIC+LV  N +S  +   P  ESF+V +D +  I + KL  VP++V++
Sbjct: 395 SICELVEAN-ISHYNSTRP--ESFEVSIDANGTIAITKLNTVPKNVEL 439

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  280 bits (716), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 163/438 (37%), Positives = 251/438 (57%), Gaps = 51/438 (11%)

Query: 18  LGNKLNSLGLQDSPHGPSKQRRKQQSGKRTVCI------------------------PFS 53
           L   L  + L+D P+ P  + RK+ S ++ + I                        P+S
Sbjct: 11  LAKDLEGINLRDVPN-PVNEHRKKSSKRKIIPISSLKRPSSQQKNDYLEEISEFTRVPYS 69

Query: 54  KFEHSDLDYFPDDTA-DFFEGCEEVATYQNGYLFMKDSSKKPLYPCLQ-----MFAALIA 107
            F H+ +  FP     D F   +EVA + +  L++  +++K + P L+     ++ + + 
Sbjct: 70  SFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYV--AARKDVIPNLKEDISHLYESPLL 127

Query: 108 ENRGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGK-VT 166
           E R  K K  Y+G DL+   +   P+  SELD+   C  YI+ W      K F  GK  T
Sbjct: 128 EAR--KLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKKFT 185

Query: 167 IISPRHHVVDLVMALF--HDDEVSIICTNIGKGKLIFSGDRS---KEERNGLNSKNSMTR 221
           +++ RHH+VDL M  F   + + SII T +G G +  S +     K  + G+ S +   +
Sbjct: 186 VVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSGDPNIK 245

Query: 222 KICYSGFALEDKLT-----TSHDERMGPFYSIVEGKINERLSLLLRCEMDAYNPIFNRYT 276
           KIC+SGF  E+ LT     +       P +SIVEGK++E + LL+RCEMDA+NP+    T
Sbjct: 246 KICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKTNT 305

Query: 277 ELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKK 336
           ELKCF  L++Q+++HR+KLLKTW+Q GL+P+SD+++G RD+  GQL D+ WYSR +L++K
Sbjct: 306 ELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLFRK 365

Query: 337 FNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKN-SLSSPDDPYPKYESFKVIVDK 395
           FN+P +  N K +N+NA +AVEWC HCI+SICDLV  N S  + + P P    F++ +D 
Sbjct: 366 FNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEP----FEINIDA 421

Query: 396 SHNIIVKKLTKVPRHVQI 413
           +  II+ KL+ +PR+V+I
Sbjct: 422 NGTIIITKLSTIPRNVEI 439

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  277 bits (708), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 150/380 (39%), Positives = 228/380 (60%), Gaps = 22/380 (5%)

Query: 50  IPFSKFEHSDLDYFPDDTA-DFFEGCEEVATYQNGYLFMKDSSKKPLYPCLQMFAALIAE 108
           + ++ F HS +  FP     D F   +EVA + NG  +   + +K + P L+   A + E
Sbjct: 66  VSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYT--TVRKDILPNLKGDIAELCE 123

Query: 109 NR---GPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSG-K 164
                  + KLPY+G DL+    ++ P+  SELDS + C  YI+ W      + F  G K
Sbjct: 124 RSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRK 183

Query: 165 VTIISPRHHVVDLVMALF--HDDEVSIICTNIGKGKLIFSGDRSKEER---NGLNSKNSM 219
            T+++ RHH+VD+ M LF   + + S++ T +G G + FS ++  + R    G+ S +  
Sbjct: 184 FTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPN 243

Query: 220 TRKICYSGFALEDKLT-----TSHDERMGPFYSIVEGKINERLSLLLRCEMDAYNPIFNR 274
            +KICYSGF  E+ +T        +    P +S+VE K++E + LL+RCEMDA+NP+   
Sbjct: 244 MKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGA 303

Query: 275 YTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLY 334
            TELKCF  L++ ++ HRRKLLKTW+Q GL P+SD++IG RD+  GQL D+ WYSR SL 
Sbjct: 304 NTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLC 363

Query: 335 KKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKN-SLSSPDDPYPKYESFKVIV 393
            KFN+  +  N + LN+NA +AVEWC HCI+SIC+L+  N S  S  +P    ESF++ +
Sbjct: 364 MKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNP----ESFEISI 419

Query: 394 DKSHNIIVKKLTKVPRHVQI 413
           D ++ I + KL  +P+HV++
Sbjct: 420 DSNNTIAITKLKNIPKHVEL 439

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  270 bits (689), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 155/423 (36%), Positives = 238/423 (56%), Gaps = 45/423 (10%)

Query: 22  LNSLGLQDSPHGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFEGCEEVATYQ 81
           +   G +  P   + Q +KQ    R   +PF +F HS +  FP  T  F+E   +VA Y 
Sbjct: 1   MKKTGQELMPLHTTVQSQKQAPITR---VPFGEFSHSSISLFPTCTQPFYESSNQVALYH 57

Query: 82  NGYLFMKDSSKKPLYPCLQMFAALIAENRGPKN---KLPYIGCDLYQGHERYKPLPSSEL 138
           N  L+   +S+  + P L+   A + +    +    K  Y+G DLY G E + P+ + +L
Sbjct: 58  NHKLY--PASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDL 115

Query: 139 DSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALF-------------HDD 185
           DS   C  +IK WER+  +K     K  I+S RHH+V++ M LF              D 
Sbjct: 116 DSLEPCMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDY 175

Query: 186 EVSIICTNIGKGKLIFSGDRSKEERN---GLNSKNSMTRKICYSGFALEDKLT--TSHDE 240
            ++++ T    G+L+F+ D S    +   G+ SKN + ++ICYSGFALED +T  TS  E
Sbjct: 176 VLNVVYTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRICYSGFALEDLMTETTSELE 235

