Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B021605.704ON37537519260.0
ZYRO0G06556g5.704ON3793568391e-110
NCAS0A031905.704ON3983667911e-102
SAKL0E14960g5.704ON3843297721e-99
KLLA0A00550g5.704ON3803197261e-92
KAFR0H002005.704ON3893297094e-90
Kwal_55.196885.704ON3933887034e-89
KNAG0C066105.704ON3863086991e-88
TPHA0D046205.704ON4063856923e-87
KLTH0E01012g5.704ON3863636809e-86
NDAI0E050505.704ON4513736632e-82
CAGL0G02519g5.704ON3783746294e-78
AFR288C5.704ON4653786261e-76
Kpol_YGOB_Anc_5.7045.704ON2072003794e-43
NDAI0K028706.48ON6621361267e-07
SAKL0E02068g6.48ON5581141161e-05
NCAS0F002306.48ON6051141105e-05
AGR256W6.48ON5791131096e-05
KLTH0C10406g6.48ON5531141097e-05
Ecym_31386.48ON5881131043e-04
TDEL0G042206.48ON632152980.002
KLLA0F20504g6.48ON567114970.002
TPHA0J005306.48ON589133960.002
YOR171C (LCB4)6.48ON624124960.003
Kwal_56.225506.48ON553107920.007
Smik_12.3356.48ON678132910.011
ZYRO0C07084g6.48ON647103910.013
TPHA0F024906.48ON677113900.014
YLR260W (LCB5)6.48ON687132890.018
Suva_8.2246.48ON624125890.018
KAFR0G026206.48ON601106890.021
Skud_12.3406.48ON680131870.032
KNAG0M011106.48ON598131860.044
TBLA0G004306.48ON954111840.081
Smik_15.3496.48ON625124830.093
Suva_10.3586.48ON680131830.11
Skud_15.3336.48ON627124830.11
CAGL0K05995g6.48ON794113820.13
Kpol_1042.16.48ON653114820.15
KAFR0A052506.48ON717114810.17
Kpol_1037.376.48ON622127790.33
NCAS0D025106.48ON646152741.4
NDAI0K026404.142ON41857703.4
NDAI0I023706.48ON760175704.0
CAGL0M01936g3.295ON94758678.2
KNAG0E027306.48ON748111679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02160
         (375 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    746   0.0  
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   327   e-110
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    309   e-102
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   301   1e-99
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   284   1e-92
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      277   4e-90
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   275   4e-89
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   273   1e-88
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   271   3e-87
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   266   9e-86
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   259   2e-82
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   246   4e-78
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   245   1e-76
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   150   4e-43
NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {...    53   7e-07
SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} simila...    49   1e-05
NCAS0F00230 Chr6 (35422..37239) [1818 bp, 605 aa] {ON} Anc_6.48 ...    47   5e-05
AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic ...    47   6e-05
KLTH0C10406g Chr3 complement(862020..863681) [1662 bp, 553 aa] {...    47   7e-05
Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}...    45   3e-04
TDEL0G04220 Chr7 complement(765502..767400) [1899 bp, 632 aa] {O...    42   0.002
KLLA0F20504g Chr6 complement(1902726..1904429) [1704 bp, 567 aa]...    42   0.002
TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6....    42   0.002
YOR171C Chr15 complement(652010..653884) [1875 bp, 624 aa] {ON} ...    42   0.003
Kwal_56.22550 s56 (176751..178412) [1662 bp, 553 aa] {ON} YLR260...    40   0.007
Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260...    40   0.011
ZYRO0C07084g Chr3 complement(533008..534951) [1944 bp, 647 aa] {...    40   0.013
TPHA0F02490 Chr6 (549495..551528) [2034 bp, 677 aa] {ON} Anc_6.4...    39   0.014
YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor...    39   0.018
Suva_8.224 Chr8 complement(402084..403958) [1875 bp, 624 aa] {ON...    39   0.018
KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {O...    39   0.021
Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260...    38   0.032
KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {...    38   0.044
TBLA0G00430 Chr7 (86333..89197) [2865 bp, 954 aa] {ON} Anc_6.48 ...    37   0.081
Smik_15.349 Chr15 complement(608112..609989) [1878 bp, 625 aa] {...    37   0.093
Suva_10.358 Chr10 (627071..629113) [2043 bp, 680 aa] {ON} YLR260...    37   0.11 
Skud_15.333 Chr15 complement(600768..602651) [1884 bp, 627 aa] {...    37   0.11 
CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} simil...    36   0.13 
Kpol_1042.1 s1042 (2298..4259) [1962 bp, 653 aa] {ON} (2298..425...    36   0.15 
KAFR0A05250 Chr1 (1038486..1040639) [2154 bp, 717 aa] {ON} Anc_6...    36   0.17 
Kpol_1037.37 s1037 (90148..92016) [1869 bp, 622 aa] {ON} (90148....    35   0.33 
NCAS0D02510 Chr4 complement(474974..476914) [1941 bp, 646 aa] {O...    33   1.4  
NDAI0K02640 Chr11 (586470..587726) [1257 bp, 418 aa] {ON} Anc_4....    32   3.4  
NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.4...    32   4.0  
CAGL0M01936g Chr13 complement(234892..237735) [2844 bp, 947 aa] ...    30   8.2  
KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {O...    30   9.2  

