Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B021705.703ON56756727860.0
ZYRO0G06578g5.703ON56957514160.0
Suva_9.385.703ON56957713930.0
YIL150C (MCM10)5.703ON57157613890.0
NCAS0G002205.703ON59258013830.0
Smik_9.195.703ON57257713780.0
Skud_9.185.703ON57157913710.0
KAFR0D022105.703ON58459313161e-176
Kpol_1043.715.703ON58558412391e-164
TPHA0E002105.703ON54454512071e-160
CAGL0H06589g5.703ON58359312081e-160
TBLA0G010205.703ON59459811961e-157
KNAG0L021505.703ON61661511771e-154
NDAI0F002805.703ON61061011741e-154
SAKL0E14938g5.703ON57458411321e-148
KLTH0E01034g5.703ON58355910751e-139
Kwal_55.196915.703ON4664719581e-124
AFR287W5.703ON6116148621e-107
KLLA0A00572g5.703ON5775867921e-97
Ecym_74042.468ON360117732.5
NDAI0I031503.552ON18441712.8
Kwal_27.102398.844ON91464707.8
Suva_13.3422.347ON712856910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02170
         (567 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...  1077   0.0  
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   550   0.0  
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   541   0.0  
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   539   0.0  
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   537   0.0  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   535   0.0  
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   532   0.0  
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   511   e-176
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   481   e-164
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   469   e-160
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   469   e-160
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   465   e-157
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   457   e-154
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   456   e-154
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   440   e-148
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   418   e-139
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   373   e-124
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   336   e-107
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   309   1e-97
Ecym_7404 Chr7 complement(831674..832756) [1083 bp, 360 aa] {ON}...    33   2.5  
NDAI0I03150 Chr9 (741840..742394) [555 bp, 184 aa] {ON} Anc_3.55...    32   2.8  
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...    32   7.8  
Suva_13.342 Chr13 complement(563583..565721) [2139 bp, 712 aa] {...    31   10.0 

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score = 1077 bits (2786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/567 (93%), Positives = 528/567 (93%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKSKDPNFDAI 60
           MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKSKDPNFDAI
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKSKDPNFDAI 60

Query: 61  QVESSPVKKPAESIKVEPSRTKRVLDIENLNEKKVESRSQIPANTTSYFIDNFRNXXXXX 120
           QVESSPVKKPAESIKVEPSRTKRVLDIENLNEKKVESRSQIPANTTSYFIDNFRN     
Sbjct: 61  QVESSPVKKPAESIKVEPSRTKRVLDIENLNEKKVESRSQIPANTTSYFIDNFRNSKKEE 120

Query: 121 XXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQRYISQDDLRKVLHEV 180
                       KRVHTFRGIDGNHKFK         YSDLWVKQRYISQDDLRKVLHEV
Sbjct: 121 QKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLRKVLHEV 180

Query: 181 KILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDFQYNL 240
           KILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDFQYNL
Sbjct: 181 KILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDFQYNL 240

Query: 241 DVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCILEIGQ 300
           DVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCILEIGQ
Sbjct: 241 DVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCILEIGQ 300

Query: 301 SRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGAPTKV 360
           SRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGAPTKV
Sbjct: 301 SRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGAPTKV 360

Query: 361 DSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKAFFNDEFQNPDIL 420
           DSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKAFFNDEFQNPDIL
Sbjct: 361 DSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKAFFNDEFQNPDIL 420

Query: 421 NNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEIEKGSKKYEEICETTEATLQSGLIQN 480
           NNL             LILQQQLKRINSRHAAIEIEKGSKKYEEICETTEATLQSGLIQN
Sbjct: 421 NNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIEKGSKKYEEICETTEATLQSGLIQN 480

Query: 481 LGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKKEHVELKPAKEVLLQRKRD 540
           LGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKKEHVELKPAKEVLLQRKRD
Sbjct: 481 LGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKKEHVELKPAKEVLLQRKRD 540

Query: 541 RERAWQENFGDKSVNLSSDSDSDIEIV 567
           RERAWQENFGDKSVNLSSDSDSDIEIV
Sbjct: 541 RERAWQENFGDKSVNLSSDSDSDIEIV 567

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/575 (50%), Positives = 391/575 (68%), Gaps = 15/575 (2%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKR-QLKSKDPNFDA 59
           M DPREV+  D +  LTS+ E++ E+E QI EIERQK+DL++RL  K+   K  DPN   
Sbjct: 1   MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 60  IQVESSPVKKPAESI---KVEPSRTKRVLDIENLNEKKVESRSQIPANTTSYFIDNFRNX 116
           IQVESSP KK   S+    V+    +  +  ENLNE K +S+ QIPANTTS+FI+ +   
Sbjct: 61  IQVESSP-KKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQIPANTTSFFIEKYSTS 119

Query: 117 XXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQRYISQDDLRKV 176
                            RVHTF+G     ++K         +S+LW+ +RYI +++ R +
Sbjct: 120 KRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSI 179

Query: 177 LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236
              +KILRLSKLFAK+KPPKF EP YSNWA IG+IS KG+VKF+S+  P KYFKFTLT+F
Sbjct: 180 FANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNF 239

Query: 237 QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296
           QY++D Y+FGK+GVERYYNLRVGDI+AILNP+VLPWRPS     IKSFNLRISH F CIL
Sbjct: 240 QYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECIL 299

Query: 297 EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356
           EIG SRD+ WC  FNKS+N+ C  PINK KE CC++HRE++FRS +AKR+EL+G++ALGA
Sbjct: 300 EIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGA 359

Query: 357 PTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKN---SDLRGIHFSNGNAAKAFFNDE 413
           PT++D+ PALYR  S+  + N+ ++ N       K     D+   HFSN NAAKAFF++ 
Sbjct: 360 PTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFDER 419

Query: 414 FQNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTEAT 472
           FQNP+ L NL              IL ++LK    +++ ++I+ K +++ +EI  TTE+T
Sbjct: 420 FQNPETLRNLENKRRKLRDNRKSNILNRELK----KNSELDIKHKSAEEIDEIKRTTEST 475

Query: 473 LQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKKEHVELKPAKE 532
           + SG+++NLGFDPT G+I +V K    D S+   L +K   V+SLL FKK++V+LKP+KE
Sbjct: 476 MGSGMMKNLGFDPTQGKIASVFKHQRSD-SDKKPLTEKDSSVASLLSFKKDNVKLKPSKE 534

Query: 533 VLLQRKRDRERAWQENFGDKSVNLSSDSDSDIEIV 567
           +L+++KR RER W+E+FG    +   DSDSD+EIV
Sbjct: 535 ILIKQKRRRERVWKEHFGSGG-DEKDDSDSDLEIV 568