Query: 241 RMG--------PFYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHR 292
           + G          +++VE K+++ + +LLRCE+DA+N    ++TELKCF+ L + + +HR
Sbjct: 236 KEGEKLTGGEKAVFAVVENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHR 295

Query: 293 RKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFN 352
           RKLLK WVQ G++PDSD++IG RD+  G+LED+ WYSR  L  K NN ++  +    NFN
Sbjct: 296 RKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFN 355

Query: 353 ANIAVEWCFHCIESICDLVMKN----SLSSPDDPYPKYESFKVIVDKSHNIIVKKLTKVP 408
           A +A +W  HCI SIC LV +N    ++S+P       + F++ +D   NI +K L+KVP
Sbjct: 356 AQVATQWSQHCIRSICKLVDENLDQKAISNP-------QGFQIRIDSRRNIRIKCLSKVP 408

Query: 409 RHV 411
           + +
Sbjct: 409 KDI 411

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  244 bits (624), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 141/372 (37%), Positives = 209/372 (56%), Gaps = 18/372 (4%)

Query: 55  FEHSDLDYFPDDTADFFEGCEEVATY-----QNGYLFMKDSSKKPLYPCLQMFAALIAEN 109
           F HS++ +FP     FF+   E+ T+        YLF      +PL   +  +    A+N
Sbjct: 30  FVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPAKN 89

Query: 110 RGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIIS 169
              K K  Y+G DL  G E Y PL   EL++      +I  WE +   K  +  K TI+S
Sbjct: 90  -ASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVS 148

Query: 170 PRHHVVDLVMALFHDDEVSIICTNIGKGKLIFSGDRSKEERN-GLNSKNSMTRKICYSGF 228
            RHH++DL+M  F  +E ++I T++  G LI S D+SK + + G+ SK++  RK+CY+GF
Sbjct: 149 NRHHLIDLIMCPFSLEEANLIVTHL-DGLLIISSDKSKPKVDSGIRSKDTRVRKLCYTGF 207

Query: 229 ALEDKLTTSHDERMGP---FYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLN 285
            LE+ +T    +  G    FYSIVE K+ E +SLLL+ EMD+YNP  + Y ELKC     
Sbjct: 208 ELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCSVNFQ 267

Query: 286 VQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARN 345
           ++++ HRRKLL+ W+Q GL+P +DL++G RD    QL+ L  Y+R  +YKKF+  ++  N
Sbjct: 268 LKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRNLNEN 327

Query: 346 NKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLT 405
            KY NFN+ +AV+W  H I  I +LV KN    P       +SFK+ + +   + + KL 
Sbjct: 328 RKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEP------LQSFKLTLTRDLQLSLTKLA 381

Query: 406 KVPRHVQIPRAF 417
             P  + IP  F
Sbjct: 382 NTPAGL-IPEKF 392

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  226 bits (576), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 156/433 (36%), Positives = 226/433 (52%), Gaps = 41/433 (9%)

Query: 14  EVHLLGNKLNSLGLQDSPH-GPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFE 72
           ++ L GN  NS  +   P    S   +K Q G     I F+ F      +F    +D + 
Sbjct: 10  KMSLDGNDKNSHNIHKLPVCSHSLPGKKYQGG----SIRFNSFVKPSKTHF----SDLYR 61

Query: 73  GCEEVATYQNGYLFMKDS---SKKPLYPCLQMFAALIAENR---GPKNKLPYIGCDLYQG 126
             +EVATY  G L +            PCL+     IA        K K  YIG DL++ 
Sbjct: 62  TSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIGADLFKD 121

Query: 127 HERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSG---KVTIISPRHHVVDLVMALFH 183
           +E+Y  +    L   I+CF+YI+ ++++  ++    G   +  II+ RHH+ DLV+A F 
Sbjct: 122 YEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAPFK 181

Query: 184 ---DDEVSIICTNIGKGKLIFSGDRSKEERNGLNSK---NSMTRKICYSGFALED----- 232
              D EVS++ T +G  +++ S D + E  +   +K   NSM RKI  SGFA ED     
Sbjct: 182 KISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNSM-RKIVNSGFAFEDLVIKD 240

Query: 233 ----KLTTSHDERM-------GPFYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCF 281
               KLT S +E+          ++S+VE  I+ +L++LLR EMD YNP+ N YTELKCF
Sbjct: 241 YTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSYTELKCF 300

Query: 282 TKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPS 341
           T+LN+    HR+KLLKTWVQIG +P+SDL++G+RDTQ G L D+TW+SR  L  K ++  
Sbjct: 301 TRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDSYY 360

Query: 342 IARNNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIV 401
             R   + N     A  W +H + +I  L       +P  P      F++IV+K+  I +
Sbjct: 361 SPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIVEKNRTITL 420

Query: 402 KKLTKVPRHVQIP 414
             L KVP  V IP
Sbjct: 421 LPLKKVPASVPIP 433

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  225 bits (573), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 115/313 (36%), Positives = 189/313 (60%), Gaps = 13/313 (4%)

Query: 113 KNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRH 172
           K KLPY+G +LY   E++ P+ S+ LDS++ CFEY++  +  +  K +N+   T ++PRH
Sbjct: 133 KFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLYNT-PYTFMTPRH 191

Query: 173 HVVDLVMALFHDDEVSI-----ICTNIGKGKLIFSGDRSKEERNGLNS---KNSMTRKIC 224
           H+ +L+M ++   E  +     + T I    ++ S D +KE      +   +NS ++K+ 
Sbjct: 192 HLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNHKLQNSFSKKVI 251

Query: 225 YSGFALEDKLTTSHDERMGPFYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKL 284
            SGF  E+ +  +  E   P++ I E ++  + + ++R EMD+YN     +TELKCF KL
Sbjct: 252 NSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMDSYNNKTETFTELKCFNKL 311

Query: 285 NVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIAR 344
           ++    HR+KLLKTW Q GL P+ D++IG RDT  G LEDL WYSR ++Y+K  +PS+ +
Sbjct: 312 HLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRENMYQKLQDPSLPK 371