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/375 (97%), Positives = 364/375 (97%)

Query: 1   MSSTEEIKLLNIHGICYSVISEPSESRFQLVKTATTTEDDRTVQNQPNLIVIDSVHSGKG 60
           MSSTEEIKLLNIHGICYSVISEPSESRFQLVKTATTTEDDRTVQNQPNLIVIDSVHSGKG
Sbjct: 1   MSSTEEIKLLNIHGICYSVISEPSESRFQLVKTATTTEDDRTVQNQPNLIVIDSVHSGKG 60

Query: 61  RTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHTVLFLSGDTSISE 120
           RTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHTVLFLSGDTSISE
Sbjct: 61  RTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHTVLFLSGDTSISE 120

Query: 121 FINNLPQGAPSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVF 180
           FINNLPQGAPSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVF
Sbjct: 121 FINNLPQGAPSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVF 180

Query: 181 PNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVNSLA 240
           PNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVNSLA
Sbjct: 181 PNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVNSLA 240

Query: 241 ASYSYFALINTPNLEPAYRPSPESDPLKEEXXXXXXXXXXXKDQFLTKVMKGYELGPSDK 300
           ASYSYFALINTPNLEPAYRPSPESDPLKEE           KDQFLTKVMKGYELGPSDK
Sbjct: 241 ASYSYFALINTPNLEPAYRPSPESDPLKEELYLLGYSSGLSKDQFLTKVMKGYELGPSDK 300

Query: 301 LPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQADLEVSNKFSIEF 360
           LPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQADLEVSNKFSIEF
Sbjct: 301 LPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQADLEVSNKFSIEF 360

Query: 361 LNHYSKFNIKAMSSN 375
           LNHYSKFNIKAMSSN
Sbjct: 361 LNHYSKFNIKAMSSN 375

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  327 bits (839), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 166/356 (46%), Positives = 226/356 (63%), Gaps = 16/356 (4%)

Query: 28  FQLVKT-------ATTTEDDRTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVN 80
           FQL K+       A+T  DD T      LIV+DS+ SG GRT  ND Y+IV+ PI E +N
Sbjct: 29  FQLEKSHAKQSSRASTRSDDST------LIVLDSLKSGIGRTENNDFYSIVIAPILEELN 82

Query: 81  IDHRLIKTTSRDTIASYASTLDISQSHTVLFLSGDTSISEFINNLPQGAPSAN-LSILSF 139
            +H  IKTTS D+++ +A +LD  Q + +  +SGDT+ISEF NNLP    + N L IL  
Sbjct: 83  WNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTISEFCNNLPNKKITRNPLRILPL 142

Query: 140 PMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVFPNGYSIVFFIILSMGFHAN 199
           PMG+GNAWA+SLG   P+  F  ++   +     PLY+A  PNGYSI+FF+I S+GFHAN
Sbjct: 143 PMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALPNGYSIIFFMIFSLGFHAN 202