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/577 (48%), Positives = 388/577 (67%), Gaps = 18/577 (3%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKS-KDPNFDA 59
           M+DPRE++  DP+  +TSDEED++ +  ++  +ER+K+ L+ERLK K+  K  +DPNF+A
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 60  IQVESSPVKKPAESIKVEPSRTKRVLD--IENLNEKKVESRSQ-IPANTTSYFIDNFRNX 116
           ++V  SP KK    +K      K+ +     N+NE  +  +SQ  P+NTT+YF+  F++ 
Sbjct: 61  VEVPQSPAKKSI--VKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDA 118

Query: 117 XXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQRYISQDDLRKV 176
                            RVHTF G D N ++K         +S+LWVK+RYI ++DL++ 
Sbjct: 119 KRNEDKQIAKYEGMMNARVHTF-GTD-NKEYKPIITNELESFSNLWVKKRYIPEEDLKRA 176

Query: 177 LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236
           LHE+KILRL+KLFAKI+PPKF EP Y+NWA +G+IS K  +KF+SS KP+K+F FT+TDF
Sbjct: 177 LHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 236

Query: 237 QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296
           Q++LDVY+FGKKGVERYYNLR+GD++AILNPEVLPWRPS +GNFIKSFNLRISHDF CIL
Sbjct: 237 QHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 296

Query: 297 EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356
           EIG SRD+ WC   NK  +K+CG+PIN     CCD+HRE+QFR   AKRIELNG +ALGA
Sbjct: 297 EIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGA 356

Query: 357 PTKVDSGPALYREKSAGAH---RNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKAFFNDE 413
           PTKVDS P+LYR K        R+ +   +  ++ V +NS     +F+N N+AKAFF+++
Sbjct: 357 PTKVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSH----NFTNSNSAKAFFDEK 412

Query: 414 FQNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTEAT 472
           FQNPD+L NL               L ++L +I  R  +  +E K   + +++ +TTE+ 
Sbjct: 413 FQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESA 472

Query: 473 LQSGLIQNLGFDPTHGEIGNVLKQAAK-DKSNNGQLNKKQKEVSSLLKFKKEHVELKPAK 531
           LQ+GLIQ LGFDPTHG+I  VLK +    +S   ++N K+  ++ LL++KKE V L P+K
Sbjct: 473 LQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSK 532

Query: 532 EVLLQRKRDRERAWQENFGDKSVNLSSD-SDSDIEIV 567
               +++  RE  WQ +FG K   ++SD S SD+EIV
Sbjct: 533 NEWFKKRSHREEVWQRHFGSKETEVASDASGSDLEIV 569

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/576 (47%), Positives = 381/576 (66%), Gaps = 14/576 (2%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKS-KDPNFDA 59
           MNDPRE++  DP+  +TSDEED++ +  ++  +ER+++ LVERLK K++ K  +DPNF+A
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 60  IQVESSPVKKPAESIKVEPSRTKRVLDIENLNE---KKVESRSQIPANTTSYFIDNFRNX 116
           I+V  SP K   +      ++     +  N+NE    +++ + + PA+TT+YF++ F+N 
Sbjct: 61  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120

Query: 117 XXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQRYISQDDLRKV 176
                            RVHTF       K+          +S+LWVK+RYI +DDL++ 
Sbjct: 121 KKNEDKQIAKFESMMNARVHTFS--TDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRA 178

Query: 177 LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236
           LHE+KILRL KLFAKI+PPKF EP+Y+NWA +G+IS K  +KF+SS KP+K+F FT+TDF
Sbjct: 179 LHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 238

Query: 237 QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296
           Q+ LDVY+FGKKGVERYYNLR+GD++AILNPEVLPWRPS +GNFIKSFNLRISHDF CIL
Sbjct: 239 QHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 298

Query: 297 EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356
           EIG SRD+ WC   NK  +K CG+PIN +  KCCD+HRE+QFR   AKRIELNG +ALGA
Sbjct: 299 EIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGA 358

Query: 357 PTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLR--GIHFSNGNAAKAFFNDEF 414
           PTKVDS P+LY+   A     F ++    ++   +   L+    +F+N N+AKAFF+++F
Sbjct: 359 PTKVDSQPSLYK---AKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKF 415

Query: 415 QNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTEATL 473
           QNPD+L NL               L ++L +I  R  +  +E K   + +++  TTE+ L
Sbjct: 416 QNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESAL 475

Query: 474 QSGLIQNLGFDPTHGEIGNVLKQA-AKDKSNNGQLNKKQKEVSSLLKFKKEHVELKPAKE 532
           Q+GLIQ LGFDPTHG+I  VLK + +  +  N  L KK+  ++ LL +KKE V L P+K 
Sbjct: 476 QTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKN 535

Query: 533 VLLQRKRDRERAWQENFGDKSVNLSSD-SDSDIEIV 567
              +++  RE  WQ++FG K    +SD S SD+EI+
Sbjct: 536 EWFKKRSHREEVWQKHFGSKETKETSDGSASDLEII 571

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/580 (48%), Positives = 391/580 (67%), Gaps = 18/580 (3%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKSK-DPNFDA 59
           MNDPREV+ TDP+  ++SDE+D+  +   +  +ER+++DL+ R+K K++ K   DPNF  
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 60  IQVESSPVKKPAESIKVEPSRTKRVLDI--ENLNEKKVESRS-QIPANTTSYFIDNFRNX 116
           +QV  SPVKK   ++ V   ++   ++I  EN NE ++  +S Q+P+NTT+YF++ F+  
Sbjct: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKS 120

Query: 117 XXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQRYISQDDLRKV 176
                            RVHTF+   G  +FK         YS++W+K+RYI Q +LRK+
Sbjct: 121 KKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKM 180

Query: 177 LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236
           LH +KILRLSKLFAK++PPKF+EPQYSNWA +GIISAKG  KF+++ KP KY KFT+TDF
Sbjct: 181 LHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDF 240

Query: 237 QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296
           Q+ LDVY+FGK GVERYYNLRVGD++AILNPEV PWRPS KG FIKSFNLRI+HDF CIL
Sbjct: 241 QHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFKCIL 300

Query: 297 EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356
           EIG S+D+ +CK  +++    C TPIN +KE  CD+H+EI+FR N++KRIELNGSFALGA
Sbjct: 301 EIGSSKDLGFCKVTSRN-GTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFALGA 359

Query: 357 PTKVDSGPALYREKSAGA------HRNFKVLPNHYQKSVGKNS-DLRGIHFSNGNAAKAF 409
           PTKV++ P LYR+K+          +NF V  +    S+ K+  DLR  HFSN N+AKAF
Sbjct: 360 PTKVENNPTLYRKKNGETRHSRKNRQNFSVSASF--GSINKDQFDLRNRHFSNNNSAKAF 417