Query: 345 NNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKL 404
                +F  +I ++W  HCI +I     K++  +  +P     ++KVI+DK  +II+KKL
Sbjct: 372 FKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNPM----TYKVIIDKHKSIIIKKL 427

Query: 405 TKVPRHVQIPRAF 417
           + VP++V+IP  F
Sbjct: 428 SIVPKNVEIPTDF 440

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  217 bits (553), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 142/384 (36%), Positives = 212/384 (55%), Gaps = 23/384 (5%)

Query: 50  IPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYLFMKDSSKKPL--YPCLQMFAALIA 107
           + F +F H D   +    A  F+  +EVA Y  G L++ D +   L   P L+   A +A
Sbjct: 28  VRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAALA 87

Query: 108 ENRGPKN----KLPYIGCDLYQGHERYKPLPSSE-LDSSIACFEYIKKWER-RKISKSFN 161
           +++  +     K  Y+G  LY G E Y    S + LDS+  C +YI +W R  K  K F 
Sbjct: 88  QSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKFG 147

Query: 162 -SGKVTIISPRHHVVDLVMALF-HDDEVSIICTNIGKGKLIFSG---DRSKEERN-GLNS 215
            S +  I+ PRHH+V+L MALF +D +  ++CT + +GK I      D S+  RN G+  
Sbjct: 148 ESYRHIIVGPRHHLVELTMALFANDSDYKLVCT-VLRGKFIVLSQFDDGSQRNRNEGITL 206

Query: 216 KNSMTRKICYSGFALEDKLTTSHDERMGPFYSIVEGKINERLSL-LLRCEMDAYNPIFNR 274
            +  TR +CYSGF +      S +  + P      G    R  L    CEMDAYN I N 
Sbjct: 207 SDRRTRMLCYSGFVICK--IWSLNRGIIPSQFFYYGTPIRRGHLATFTCEMDAYNQIENH 264

Query: 275 YTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLY 334
           YTELKC+  LN++ + H+ KLL+TWVQ  + PD+D++IG R+   G L+D+T  SR SLY
Sbjct: 265 YTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLY 324

Query: 335 KKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKN-SLSSPDDPYPKYESFKVIV 393
           +KFNN    R +   N+NA +AVEW  + +++I  L+  N +  S  +P    ++F V V
Sbjct: 325 RKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLEP----QAFVVTV 380

Query: 394 DKSHNIIVKKLTKVPRHVQIPRAF 417
            + H+I ++KL  VP++ +IP+ F
Sbjct: 381 YRGHDIGIRKLKGVPKYAEIPKEF 404

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  214 bits (546), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 122/360 (33%), Positives = 197/360 (54%), Gaps = 8/360 (2%)

Query: 48  VCIPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYLFMK-DSSKKPLYPCLQMFAALI 106
            C+    FE + + +FP +   FF+  +E+ T  +     K +  +K   P L+    L 
Sbjct: 17  ACVSCRGFERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDLGLF 76

Query: 107 AENRGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGK-V 165
              +       Y+G DL + ++ ++PL  ++L+     FE++ KWE     K ++SG   
Sbjct: 77  TITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDH-GKPYSSGSDF 135

Query: 166 TIISPRHHVVDLVMALFHDDEVSIICTNIGKGKLIFSGDRSKEERNGLNSKNSMTRKICY 225
           TI+  RH+++DL+MA F D++V      I     IF   + +++ +G+ S  S  R+ICY
Sbjct: 136 TIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKDDGIYSSESNIRRICY 195

Query: 226 SGFALEDKLT-TSHDERMGPFYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKL 284
           +GF LED +T T        FYS+V+GKI++ + LL + EMD +NP    YTE+KC T L
Sbjct: 196 TGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIKCTTGL 255

Query: 285 NVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIAR 344
            V+   HRRKLL+ WVQ  L+P +DL+IG RD    QL     Y+R  LY+KFNN +++ 
Sbjct: 256 KVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNLSL 315

Query: 345 NNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKL 404
             K  N+NANI+V+W  H ++ +C  +      +P +      SFK+ + K   + ++K+
Sbjct: 316 LKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAV----SFKLTLTKQLELRLRKI 371

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  205 bits (522), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 123/344 (35%), Positives = 201/344 (58%), Gaps = 20/344 (5%)

Query: 70  FFEGCEEVATYQNGYLFMKDSSKKPLYPCLQMFAALIAENR-GPKNKL--PYIGCDLYQG 126
           F++  + +  + +  L+  + ++  L+P L+   A IA++    K +L  P++G  LY+ 
Sbjct: 62  FYDSAKTLGIFHDHKLY--EMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYEN 119

Query: 127 HERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDD- 185
           H++Y P+ + ELD++ AC  Y+ ++E     K        I++ RHH++DL +  F    
Sbjct: 120 HDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQF 179

Query: 186 -EVSIICTNIGKGKLIFSGDRS--KEERNGLNSKNSMTRKICYSGFALEDKLTTS-HDER 241
             V+++C       L  S D +    ++ G+N+ N + +KIC+SGFALED LT S +DE 
Sbjct: 180 TNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALEDILTESANDEE 239

Query: 242 MGPFYSIVEGKI-NERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWV 300
             P + IVE +I N RL  L+RCE+DAYNPI + YTELKC+ K N  +  HRRKLLK+W+
Sbjct: 240 RNPTFLIVENEIANTRL--LMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSWI 297

Query: 301 QIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFNANIAVEWC 360
           Q G+IP +D++IG RDT+ G L+D+  Y+R  LY K  + S+ R +  LN++  I+V W 
Sbjct: 298 QTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVWY 357

Query: 361 FHCIESICDLVMKNSLSSPDDPYPKYES--FKVIVDKSHNIIVK 402
              I +     +  +++S  D + + E   F + VD + NI ++
Sbjct: 358 RSLINT-----LTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIE 396

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  198 bits (504), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 111/322 (34%), Positives = 177/322 (54%), Gaps = 8/322 (2%)

Query: 55  FEHSDLDYFPDDTADFFEGCEEVATYQNGYLFMKDS---SKKPLYPCLQMFAALIAENRG 111
           F+H+ ++ FP +   FF+  +EVAT    +L   D      K   P L        E+  
Sbjct: 24  FQHAQINQFPKNVLPFFDEVQEVATI--THLLDTDEFLLDDKLGMPELVQDLCEFTESGK 81

Query: 112 PKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIISPR 171
             NK  YIG DL    + Y P+   +L+       ++++W++       ++   TI+  R
Sbjct: 82  LANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFTIVCSR 141

Query: 172 HHVVDLVMALFHDDEVSIICTNIGKGKLIFSGDRSKEERN-GLNSKNSMTRKICYSGFAL 230
           H+++DL+M  F D++V +       G L  S D   ++ + G++S ++  +KICY+GF L
Sbjct: 142 HNLIDLIMMPFSDEDVHLK-IQFSNGYLNLSPDAQYQKTDQGIHSGDTKIKKICYTGFEL 200

Query: 231 EDKLT-TSHDERMGPFYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDT 289
           E+ +T TS  +    FYS+VEGK+ + + LLL+ EMD +N     YTE+KC + L V+ T
Sbjct: 201 ENLITATSKPDVRSSFYSLVEGKLGDGIKLLLKAEMDCFNSSTRSYTEIKCSSGLKVKST 260

Query: 290 AHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYL 349
            HRRKLL+ WVQ  L+P ++L++G RD    QL     Y+R  LY+KFNN  +    K  
Sbjct: 261 YHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNY 320

Query: 350 NFNANIAVEWCFHCIESICDLV 371
           N+NA I+V+W  H I+ +C ++
Sbjct: 321 NYNATISVQWFRHVIQQLCQMI 342

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  199 bits (505), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 123/361 (34%), Positives = 200/361 (55%), Gaps = 20/361 (5%)

Query: 20  NKLNSLGLQDSPHGPSKQRRKQQSGKR-TVCIPFSKFEHSDLDYFPDDTADFFEGCEEVA 78
           NK++ LG   S    S ++  + S K+ ++ +   KF H  ++Y  D T      C+EV 
Sbjct: 11  NKVDQLGESLSQLRISTRKNNKPSQKKGSLVLSCKKFPHVSVNYVVDKTPKLLTDCKEVH 70

Query: 79  T----YQNGYLFMKDSSKKP-LYPCLQMFAALIA-ENRGPKNKLPYIGCDLYQGHERYKP 132
                  +  L   ++S+KP L P +  +      EN+  K+   +IG DL +G++ Y P
Sbjct: 71  NCSYIINDATLLWNEASRKPRLRPEVCTYIKDSKWENKAVKDS--FIGIDLTKGYDDYVP 128

Query: 133 LPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSIICT 192
           L  + L+S +   E  +++E     K+ N  K T +S RHH++D++M  F D+ +S++ T
Sbjct: 129 LDRNVLNSLVILKEAYQRYE-----KTLNPEKTTFVSLRHHIIDIIMCPFLDEPLSLLMT 183

Query: 193 NIGKGKLIFSGDRSKEERNGLN-SKNSMTRKICYSGFALEDKL----TTSHDERMGPFYS 247
                 ++ S D+SK++ NG++ ++NS  +KICY+GFALED L    T  H      +YS
Sbjct: 184 VQPDKNILISVDKSKDKPNGIHETRNSFNKKICYTGFALEDLLIESPTEGHILEHELYYS 243

Query: 248 IVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPD 307
           IV G +N+ + LL++ EMD+ N + + YTE+K      + +T HRRKLL+ W+Q  L+P 
Sbjct: 244 IVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPK 303

Query: 308 SDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSI-ARNNKYLNFNANIAVEWCFHCIES 366
           SDL+IG R++   +LE L  Y    +Y K NN SI  +  K+  FN N+A +W  H  + 
Sbjct: 304 SDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQV 363

Query: 367 I 367
           +
Sbjct: 364 L 364

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  184 bits (466), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 117/381 (30%), Positives = 187/381 (49%), Gaps = 34/381 (8%)

Query: 24  SLGLQDSPHGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFEGCEEVAT-YQN 82
           ++ ++  PHGP  +R K++S +                         F    EV T ++ 
Sbjct: 24  NVNMKKFPHGPITRRGKERSIR------------------------IFSESREVGTAFRQ 59

Query: 83  GYLFMKDSSKKPLYPCLQMFAALIAENRGPKNKLPYIGCDLYQGHERYKPLPSSELDSSI 142
           G ++  D  K    P L         +R     + Y+G DL    E + P+ S EL    
Sbjct: 60  GLVYDLDDKKN--LPLLNDEICEYISHRSKSKLIGYVGSDLSVESETFHPVTSEELHCLH 117

Query: 143 ACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSIICTNIGKGKLIFS 202
              ++I KWE        +  K TI+SPRHH++D++M  F ++   ++ T   +G  + +
Sbjct: 118 GLLKFIAKWEADNEVNYASRSKFTIVSPRHHILDILMIPFGNERCRLVFTA-HRGLFVIT 176

Query: 203 GDRSKEERNGLNSKNSMTRKICYSGFALEDKLTTSHDERMGPFYSIVEGKINERLSLLLR 262
              S+    G+NS +S TRKICY+GF LE  LT +     G FYS +E K+   +++LL+
Sbjct: 177 LAPSQRP-TGINSPSSATRKICYTGFELERLLTATSGTERGSFYSFIEAKLEPDITILLQ 235

Query: 263 CEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQL 322
           CEMDAYNP   +YTE+K     NV++  H  KLLK W Q  L+P +D+++G RD     L
Sbjct: 236 CEMDAYNPKRQKYTEIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVL 295