Query: 410 FNDEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEI-EKGSKKYEEICET 468
           F+++FQNPD+LNNL               + ++L +     A+ ++ E+ + + +++   
Sbjct: 418 FDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQMKRA 477

Query: 469 TEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNG---QLNKKQKEVSSLLKFKKEHV 525
           TE TLQSG+IQ LGFDPTHG+I NVL+     +  +    Q++ K+ +V+ LL F+K HV
Sbjct: 478 TETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRKSHV 537

Query: 526 ELKPAKEVLLQRKRDRERAWQENFGDKSVNLSSDSDSDIE 565
            L P +  L++R+  RER WQENFG K   +S++    IE
Sbjct: 538 ILAPTRNELIERRDRRERIWQENFGQKRKPISANDLLAIE 577

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/577 (48%), Positives = 381/577 (66%), Gaps = 15/577 (2%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKS-KDPNFDA 59
           M+DPRE++  DP+  +TSDEED++ +  ++  +ER+++ L+ERLK K+  K   DPNF+A
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 60  IQVESSPVKKPAESIKVEPSRTKRVLDIENLNEK---KVESRSQIPANTTSYFIDNFRNX 116
           I+V  SP K   +S      +    L+  N NE    +++ + ++P NTT+YF+  F+N 
Sbjct: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120

Query: 117 XXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQRYISQDDLRKV 176
                            RVHTF G D N K+K         +S+LWVK+RYI +DDL++ 
Sbjct: 121 KKDEDRQIAKFESMMDARVHTF-GTD-NKKYKPIIANELEGFSNLWVKKRYIPEDDLKRS 178

Query: 177 LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236
           LHE+KILRL KLFAK++PPKF  P+Y+NWA +G+IS K  +KF+SS KP+K+F FT+TDF
Sbjct: 179 LHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 238

Query: 237 QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296
           Q+ LDVY+FGKKGVERYYNLR+GDI+AILNPEVLPWRPS +GNFIKSFNLRISHDF CIL
Sbjct: 239 QHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 298

Query: 297 EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356
           EIG SRD+ WC   N   +K CG+PIN +  KCCD+HRE+QFR   AKRIELNG +ALGA
Sbjct: 299 EIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGA 358

Query: 357 PTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLR--GIHFSNGNAAKAFFNDEF 414
           PTKV+S P+LY+ K  G +R F ++ +  +    +   ++    +F+N N+AKAFF+++F
Sbjct: 359 PTKVNSQPSLYKAK--GENR-FNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKF 415

Query: 415 QNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTEATL 473
           QNPD+L NL               L ++L +I  R  +  +E K   + +++ +TTE  L
Sbjct: 416 QNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENAL 475

Query: 474 QSGLIQNLGFDPTHGEIGNVLKQAAK-DKSNNGQLNKKQKEVSSLLKFKKEHVELKPAKE 532
           Q+GLIQ LGFDPTHGEI  VLK +    +S N  LN K+  ++ LL +KKE V L P+K 
Sbjct: 476 QTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKN 535

Query: 533 VLLQRKRDRERAWQENFGDK--SVNLSSDSDSDIEIV 567
              +++  RE  WQ +FG K  +   S  S SD+EI+
Sbjct: 536 EWFKKRNHREEVWQRHFGPKGEAEEASDASASDLEII 572

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/579 (47%), Positives = 381/579 (65%), Gaps = 20/579 (3%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLK-SKDPNFDA 59
           M+DPRE +  DP+  +TSDE+D++ +  ++  +ER+K+ LVERLK K++ K ++DPNF+A
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 60  IQVESSPVKKPAESIKVEPSRTKRVL-----DIENLNEKKVESRSQIPANTTSYFIDNFR 114
           I+V  SP K    +I    +  KR +     +I +L   +++ + ++P+NTT YF+  F+
Sbjct: 61  IEVPQSPAKN--RNIMKSQNTMKRDMRPAASNINDLKLSQLQQKQELPSNTTGYFMQKFQ 118

Query: 115 NXXXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQRYISQDDLR 174
           N                  RVHTF G D   +++         +S++WVK+RYI +DDL+
Sbjct: 119 NAKRNEEKQRAKYENMMNARVHTF-GTD-KKEYRATIANELEEFSNIWVKKRYIPEDDLK 176

Query: 175 KVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLT 234
           + LHE+KILRL KLFAKI+PPKF EP Y+NWA +G+IS K  VKF+SS KP K+F FT+T
Sbjct: 177 RALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTIT 236

Query: 235 DFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPC 294
           DFQ+ LDVY+FGKK VERYYNLR+GD++AILNPEVLPWRPS +GNFIKSFNLRISHDF C
Sbjct: 237 DFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKC 296

Query: 295 ILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFAL 354
           ILEIG SRD+ WC   N+ +N+ CG+PIN    KCCD+HRE+QFR   AKRIELNG +AL
Sbjct: 297 ILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYAL 356

Query: 355 GAPTKVDSGPALYREKSAGAH---RNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKAFFN 411
           GAPTKVD+ P LYR K        R+ +   +  ++ + KNS     +F N N+AKAFF+
Sbjct: 357 GAPTKVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSH----NFRNSNSAKAFFD 412

Query: 412 DEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTE 470
           ++FQNPD+L NL               L ++L +I  R  +  +E K  ++ ++I +TTE
Sbjct: 413 EKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTE 472

Query: 471 ATLQSGLIQNLGFDPTHGEIGNVLKQAAK-DKSNNGQLNKKQKEVSSLLKFKKEHVELKP 529
           + LQ+GL+Q LGFDPTHG+I  VLK +    +  N  +  K+  +  LL +KKE V L P
Sbjct: 473 SALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAP 532

Query: 530 AKEVLLQRKRDRERAWQENFGDKSVNLSSD-SDSDIEIV 567
           +K    +++  RE  WQ++FG K  +  SD S SD+EIV
Sbjct: 533 SKNEWFKKRSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  511 bits (1316), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 268/593 (45%), Positives = 388/593 (65%), Gaps = 35/593 (5%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKR-QLKSKDPNFDA 59
           M+DPRE+   D +  +T D+ED R +E ++ +IE  KRDL+ERL  K+ +++ +DPNF  
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 60  IQVESSPVKKPAESIKVEPSRTKRVLDI-------ENLNEKKVESRSQIPAN-------T 105
           +QV +SPVKK    +++   + +++ +I       EN NE  ++ R Q           +
Sbjct: 61  VQVPASPVKK--HELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNAS 118

Query: 106 TSYFIDNFRNXXXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQ 165
           T YF++ FR+                  RVHTF GI+  ++++         YS+LW+ +
Sbjct: 119 TEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINK 178

Query: 166 RYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKP 225
           RY    +L+ +LHEVKILRL+KLFAK++PPKF EPQYSNW  +GI+S K  +KF++S KP
Sbjct: 179 RYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKP 238

Query: 226 MKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFN 285
            KY KFTLTDF++ +D Y+FGK+GVERYYNLR+GDI+A+LNPE+LPWRPS K N+IKSFN
Sbjct: 239 QKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFN 298

Query: 286 LRISHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKR 345
           LRISH + CILEIG+SRD+  C    +S +K CG PINK  ++CC++HRE++ R   +KR
Sbjct: 299 LRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKR 358

Query: 346 IELNGSFALGAPTKVDSGPALYREKSAGAHR--NFKVLPNHYQKS------VGKNSDLRG 397
           ++L+G +ALGAPTK++S PALYR  +A   +  NFK+ P++ Q +       G+ S    
Sbjct: 359 LDLSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKF-- 416

Query: 398 IHFSNGNAAKAFFNDEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEIEK 457
             FSN NAAKAFF+DEFQNPD+++NL              +L ++L R+  +   +E  K
Sbjct: 417 --FSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQDLE-GK 473

Query: 458 GSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQ---LNKKQKEV 514
             ++ E++ +TT+ TLQSGL Q +GFDPT G+I  +LK   K++S +G+   L++K + V
Sbjct: 474 TREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKN--KERSKDGEPKFLSQKDRTV 531

Query: 515 SSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDKSVNLSSDSDSDIEIV 567
             L+ FKKE++ L P+K  LL +K  RE+ WQENFG    N +S+SDSD+EIV
Sbjct: 532 DDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQNKSNDNSESDSDLEIV 584

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  481 bits (1239), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 272/584 (46%), Positives = 375/584 (64%), Gaps = 28/584 (4%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKSK-DPNFDA 59
           MNDPRE  + D +  L+SDE +Q E+ +Q+  IERQK+DL+ERLK K++ KSK DPNF  
Sbjct: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 60  IQVESSPVKKPAESIKVEPSRTKRVLDIENLNEKKVESRSQIPAN--TTSYFIDNFRNXX 117
           +QV SSP K     +K          + E  N  +V   ++  +N  TTSYF++ F N  
Sbjct: 59  VQVPSSPKKSRVVELKPTSKPIDNNEEEEEENPNEVALMTKDDSNYGTTSYFMEKFYNSK 118

Query: 118 XXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQRYISQDDLRKVL 177
                           RVHTF G     +FK         YS+LW++ RYI  D+L  +L
Sbjct: 119 KDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLML 178

Query: 178 HEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDFQ 237
            ++KILRL KLFAK++PPKF EPQYSNW   GII++K  +K++SS KP KYFKFT++DFQ
Sbjct: 179 LDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDFQ 238

Query: 238 YNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSE----KGNFIKSFNLRISHDFP 293
           +NLDV++FG KGVE+YYNLRVGD+VAILNPE+LPWRPSE     G+ IKSFNLRISH F 
Sbjct: 239 HNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKFD 298

Query: 294 CILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFA 353
           CILEIG SRD+ WC   N S+N  C TPINK+KE  C +HREIQFR   + R+EL+G++A
Sbjct: 299 CILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTYA 358

Query: 354 LGAPTKVDSGPALYREKSAGAHRNFK-----VLPNHYQKSVGKNS-DLRGIHFSNGNAAK 407
           LGAPTKVD+ PALY+ +    +   +     V  +HYQK    N  + R  HFS  N+AK
Sbjct: 359 LGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSAK 418

Query: 408 AFFNDEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEIEKGSKKYEEICE 467
           AFF+++FQNPDILNNL               L + LK          ++K SK ++ +  
Sbjct: 419 AFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNT--------VDKESKNFKNLKN 470

Query: 468 TTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDK--SNNGQLNKKQKEVSSLLKFKKEHV 525
            T+ATLQ+G++Q LGFDPT G++ +V++ +  +   +N  Q+ KK+  +  L+ F+K+ V
Sbjct: 471 ATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKE-ALDDLMTFRKDTV 529

Query: 526 ELKPAKEVLLQRKRDRERAWQENFGDK--SVNLSSDSDSDIEIV 567
            LKP+K+ L++R+ DR+R W++ FG +  S++ + DS SD++I+
Sbjct: 530 NLKPSKDDLIKRRIDRQRNWKKLFGKQQSSIDNNDDSGSDLKIL 573

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  469 bits (1207), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 246/545 (45%), Positives = 355/545 (65%), Gaps = 19/545 (3%)

Query: 41  VERLKSKRQLKSK-DPNFDAIQVESSPVKKPAE-SIKVEPSRTKRVLDIENLNEKKVESR 98
           ++RLK+K++ + K DPNF  IQ++ SP KK +  +  V P   KR+++  N NE KV S 
Sbjct: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDVNPNEAKVVSN 60

Query: 99  SQIPANTTSYFIDNFRNXXXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXY 158
           + +PANTTSYF+ NF                    RVH+F G + + K++         Y
Sbjct: 61  ANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEEY 120

Query: 159 SDLWVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVK 218
           S   + +RY+ ++++ K LH +KILRL+KLFAKI+PPKF+EP Y+NWA  GII +K  +K
Sbjct: 121 SRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIK 180

Query: 219 FSSSGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKG 278
            +SS  P+K+FKFT+T+FQ+ LD+++FG  GVE+YYNLRVGDI+ ILNPEVLPWRP  KG
Sbjct: 181 LTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEFKG 240

Query: 279 NFIKSFNLRISHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQF 338
           N IKSFNLRISH F CILEI +S+DI WC+  N+     C TPINK+K+  CD+H+E+QF
Sbjct: 241 NSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEMQF 300

Query: 339 RSNHAKRIELNGSFALGAPTKVDSGPALYREKSAGAHR---NFKVLPNHYQKSVGKNSDL 395
           RS +AKR+EL+G++ALGAPT++DS PALYR K+    +   NF ++ +       +N  +
Sbjct: 301 RSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKENDPI 360

Query: 396 --RGIHFSNGNAAKAFFNDEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAI 453
             +  HFS+ N+AKAFF+++FQNPD+L NL             ++LQ+ L+        +
Sbjct: 361 NSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRALRESVGNSKLL 420

Query: 454 EIEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNK-KQK 512
             +K +++ + +  TT+ATLQ+G IQ LGFDPT G+I  VL+++A DKS   +L K K  
Sbjct: 421 LKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSA-DKSTQSKLQKQKSN 479