Query: 323 EDLTWYSRGSLYKKFNNPSIARNN-KYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDD 381
           + +  YS   + +K       R++  Y NFN  +A +W  + I  IC+ +  +SL     
Sbjct: 296 KTVVPYSVDQIAEKLYIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERL--SSLVDATS 353

Query: 382 PYPKYESFKVIVDKSHNIIVK 402
             P  +SF V +DK+  + ++
Sbjct: 354 SSP--QSFLVEIDKNLQMKIR 372

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 130/309 (42%), Gaps = 51/309 (16%)

Query: 122 DLYQGHERYKPLPSSELDSSI--ACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVM 179
           DL  G +++K   + E DS+        ++++ERRK  K+    KV II+ R  +  L+ 
Sbjct: 58  DLLSGIKKFKECNTEEFDSTTLHGLLSTLEEYERRKSKKT----KVDIITFRGIIRKLIS 113

Query: 180 ALFHDDEVSIICTNIGK--GKLIFSGDRSKEERNGLN-SKNSMTRKICYSGFALEDKLTT 236
           + F   + + +   I    G+L     ++      +N ++ S+  +  YSG+  E   T 
Sbjct: 114 SAFDSSQFNPVNFRIVSFDGQLFIKEVKTDASETSINKNRESLQARAYYSGYKFEALATL 173

Query: 237 SHDERMGP-----------------FYSIVEGKINERLSLLLRCEMDAY-------NPIF 272
           S    + P                 F S+V   I  +  +L+  E+D         +   
Sbjct: 174 SLPLPLVPRTTLEKRPKKIINNGDQFISMVRTGIG-KCKILIGAEVDCIFDFKEDSDDNL 232

Query: 273 NRYTELKCFTKLNVQDTAHR--RKLLKTWVQIGLIPDSDLIIGTRDTQ--VGQLEDLTWY 328
             Y ELKC T +N    AH+  RKL KTW+Q  L+  + +I G RD    +  +E+ T  
Sbjct: 233 KHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRDDNFMLKTVEEFT-T 291

Query: 329 SRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYES 388
           S   L  K NNP        +      A++W     E +       S+  P+D     ++
Sbjct: 292 SEVPLILKNNNPQ-------MQTVCVDAIKWYGAFTEWLL-----TSIPRPEDDIDTIKA 339

Query: 389 FKVIVDKSH 397
           +K+I + +H
Sbjct: 340 YKLIFENNH 348

>Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 62/127 (48%), Gaps = 17/127 (13%)

Query: 275 YTELKCFTK-LNVQDT-AHRRKLLKTWVQIGLIPDSDLIIGTRDTQ--VGQLEDLTWYSR 330
           Y ELKC  + +N+ DT    RKL +TW+Q  L+    +I G +D Q  +  +E+ +    
Sbjct: 239 YAELKCTQQVMNISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDQYVLKTVEEFSTEEV 298

Query: 331 GSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFK 390
             L K  NNP +         +   A++W     E +  ++ ++     +DP+ +  +FK
Sbjct: 299 PVLLKN-NNPQMGS-------SCLEAIKWYGLLTEWLLKMIPRD-----EDPHAQVRAFK 345

Query: 391 VIVDKSH 397
           +I + +H
Sbjct: 346 LIFENNH 352

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 60/127 (47%), Gaps = 17/127 (13%)

Query: 275 YTELKCFTK-LNVQDT-AHRRKLLKTWVQIGLIPDSDLIIGTRDTQ--VGQLEDLTWYSR 330
           Y ELKC  + +NV DT    RKL +TW+Q  L+    +I G +D    +  +E+ +    
Sbjct: 239 YAELKCTQQVMNVSDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDHYVLKTVEEFSTEEV 298

Query: 331 GSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFK 390
             L K  NNP +         +   A++W     E +  +V +      +DP+ +  +FK
Sbjct: 299 PVLLKN-NNPQVGS-------SCLEAIKWYGLLTEWLLKMVPRE-----EDPHARIRAFK 345

Query: 391 VIVDKSH 397
           ++ + +H
Sbjct: 346 LVFENNH 352

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 275 YTELKCFTKLNVQDTAHR--RKLLKTWVQIGLIPDSDLIIGTRD 316
           Y ELKC T++     AHR  RKL KTW+Q  L+    +I G RD
Sbjct: 227 YAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFRD 270

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 63/128 (49%), Gaps = 19/128 (14%)

Query: 275 YTELKCFTKL-NVQDT-AHRRKLLKTWVQIGLIPDSDLIIGTRDTQ--VGQLEDLTWYSR 330
           Y ELKC  ++ N+ DT    RKL +TW+Q  L+    +I G +D    +  +E+ +    
Sbjct: 239 YAELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDHYVLKTVEEFSTEEV 298

Query: 331 GSLYKKFNNPSIARNNKYLNFNANI-AVEWCFHCIESICDLVMKNSLSSPDDPYPKYESF 389
             L K  NNP +         +A + A++W     E +  ++ ++     +DP+ +  +F
Sbjct: 299 PVLLKN-NNPQVG--------SACLEAIKWYGLLTEWLLKMIPRD-----EDPHSQIRAF 344

Query: 390 KVIVDKSH 397
           K++ + +H
Sbjct: 345 KLVFENNH 352

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 62/126 (49%), Gaps = 15/126 (11%)

Query: 275 YTELKCFTK-LNVQDT-AHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGS 332
           Y ELKC  + +N  DT    RKL +TW+Q  L+    +I G +D     L+ +  +S   
Sbjct: 239 YAELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDHY-VLKTVEEFSTEE 297

Query: 333 LYKKFNNPSIARNNKYLNFNANI-AVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKV 391
           +      P + +NN     +A + A++W     E +  ++ ++     +DP+ +  +FK+
Sbjct: 298 V------PVLLKNNNPQMGSACLEAIKWYGLLTEWLLKMIPRD-----EDPHAQIRAFKL 346

Query: 392 IVDKSH 397
           + + +H
Sbjct: 347 VFENNH 352

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 17/126 (13%)

Query: 275 YTELKCFTKLNVQDTAHR--RKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGS 332
           Y ELKC T++     AH+  RK+ +TW+Q  L+    +I G RD     L+ +  YS   
Sbjct: 235 YAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRDENY-VLKTIEEYSTDE 293

Query: 333 LYKKFNNPSIARNNKY-LNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKV 391
           +      P + +NN   +N     A++W     E +  ++       P D   +   +K+
Sbjct: 294 I------PILLKNNNTKMNSMCLDAIKWYGLFTEWLLKII-------PRDQPKEIRPYKL 340

Query: 392 IVDKSH 397
           +++ +H
Sbjct: 341 VLENNH 346

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 17/126 (13%)

Query: 275 YTELKCFTKLN--VQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGS 332
           YTELKC   +    +  A  RK+ KTW+Q  L+  + +I G RD     L+ +  +S   
Sbjct: 233 YTELKCTKGVTTIAEARAFERKIFKTWLQCFLVGVNRVIYGFRDDNF-ILKSVEEFSTQE 291

Query: 333 LYKKFNNPSIARNNKYLNFNANI-AVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKV 391
           +      P I +NN     NA + A++W     E +   +       P +      ++K+
Sbjct: 292 I------PIILKNNNPQMTNACVDAIKWYGAFTEWLLKTI-------PHENDGGLRAYKL 338

Query: 392 IVDKSH 397
           I D +H
Sbjct: 339 IYDSNH 344

>Skud_7.574 Chr7 complement(945547..948510) [2964 bp, 987 aa] {ON}
           YGR240C (REAL)
          Length = 987

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 18/122 (14%)

Query: 81  QNGYLFMKDSSKKPLYPCLQMFAALIAENR----GPKNKLPYIGCDLYQGHERYKPLPSS 136
           +NG L +++     +Y   Q+ A +I+E      G +  +P        GH +   +PSS
Sbjct: 818 RNGKLLVRNEQASSVYST-QLLADIISEASKGKFGVRTAIP--------GHVQQGGVPSS 868

Query: 137 E--LDSS---IACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSIIC 191
           +  + +S   + C ++I+KW ++  +      KV       H   +      DD  ++IC
Sbjct: 869 KDRVTASRFAVKCIKFIEKWNKKNEASPNTDAKVLRFKFDTHGEKVPTVEHEDDSAAVIC 928

Query: 192 TN 193
            N
Sbjct: 929 VN 930

>CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {ON}
           similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246c RAI1
          Length = 400

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 275 YTELKCFTKLNVQDTAHR--RKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGS 332
           YTELKC ++++  +   R  +K+ + W+Q  L+    +I G RD Q   L+ +  +S   
Sbjct: 244 YTELKCSSQISTTNDVRRFEKKMFRAWLQCFLVGVPRVIYGFRDDQY-MLKTVEEFSTEE 302

Query: 333 L--YKKFNNPSIARN 345
           +    K NNP++ ++
Sbjct: 303 IPVIIKANNPTLGQS 317

>KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 275 YTELKCFTKLN--VQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGS 332
           Y ELKC   ++   +  A  RK+ KTW+Q  L+  + +I G RD     L  +  YS   
Sbjct: 233 YAELKCTKGVSTFAEARAFERKMFKTWLQCFLVGINRVIYGFRDENF-ILRSVEEYSTQE 291

Query: 333 --LYKKFNNPSIA 343
             L  K NNP + 
Sbjct: 292 VPLLLKNNNPQLT 304

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 62/139 (44%), Gaps = 20/139 (14%)

Query: 275 YTELKCFTKLN--VQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGS 332
           Y ELKC   ++   +  +  RKL KTW+Q  L+  + +I G RD     L  +  Y    
Sbjct: 233 YAELKCTKGVSTFAEARSFERKLFKTWLQCFLVGINRIIYGFRDEHF-ILRSVEEYGSHE 291

Query: 333 LYKKFNNPSIARNNKYLNFNANI-AVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKV 391
           +      P + +NN     NA + AV W     E +   + +      D+     +S+++
Sbjct: 292 I------PLLLKNNNPQLTNACMDAVRWYGAFTEWLLSSIPR------DESVDVMKSYRL 339

Query: 392 IVDKSHNIIVKKLTKVPRH 410
           I + +H     KL+++ +H
Sbjct: 340 IFENNH----LKLSEIEQH 354

>KNAG0G01890 Chr7 (421365..423686) [2322 bp, 773 aa] {ON} Anc_8.237
           YER171W
          Length = 773

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 347 KYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLTK 406
           ++   +A+IA++  F   E+   +++ +   SP D YPK  +F+ ++ KS+ + + K + 
Sbjct: 436 RFTCLDASIAIKPVF---ETFSSVIITSGTISPLDMYPKMLNFETVLQKSYAMTLAKKSF 492

Query: 407 VPRHV 411
           +P  V
Sbjct: 493 LPMIV 497

>AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 775

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 98/253 (38%), Gaps = 43/253 (16%)

Query: 143 ACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALF--HDDEVSIICTNIGKGKLI 200
              + + ++ERRK SK  N+    II+ R  V  L+   F  H  +V +   +   G+L 
Sbjct: 490 GLLQTLMEYERRK-SKKVNA---DIIAFRGQVKRLIHCAFGGHATDVDMYVMSF-DGQLF 544

Query: 201 FSGDRSKEERNGLNSKNSMTRKICYSGF-----ALEDKLTTSHDE-----------RMGP 244
               R K E    + + S      YSG+     AL D+                  R GP
Sbjct: 545 IRAARKKLEFP-TSPRESWAYLAYYSGYKFERMALLDRPVAETPREVLESRGKQVVRNGP 603