Query: 513 EVSSLLKFKKEHVELKPAKEVLLQRKRDRERAW---------QENFGDKSVNLSSDSDS- 562
            + +L+ FKK  V LKP++EVLL++   RE+++          EN   KS +  +D+DS 
Sbjct: 480 AMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSASTKNDTDSD 539

Query: 563 DIEIV 567
           D+EI+
Sbjct: 540 DLEII 544

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  469 bits (1208), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 259/593 (43%), Positives = 368/593 (62%), Gaps = 43/593 (7%)

Query: 2   NDPREVVQTDPFGELTSDEEDQR-ELEDQIVEIERQKRDLVERLK-SKRQLKSK--DPNF 57
           NDPREV   DP+ +L+ D+++Q  +++ ++  IER+K+DL+ RLK +KR+L SK  DPN 
Sbjct: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 58  DAI------QVESSPVKKPAESIKVEPSRTKRVLDIE----------NLNEKKVESRSQI 101
             I      +V  SP +   ES+  + +    V  +           N NE+ +  +   
Sbjct: 67  KNINSRGRVEVPRSPKR---ESLPAQENLQHNVPQVTHNQAANNKKANPNEEDIVRKELD 123

Query: 102 PANTTSYFIDNFRNXXXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDL 161
              TTSYF + F+N                  R HTF G       K         YS+ 
Sbjct: 124 VVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNF 183

Query: 162 WVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSS 221
            +K+RYI +D++ K+LH +KILRL+KLFAK++PP F+EPQYSNW  IG IS+K  VK ++
Sbjct: 184 HIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTN 243

Query: 222 SGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFI 281
           + KP+KYFKFTLTDF++NLDVYVFGKK VERYYNLRVGDI+A+LNPE+LPWRPS   N I
Sbjct: 244 AAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGI 303

Query: 282 KSFNLRISHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSN 341
           KSFNLRI HDF CILEIG SRD+ WC+  N  Q+K C +PIN   ++CC+FHRE+Q RS 
Sbjct: 304 KSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRST 363

Query: 342 HAKRIELNGSFALGAPTKVDSGPALY------REKSAGAHRNFKVLPN-HYQKSVGKNSD 394
            +KRIEL+GS+ALGAPTKV + P++Y      R  +   H+ F +  +   ++   +  +
Sbjct: 364 ASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSKKEQEKEKHE 423

Query: 395 LRGIHFSNGNAAKAFFNDEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIE 454
           +   HFSN  AAKAFF+D FQ+P +L NL               L   LK +N   A+  
Sbjct: 424 IEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNL---LKALNGEDAS-- 478

Query: 455 IEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEV 514
               SK  +++ E TE TLQ+G+IQ LGFDP+ G+I  VL ++   K+++  ++KK   +
Sbjct: 479 ---QSKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPTISKKMGLI 535

Query: 515 SSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDKSVNLSSDSDSDIEIV 567
           + L+ FKK+ ++LKP++E+ L+++  RE  W+++F D     ++DSDSD+EIV
Sbjct: 536 NDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQD-----TNDSDSDLEIV 583

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  465 bits (1196), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 258/598 (43%), Positives = 366/598 (61%), Gaps = 35/598 (5%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQL-KSKDPNF-- 57
           MNDPREV + D F  ++ DE+++ EL+ QI  IERQKRDL ERL+ KR++ ++ DPNF  
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 58  -----DA-----IQVESSP--VKKPAESIKVEPSRTKRVLDIENLNEKKVESR---SQIP 102
                DA     IQV  SP  +K+    +   P   K     +N NE K++++   + +P
Sbjct: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120

Query: 103 ANTTSYFIDNFRNXXXXXXXXXXXXXXXXXKRVHTFRGIDGNHK-FKXXXXXXXXXYSDL 161
           A +T+YF++NF +                  RVH+F       K  +         YS L
Sbjct: 121 AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180

Query: 162 WVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSS 221
           W+ +RY+ ++ + ++L ++KILRL+KLFAKI+PPKF  PQYSNW  +G+I+ K   K +S
Sbjct: 181 WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240

Query: 222 SGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFI 281
           S  P KYFKFT+ DFQ N+ ++VF ++ + +YYNLRVGDI+ ILNP + PWRPSE+  +I
Sbjct: 241 SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 300

Query: 282 KSFNLRISHDFPCILEIGQSRDIDWCKSFNKSQ-NKACGTPINKTKEKCCDFHREIQFRS 340
           KSFNL I   + CI+EIG+SRD+ WC    KS+  K CGTPINKTK+KCC+FHRE +FR+
Sbjct: 301 KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 360

Query: 341 NHAKRIELNGSFALGAPTKVDSGPALYREKSAGAH--RNFKVLPNHYQKSVGKNSDLRGI 398
             AKRIELNGSFALGAPTK D+ P+LY++K+   +    F V+     +  G +S L   
Sbjct: 361 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEG-DSKLHNS 419

Query: 399 HFSNGNAAKAFFNDEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEIEKG 458
           +F + N AKAFFNDEFQNPDI++NL               L ++L +  ++   +     
Sbjct: 420 NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLE 479

Query: 459 SKKYEEICET---TEATLQSGLIQNLGFDPTHGEIGNVLKQA-AKDKSNNGQLNKKQKEV 514
            K  E++ E    TE  +Q G+++N+G+DPTHG++  ++K++  KD S     + +   V
Sbjct: 480 GKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPS---YTSNRSNAV 536

Query: 515 SSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDKS-----VNLSSDSDSDIEIV 567
           + LL FKK+ V LKP K  LL +KR R+  W E FGD+S     + LSS  DSD+EIV
Sbjct: 537 NDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLEIV 594

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  457 bits (1177), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 253/615 (41%), Positives = 365/615 (59%), Gaps = 52/615 (8%)

Query: 3   DPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKR-QLKSKDPNFDA-I 60
           DPR+V+  DP+  +TSDE+++ +++ ++ E+ER+K+DL +RLK KR  +K  D N    +
Sbjct: 4   DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 61  QVESSPVKKPAESIKVEPSR-------TKRVLDIE-------NLNEKKV-----ESRSQI 101
           QV SSP K+   +I V   R        KR L +        NLNE +      +   Q 
Sbjct: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123

Query: 102 PANTTSYFIDNFRNXXXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDL 161
              TTSYF++ F+                   RVHTF+G+D   +F+         +SDL
Sbjct: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVD--KEFQLEAVNELEQFSDL 181

Query: 162 WVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSS 221
           W+ +RYI +  L + L +VK+LRL+KLFAK++PPKF EPQYSNWA + IIS K +VKF++
Sbjct: 182 WISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTT 241

Query: 222 SGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRP---SEKG 278
           S  P K+ +FTLT+FQ  LD++VFG  GV+RYYNLR GDIVA+LNPE+LPWRP   S++ 
Sbjct: 242 SKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQT 301

Query: 279 NFIKSFNLRISHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQF 338
             IKSFNL+I+H F CILEIG+SRD+ +C    K  N+ CG+ IN  +++ C++HRE+Q 
Sbjct: 302 TSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQM 361

Query: 339 RSNHAKRIELNGSFALGAPTKVDSGPALYREKSAGAHRNFKVLPNHYQK----------- 387
           R N +KR++LNG FALGAPTKV + P L+RE S    ++ + LP    K           
Sbjct: 362 RQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNSR 421

Query: 388 -----SVGKNSDLRGIHFSNGNAAKAFFNDEFQNPDILNNLXXXXXXXXXXXXXLILQQQ 442
                S  +N  L+G  F++ NAAKAFF+DEFQNPD+L+NL               L ++
Sbjct: 422 HGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDRK 481

Query: 443 LKRINSR-HAAIEIEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDK 501
           LKR+ S+      ++K + +   +  TTE  L +GLIQ LGFDPTHG   +V+K+   ++
Sbjct: 482 LKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSER 541

Query: 502 SNNGQ----LNKKQKEVSSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDKSVNLS 557
            +       L++K+  V+ LL++K++   L P++  L  RK+ R   W+E FG K   + 
Sbjct: 542 GSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGTPVD 601

Query: 558 S-----DSDSDIEIV 567
           S     D   D+EIV
Sbjct: 602 SQPVDNDDSDDLEIV 616

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  456 bits (1174), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/610 (42%), Positives = 376/610 (61%), Gaps = 43/610 (7%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKS-KRQLKSKDPNFDA 59
           MNDPRE    DPF +L+  EE++  + +++ +++R+K DL+ RLK  K + K +DPNFD 
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 60  IQVESSPVKKPAESIKVEPS----RTKRVLD----------IENLNEKKVESRSQ----I 101
           +Q+  +P +K       E +    R ++  +          + N NE KV  R +    +
Sbjct: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKL 120

Query: 102 PANTTSYFIDNFRNXXXXXXXXXXXXXXXXXKRVHTFRGIDGNHK-----FKXXXXXXXX 156
           P+NTTSYF++ F++                  RVH F+G++ + K     ++        
Sbjct: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 157 XYSDLWVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQ 216
            YS L +++RYI + +L  +   +KILRL+KLFAK++PPKF EPQYSNW  +GII+ KG 
Sbjct: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 217 VKFSSSGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPS- 275
           +KF+SS KP KYFKFT++DF+YN+D+++F K  VERYYNLR+GDI+AILNPEVLPWRPS 
Sbjct: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300

Query: 276 -EKGNFIKSFNLRISHDFPCILEIGQSRDIDWCKSFNK-SQNKACGTPINKTKEKCCDFH 333
            + G  IKSFNLRI+H++ CI+E+G+S+D+ +C   NK +++  C TPI+ +KE  C +H
Sbjct: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360

Query: 334 REIQFRSNHAKRIELNGSFALGAPTKVDSGPALYREKSAGA----HRN-FKVLP-NHYQK 387
           +EI+FR+N +KRIELNGSFALGAP KV + P LYR  +       H N F V+  +  +K
Sbjct: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420

Query: 388 SVGK-NSDLRGIHFSNGNAAKAFFNDEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKRI 446
           +  K   + R  +FS+ N+AKAFF+++FQNPD+L NL               L Q+L + 
Sbjct: 421 NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA 480

Query: 447 --NSRHAAIEIEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNN 504
             N     +   K  K+Y ++   TE TLQ+G+IQ LGFDPTHG+I  VL+       +N
Sbjct: 481 IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSGKDN 540

Query: 505 GQLNKKQKEVSSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFG------DKSVNLSS 558
                K ++V  LL+FKK  V L PAKE L++RK  RE  WQ++FG      ++ +N   
Sbjct: 541 VHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLNDDV 600

Query: 559 D-SDSDIEIV 567
           D S+SD+EIV
Sbjct: 601 DTSESDLEIV 610

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  440 bits (1132), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 248/584 (42%), Positives = 350/584 (59%), Gaps = 27/584 (4%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKSK-DPNFDA 59
           M DPRE  + D F EL+ DE+D  +L  ++ E+ER+K+DL +RL+   Q K K DPNF  
Sbjct: 1   MEDPREPREIDIFDELSCDEDD--DLHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 60  IQVESSPVKKPAESIKVEPSRTKRVLDI-----ENLNEKKVESRSQIPANTTSYFIDNFR 114
           ++V  SP K    ++K E SR+K   +      ENLNE +V+ ++ + + +T YF  NF 
Sbjct: 59  VEVPRSPSKSKHVAVK-ETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFAQNFS 117

Query: 115 NXXXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQRYISQDDLR 174
           +                  RVHTF G D   ++          +S  W+ +RYI+ +  R
Sbjct: 118 SSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQAR 177

Query: 175 KVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLT 234
           K+L E K+LRL KLFAK++PP F EPQYSNW  IGIISAK  VK ++  KP +YF  TLT
Sbjct: 178 KILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLT 237

Query: 235 DFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSE------KGNFIKSFNLRI 288
           DF++ +++Y+FG K VE+YYNL+VGDI+A+LNPE+ PWRPS+          IKSFNL I
Sbjct: 238 DFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCI 297

Query: 289 SHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIEL 348
            H+F  ILEIG SRD  +C  +NK Q K CGTPINK+ E  C +H+E+QFR  +AKR+EL
Sbjct: 298 KHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLEL 357

Query: 349 NGSFALGAPTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKA 408
           NG+ +L +PTK      LY +  +G    + +LP+ Y            ++FSN NAA+A
Sbjct: 358 NGNKSLRSPTKNGVKHILYGKNKSGK---YDLLPDRYAPQTQSKDSQNVLYFSNPNAARA 414

Query: 409 FFNDEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKR-INSRHAAIEIEKGSKKYEEICE 467
           FF+D++QNPD LNNL              +LQ+QL++ I   ++ +   + S K +EI  
Sbjct: 415 FFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTKQDEIRR 474

Query: 468 TTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKKEHVEL 527
            T+  L+SGLI+ +GFDPT G + +VLK  +K          K   V  +L+ KKE +EL
Sbjct: 475 ATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQA----KNSAVEEILQIKKEKIEL 530