Query: 245 FYSIVEGKINERLSLLLRCEMDAY----NPI---FNRYTELKCFTKLNVQDTAHRRKLLK 297
            Y  V         L+L  E+D       P       Y ELK   K    +     KL  
Sbjct: 604 QYRTVMRTGVGEHKLVLGAEIDGIIDFREPTGDNLKHYVELKVCQK----NRNFSEKLFS 659

Query: 298 TWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFNANIAV 357
           +W+Q  L+  + +IIG RD +   L+ +  +S   +      P + +  +Y N   + A+
Sbjct: 660 SWLQCFLVGINRVIIGFRDEKF-VLKSVEEFSTSEI------PHLLKGTEYSNVCVD-AI 711

Query: 358 EWCFHCIESICDL 370
           EW     + +C+L
Sbjct: 712 EWYGALTKWLCEL 724

>Suva_5.305 Chr5 (494912..497245) [2334 bp, 777 aa] {ON} YER171W
           (REAL)
          Length = 777

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 347 KYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLTK 406
           ++   +A+IA++  F   E    +++ +   SP D YP+  +FK ++ KS+ + + K + 
Sbjct: 436 RFTCLDASIAIKPVF---EKFSSVIITSGTISPLDMYPRMLNFKTVLQKSYAMTLAKKSF 492

Query: 407 VP 408
           +P
Sbjct: 493 LP 494

>Skud_5.310 Chr5 (512188..514515) [2328 bp, 775 aa] {ON} YER171W
           (REAL)
          Length = 775

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 347 KYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLTK 406
           ++   +A+IA++  F   E    +++ +   SP D YP+  +FK ++ KS+ + + K + 
Sbjct: 436 RFTCLDASIAIKPVF---EKFSSVIITSGTISPLDMYPRMLNFKTVLQKSYAMTLAKKSF 492

Query: 407 VP 408
           +P
Sbjct: 493 LP 494

>Smik_5.343 Chr5 (526697..529024) [2328 bp, 775 aa] {ON} YER171W
           (REAL)
          Length = 775

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 347 KYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLTK 406
           ++   +A+IA++  F   E    +++ +   SP D YP+  +FK ++ KS+ + + K + 
Sbjct: 436 RFTCLDASIAIKPVF---ERFSSVIITSGTISPLDMYPRMLNFKTVLQKSYAMTLAKKSF 492

Query: 407 VP 408
           +P
Sbjct: 493 LP 494

>YER171W Chr5 (527082..529418) [2337 bp, 778 aa] {ON}  RAD35' to 3'
           DNA helicase, involved in nucleotide excision repair and
           transcription; subunit of RNA polII initiation factor
           TFIIH and of Nucleotide Excision Repair Factor 3 (NEF3);
           homolog of human XPD protein; mutant has aneuploidy
           tolerance
          Length = 778

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 347 KYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLTK 406
           ++   +A+IA++  F   E    +++ +   SP D YP+  +FK ++ KS+ + + K + 
Sbjct: 436 RFTCLDASIAIKPVF---ERFSSVIITSGTISPLDMYPRMLNFKTVLQKSYAMTLAKKSF 492

Query: 407 VP 408
           +P
Sbjct: 493 LP 494

>Kwal_23.4609 s23 complement(785074..786060) [987 bp, 328 aa] {ON}
           [contig 5] FULL
          Length = 328

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 62/167 (37%), Gaps = 23/167 (13%)

Query: 76  EVATYQNGYLFMKDSSKKPLYPCLQMFAALIAENRGPKNKLPYIGCDLYQGHERYKPLPS 135
           +V  Y  GYL    S KKP+ PC ++ +     N+          C + +  +R      
Sbjct: 145 QVEFYIKGYLARCQSKKKPVPPCTELRSGNAKSNK---------VCKIPRRDKRQTLAVH 195

Query: 136 SELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSIICTNIG 195
             L   I   E   +WER K     N+   T      +   LV        +S+I T   
Sbjct: 196 PSLTKGIKVQE---EWERYKADSQLNAETATDTIKWWYSRRLVYPNLFPLAISMIYTRFS 252

Query: 196 ----KGKLIFSGDRSKEERNGLNSKNSMTRKIC-----YSGFALEDK 233
               +     SG   +++R  L S N  TR+I      +S F L DK
Sbjct: 253 SCGMERTFSISGKLMRKDRRSLGSAN--TRRIMLLRNRFSNFGLFDK 297

>Kwal_33.14289 s33 (604076..605062) [987 bp, 328 aa] {ON} [contig
           104] FULL
          Length = 328

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 62/167 (37%), Gaps = 23/167 (13%)

Query: 76  EVATYQNGYLFMKDSSKKPLYPCLQMFAALIAENRGPKNKLPYIGCDLYQGHERYKPLPS 135
           +V  Y  GYL    S KKP+ PC ++ +     N+          C + +  +R      
Sbjct: 145 QVEFYIKGYLARCQSKKKPVPPCTELRSGNAKSNK---------VCKIPRRDKRQTLAVH 195

Query: 136 SELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSIICTNIG 195
             L   I   E   +WER K     N+   T      +   LV        +S+I T   
Sbjct: 196 PSLTKGIKVQE---EWERYKADSQLNAETATDTIKWWYSRRLVYPNLFPLAISMIYTRFS 252

Query: 196 ----KGKLIFSGDRSKEERNGLNSKNSMTRKIC-----YSGFALEDK 233
               +     SG   +++R  L S N  TR+I      +S F L DK
Sbjct: 253 SCGMERTFSISGKLMRKDRRSLGSAN--TRRIMLLRNRFSNFGLFDK 297

>Kwal_47.19306 s47 (1181820..1182806) [987 bp, 328 aa] {ON} [contig
           344] FULL
          Length = 328

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 62/167 (37%), Gaps = 23/167 (13%)