Query: 528 KPAKEVLLQRKRDRERAWQENF-GDKSVNL---SSDSDSDIEIV 567
           KP+KE L Q+ + RE  W  +F  +++ N    SSD DS++EIV
Sbjct: 531 KPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGDSELEIV 574

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  418 bits (1075), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 229/559 (40%), Positives = 330/559 (59%), Gaps = 19/559 (3%)

Query: 3   DPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSK-RQLKSKDPNFDAIQ 61
           DPREV+Q D    +TSDE++  +++ Q+ E+ERQ+RDL +RL+ K  + K++  + + ++
Sbjct: 6   DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERVE 65

Query: 62  VESSPVKKPAESIKVEPSRTKRVLDIE---NLNEKKVE-SRSQIPANTTSYFIDNFRNXX 117
           V +SP  K     K  P   K    I    N N   +E      P+NTTSYF++NF N  
Sbjct: 66  VPASP--KEERKSKASPQSQKSSKGITLAANSNNDSIEVPWKNGPSNTTSYFVENFVNAR 123

Query: 118 XXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQRYISQDDLRKVL 177
                           RVHTF+GID     +         YS   + +RY+S  +L +++
Sbjct: 124 KVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIM 183

Query: 178 HEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDFQ 237
            E+K+LRL KLF+K++PPKF EP Y+NW  IGIIS K +VK +SS KP KYFK TLTDF 
Sbjct: 184 REIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFT 243

Query: 238 YNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSE------KGNFIKSFNLRISHD 291
           +NLD+Y+F  K VE+YYNLRVGDI+AILNP++LPWRPS+       G  +KSFNL I H+
Sbjct: 244 HNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHN 303

Query: 292 FPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGS 351
           F C+LEIG S+D+ +C+  NK+  KACG PIN+     C++H++++FR  +A+R+ELNGS
Sbjct: 304 FDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGS 363

Query: 352 FALGAPTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKAFFN 411
            +L +P K     ALY   ++G  R  ++LP+ +            + FSN N AKAFF+
Sbjct: 364 TSLRSPVKNGKKQALY--GTSGVKRKLQLLPDKHAPQAQDGESQNTLFFSNPNYAKAFFD 421

Query: 412 DEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEIEKGSKKYE-EICETTE 470
           D +QNPD+LNNL               LQ QL     +         SK+ + ++ + TE
Sbjct: 422 DSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDATE 481

Query: 471 ATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKKEHVELKPA 530
             L SGL++++GFDP  G++  VLK     K+ N  LN K  +V  ++ FKK +V L P+
Sbjct: 482 QVLNSGLLRDIGFDPFRGKMREVLKFG---KNVNSGLNSKSSQVKEIMSFKKSNVSLAPS 538

Query: 531 KEVLLQRKRDRERAWQENF 549
           K    +R   RE+ W+E+F
Sbjct: 539 KAEQKKRLLRREQVWREHF 557

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  373 bits (958), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 197/471 (41%), Positives = 280/471 (59%), Gaps = 18/471 (3%)

Query: 110 IDNFRNXXXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQRYIS 169
           ++NF N                  RVHTFRG+      K          S LWV +RYI+
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 170 QDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYF 229
            D+L ++L ++KILRL KLF+K++PPKF EP Y+NW  +GI+  K  VK +SS KP KYF
Sbjct: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 230 KFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGN------FIKS 283
           K T+TDF ++LDVYVF    VE+YYNLRVGDI+AILN ++LPWRPS+ GN       +KS
Sbjct: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 284 FNLRISHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHA 343
           FNL I  ++ C+LEIG SRD+ +C+ +NK++ K CG PIN+     CD+H+EI+FR  +A
Sbjct: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 344 KRIELNGSFALGAPTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLRGIHFSNG 403
           +R+ELNGS +L +P K     ALY   S+G  R   +LP+ +            ++FSN 
Sbjct: 241 QRVELNGSMSLRSPVKNGKKQALY--GSSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNP 298

Query: 404 NAAKAFFNDEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEI-EKGSKKY 462
           N AKAFF+D +QNPD+L NL               LQ QL R   +       EK  ++ 
Sbjct: 299 NYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQEQ 358

Query: 463 EEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKK 522
           +++ + TE T+ SGL++N+GFDPT G++ +VLK     K++    + K  +V  +++ +K
Sbjct: 359 KQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVG---KNSKNSTDTKSIQVREIIETRK 415

Query: 523 EHVELKPAKEVLLQRKRDRERAWQENF---GDKSVN---LSSDSDSDIEIV 567
            +V L P+K    +R   RE+ W+E+F    D + N    S  SDSD+EIV
Sbjct: 416 TNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  336 bits (862), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 205/614 (33%), Positives = 330/614 (53%), Gaps = 56/614 (9%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRE----------LEDQIV-------------EIERQK 37
           +NDPRE+V T  + ++ SDEED  E           ED  +             +IE ++
Sbjct: 6   LNDPREIVPTSNY-DILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64

Query: 38  RDLVERLKS-KRQLKSKDPNFDAIQVESSPVKKPAESIKVEPS-RTKRVLDIENLNEKKV 95
            DL+ RL+  K + K K      ++V  SP K  A+ ++ EP+  T          E+  
Sbjct: 65  SDLLARLEELKHRSKKKAKKSPTVEVPRSPTK--AKCVEDEPAPSTSASTTYVEEPEENE 122

Query: 96  ESRSQIPANT--TSYFIDNFRNXXXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXX 153
             R  + ANT  TSYF + F                   +RV+TF   D   ++      
Sbjct: 123 NERYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVD 182

Query: 154 XXXXYSDLWVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISA 213
               YS++ + +RY+ ++DL+++LH++K+LRL KLFAK++PPKF+EP Y+NW  +G IS 
Sbjct: 183 EVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISY 242

Query: 214 KGQVKFSSSGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWR 273
           K  VK +S  KP KYF   +TDF Y++ + VFG+K VE+YY LRVGD++AILNPE+ PW+
Sbjct: 243 KSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWK 302

Query: 274 PSEKG------NFIKSFNLRISHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKE 327
            S K          +SF L I H+  CILEIG S+++ +C + NK++   CG PINK KE
Sbjct: 303 ESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKE 362

Query: 328 KCCDFHREIQFRSNHAKRIELNGSFALGAPTKVDSGPALYREKSAGAHRNFKVLPNHYQ- 386
           + C +H+E   RS +AKR+ELNG+ +L APT+     A Y  +++   +   +LP+ Y  
Sbjct: 363 QVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTK-IGLLPDVYAP 421

Query: 387 KSVGKNSDLRGIHFSNGNAAKAFFNDEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKRI 446
           ++ G     R  HF++ NA +A+F+ ++ NPD+L NL               + +QL  +
Sbjct: 422 RAPGAEQKFRE-HFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLV 480

Query: 447 NSR-HAAIEIEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNG 505
             + H  ++     +  ++  + T+  +++G+++++GFDPT G +  VL Q     ++  
Sbjct: 481 LGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPAD-- 538

Query: 506 QLNKKQKEVSSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDKSV----------N 555
               ++  +S +L  KK +++LKP+KE   +R + R   +   F +++V           
Sbjct: 539 --TVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCETAQ 596

Query: 556 LSS--DSDSDIEIV 567
           LSS   SD ++EIV
Sbjct: 597 LSSADSSDEELEIV 610

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  309 bits (792), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 198/586 (33%), Positives = 315/586 (53%), Gaps = 32/586 (5%)

Query: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERL---KSKRQLKSKDPNF 57
           + DPRE+   DP+ EL+ DE +   ++ +IVEI+ +KRDL  RL   + KR LK  DPNF
Sbjct: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLK--DPNF 62

Query: 58  DAIQVESSPVKKPAESIKVEPSR-TKRVLDIE----NLNEKKVESRSQIPANTTSYFIDN 112
           D+I V  SP K    +  +E  +    V DIE    N+NE  V  + +    TTSYF + 
Sbjct: 63  DSIDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVK-KLGTTSYFTEK 121

Query: 113 FRNXXXXXXXXXXXXXXXXXKRVHTFRGIDGNHKFKXXXXXXXXXYSDLWVKQRYISQDD 172
            R+                  RV+TF G D   +++          S L + +RY+    
Sbjct: 122 LRSINTNEHEAIKRKKELLAHRVYTFNG-DMFDEYEPITVDEKDDLSGLVIDRRYVPLAV 180

Query: 173 LRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFT 232
           LRK    +K+LRL KLF+K++ PKF+EP Y NW  +GIIS K + + ++S KP+K+F  T
Sbjct: 181 LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240

Query: 233 LTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGN--FIKSFNLRISH 290
           ++DFQ+ L+V  FGK  VE+YY LR+GD++AILNPE++P +  E G      +F+L++S 
Sbjct: 241 ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSK 300

Query: 291 DFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNG 350
           D   ILE+G S++   C+ + K++ K CG PINK  +  C +H+E + R N ++R+E++ 
Sbjct: 301 DTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISS 360

Query: 351 SFALGAPTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGK-------NSDLRGIHFSNG 403
           S A+ AP  V  G   Y++    +  N       YQ++  K        ++     FS+ 
Sbjct: 361 SVAMRAP--VVKG---YQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSA 415

Query: 404 NAAKAFFNDEFQNPDILNNLXXXXXXXXXXXXXLILQQQLKRINSRHAAIEIEKGSKKYE 463
           NA+ AFF+D+++NPDIL NL               L+++LK ++ +  + + ++ +++ +
Sbjct: 416 NASTAFFDDDYENPDILANLDNKRRKIQELRNNRNLEKKLKGLSDKLLSKKEDRVNQEAK 475

Query: 464 EICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKKE 523
           +    T +  Q GL   +G+DPT G+    L+       N    N KQ  ++ +   KK+
Sbjct: 476 KTA--TLSMFQHGLANQIGYDPTKGKAS--LEMLEYSTENKAPKNDKQLAITDICNIKKD 531

Query: 524 HVELKPAKEVLLQRKRDRERAWQENFGDKSVNLSSD--SDSDIEIV 567
           +V LKP+K+ L ++   R   + E        L  D  S  D+EI+
Sbjct: 532 NVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577

>Ecym_7404 Chr7 complement(831674..832756) [1083 bp, 360 aa] {ON}
           similar to Ashbya gossypii ABL045W
          Length = 360

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 59/117 (50%), Gaps = 13/117 (11%)

Query: 452 AIEIEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDK--SNNGQLNK 509
           A  + + +K+++EI     A  Q G+++NL         G++L+Q AKD   S    LN 
Sbjct: 216 AKSLSQLAKEHQEILHEMSAANQDGVVRNL---------GDILEQKAKDDNCSTVDNLNY 266

Query: 510 KQKEVSSLLKFKKEHV--ELKPAKEVLLQRKRDRERAWQENFGDKSVNLSSDSDSDI 564
            +K   ++++   + +  E++P + +  Q  + +++A  E  G +S   S D D+ I
Sbjct: 267 AKKRRRNVIRPALQTIDEEIQPKRNIHEQLAKLKQKALNEFNGVESDTSSDDGDTKI 323

>NDAI0I03150 Chr9 (741840..742394) [555 bp, 184 aa] {ON} Anc_3.552
           YGL231C
          Length = 184

 Score = 32.0 bits (71), Expect = 2.8,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 25/41 (60%)

Query: 493 VLKQAAKDKSNNGQLNKKQKEVSSLLKFKKEHVELKPAKEV 533
           V++++ K ++N G   K+  E++SLL  K   + + PAK +
Sbjct: 38  VIEKSQKKETNTGTDEKRTTEINSLLASKAMQIAMAPAKSI 78

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
           Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 34/64 (53%), Gaps = 10/64 (15%)

Query: 325 TKEKCCDFHREI-QFRSNHAKRI---ELNGSFALGAPTKVDSGPALYREK----SAGAHR 376
           TKE C DF+  I Q  S   K +   EL+ SFA  +P KV+SGP L   K     AGA R
Sbjct: 129 TKETCLDFYNGILQKLSEFKKELRSKELSLSFA--SPQKVESGPTLQEIKFEVLRAGATR 186

Query: 377 NFKV 380
           +  +
Sbjct: 187 SLGL 190

>Suva_13.342 Chr13 complement(563583..565721) [2139 bp, 712 aa] {ON}
           YMR163C (REAL)
          Length = 712

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 48/85 (56%), Gaps = 9/85 (10%)

Query: 18  SDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKSKDPNFDAIQVESSPVKKPAESIKVE 77
           SD E +R+L+++I+++ R+ R+  ERL++ +       +F+ ++   S +K   E    E
Sbjct: 624 SDNELRRKLDERILKLARENREGRERLRTAK-------SFELLRNARSSIK--TEFGFQE 674

Query: 78  PSRTKRVLDIENLNEKKVESRSQIP 102
           P +   VL+  +L++ KV S   IP
Sbjct: 675 PLKKNVVLESGSLSKYKVSSEETIP 699

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,101,541
Number of extensions: 2691689
Number of successful extensions: 13446
Number of sequences better than 10.0: 115
Number of HSP's gapped: 13990
Number of HSP's successfully gapped: 120
Length of query: 567
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 452
Effective length of database: 40,294,809
Effective search space: 18213253668
Effective search space used: 18213253668
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)