Query: 76  EVATYQNGYLFMKDSSKKPLYPCLQMFAALIAENRGPKNKLPYIGCDLYQGHERYKPLPS 135
           +V  Y  GYL    S KKP+ PC ++ +     N+          C + +  +R      
Sbjct: 145 QVEFYIKGYLARCQSKKKPVPPCTELRSGNAKSNK---------VCKIPRRDKRQTLAVH 195

Query: 136 SELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSIICTNIG 195
             L   I   E   +WER K     N+   T      +   LV        +S+I T   
Sbjct: 196 PSLTKGIKVQE---EWERYKADSQLNAETATDTIKWWYSRRLVYPNLFPLAISMIYTRFS 252

Query: 196 ----KGKLIFSGDRSKEERNGLNSKNSMTRKIC-----YSGFALEDK 233
               +     SG   +++R  L S N  TR+I      +S F L DK
Sbjct: 253 SCGMERTFSISGKLMRKDRRSLGSAN--TRRIMLLRNRFSNFGLFDK 297

>TPHA0A01920 Chr1 complement(387645..389966) [2322 bp, 773 aa] {ON}
           Anc_8.237 YER171W
          Length = 773

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 56/124 (45%), Gaps = 12/124 (9%)

Query: 290 AHRRKLLKTWVQIGLIPDSDLI--IGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNK 347
           A R  LL   +++  + D   +  I T  T V   ED        + + F   + A  N 
Sbjct: 378 AERLSLLVRTLEVTDVEDFAALKDIATFATLVSTYEDGFLL----IIEPFELENAAVPNP 433

Query: 348 YLNF---NANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKL 404
            L F   +A+IA++  F   E    +++ +   SP D YP+  +F  ++ KS+ + + K 
Sbjct: 434 ILRFTCLDASIAIKPVF---ERFSSVIITSGTISPLDMYPRMLNFTTVLQKSYTMTLTKK 490

Query: 405 TKVP 408
           T +P
Sbjct: 491 TFLP 494

>ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} similar
           to uniprot|P53063 Saccharomyces cerevisiae YGL246C RAI1
           Nuclear protein that binds to and stabilizes the
           exoribonuclease Rat1p required for pre-rRNA processing
          Length = 380

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 12/105 (11%)

Query: 275 YTELKCFTKLNVQDTAHR--RKLLKTWVQIGLIPDSDLIIGTRDTQ--VGQLEDLTWYSR 330
           Y ELKC   ++    A +  RK+ +TW+Q  L+    +I G RD    +  +E+ T    
Sbjct: 231 YAELKCSADVSTPADARKFERKVFRTWLQCFLVGIPRIIYGFRDNNNVLKTVEEYTTTEV 290

Query: 331 GSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNS 375
             L K  NNP  A N+  L+     A++W     E +  ++ ++ 
Sbjct: 291 PVLLKS-NNP--AMNSSCLD-----AIKWYGTLTEWLLKMIPRDG 327

>Smik_12.294 Chr12 complement(548629..550740) [2112 bp, 703 aa] {ON}
           YLR233C (REAL)
          Length = 703

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 183 HDDEVSIICTN----IGKGKLIFSGDRSKEERNGLNSKNSMTRKICY 225
           H  +++II  N    IG   L+FS ++SKEERN L   +   R++ +
Sbjct: 357 HSAKINIIFENLTAMIGSFDLMFSNEKSKEERNRLKYVDLCERQVLF 403

>KAFR0B02570 Chr2 (511567..513906) [2340 bp, 779 aa] {ON} Anc_8.237
           YER171W
          Length = 779

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 351 FNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLTKVP 408
            +A+IA++  F   E    +++ +   SP D YP+  +F+ I+ KS+++ + K + +P
Sbjct: 441 LDASIAIKPVF---EKFSSVIITSGTISPLDMYPRMLNFETILQKSYSMTLDKKSFLP 495

>Kpol_414.1 s414 (1989..6635) [4647 bp, 1548 aa] {ON} (1989..6635)
            [4647 nt, 1549 aa]
          Length = 1548

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%)

Query: 27   LQDSPHGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFEGCEEVATY 80
            L DS     K R+  +S K   C+PF     SDL +  D   DF +G   +  +
Sbjct: 1397 LMDSTKNFIKYRQLVESVKDVPCVPFFGVFLSDLTFTSDGNPDFIKGSSHIINF 1450

>NDAI0B02270 Chr2 (564974..567289) [2316 bp, 771 aa] {ON} Anc_8.237
           YER171W
          Length = 771

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 347 KYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVKKLTK 406
           ++   +A+IA++  F   E    +++ +   SP D YP+  +F+ ++ KS+++ + K + 
Sbjct: 436 RFTCLDASIAIKPVF---EKFSSVIITSGTISPLDMYPRMLNFETVLQKSYSMTLAKKSF 492

Query: 407 VPRHV 411
           +P  V
Sbjct: 493 LPMIV 497

>TPHA0D03740 Chr4 complement(784729..791682) [6954 bp, 2317 aa] {ON}
            Anc_6.311 YMR207C
          Length = 2317

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 136  SELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSIICTNIG 195
            S++DSS    E  KK E     K+ +S    I+ P + + +  +    + E S+I   +G
Sbjct: 956  SKMDSSFPAVELRKKLEDAINEKNSDSSMKQILEPLYDITESYLNGIKEHEYSVIIKLLG 1015

Query: 196  K---GKLIFSGDRSKEE 209
            K    + +F GD+ +EE
Sbjct: 1016 KYYDTERLFIGDKVQEE 1032

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,605,281
Number of extensions: 2210859
Number of successful extensions: 5494
Number of sequences better than 10.0: 55
Number of HSP's gapped: 5572
Number of HSP's successfully gapped: 55
Length of query: 418
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 306
Effective length of database: 40,638,807
Effective search space: 12435474942
Effective search space used: 12435474942
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)