Query: 200 LVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVNSLAASYSYFALINTPNLEPAYR 259
           L+HACE P+Y +MG E+FQ+A   IL+ Y LDL I+++ L  SY+YFALINTPNLE  Y+
Sbjct: 203 LLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLDGLRRSYAYFALINTPNLEATYK 262

Query: 260 PSPESDPLKEEXXXXXXXXXXXKDQFLTKVMKGYELGPSDKLPLDSDTIYVPFTKGFDVT 319
           PSP S+PL+ E           + + + K+M+GY+  P+  LP + D IY   T  F + 
Sbjct: 263 PSPRSNPLERELRLLGYSSSLGRQELVEKIMQGYQNKPNGDLPTNEDMIYKSITHDFTLV 322

Query: 320 LDFPLLESPRYKSEICCDGVLLNLQDLQA--DLEVSNKFSIEFLNHYSKFNIKAMS 373
           L+  L +S  +K EICCDG+LLNL D Q+    + SN+   +FLN YS F ++  S
Sbjct: 323 LNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIRFQFLNDYSGFQLQVYS 378

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  309 bits (791), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 159/366 (43%), Positives = 229/366 (62%), Gaps = 23/366 (6%)

Query: 30  LVKTATTTEDDRTVQNQP-----NLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHR 84
           L++ +T    DR +Q  P      LIVIDS+HSG GRT+ ND Y  VM+PIF  +N+ H 
Sbjct: 34  LIEDSTPLSVDRKLQFVPLKDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHL 93

Query: 85  LIKTTSRDTIASYASTLDISQSHTVLFLSGDTSISEFINNLPQGAPSAN-----LSILSF 139
           L+KTTS+D++ ++AS LD+++ + + FLSGDT+ISEFIN LP+ +   N     LSIL F
Sbjct: 94  LVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPF 153

Query: 140 PMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVFPNGYSIVFFIILSMGFHAN 199
           P G+GNA A+SLG+ CP   F  ++    S + FPLYKA+FPNG  IVFF+ILS+GFHAN
Sbjct: 154 PFGTGNALANSLGLTCPTTIFSNYLTSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHAN 213

Query: 200 LVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVNS--------LAASYSYFALINT 251
           L+H CE P Y+++G+E+F++A   IL  Y+LDL I++ S         +  YSYF ++NT
Sbjct: 214 LLHCCEAPHYKKLGVERFRIASEDILANYDLDLNISIESPRGLSPIVPSREYSYFVVVNT 273

Query: 252 PNLEPAYRPSPESDPLKEEXXXXXXXXXXXKDQFLTKVMKGYELGPSDKLPLDSDTIYVP 311
           P LE  Y PSP+S+PL+ +           KD+ + +++KGYE    D +  ++   Y+P
Sbjct: 274 PKLEAKYIPSPQSNPLRSQLHIIAYSSSLPKDELMARILKGYENNIGDVVN-NTGVTYLP 332

Query: 312 FTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQADLE----VSNKFSIEFLNHYSKF 367
               F + L++    SP  K ++CCDG+L NL D     +     +N+  IEFL+ YS F
Sbjct: 333 IEDNFIIKLNYSQEYSPSSKFQLCCDGLLFNLNDFIHKNDNGPCKNNEILIEFLSTYSPF 392

Query: 368 NIKAMS 373
            +  MS
Sbjct: 393 QLSLMS 398

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  301 bits (772), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 150/329 (45%), Positives = 215/329 (65%), Gaps = 5/329 (1%)

Query: 49  LIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHT 108
           LI++DSV SG GR  Q D  T V+KPI E +  +H++IKT S  +IA +A  ++ S+S+T
Sbjct: 55  LIILDSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYT 114

Query: 109 VLFLSGDTSISEFINNLP-QGAPSAN-LSILSFPMGSGNAWASSLGIMCPVKTFGQFIRG 166
           ++FLSGDTSISEF+N++P Q + S + L+I   PMG+GNAWASSL + CPV++F +F++ 
Sbjct: 115 IIFLSGDTSISEFLNHIPTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKN 174

Query: 167 EMSHSPFPLYKAVFPNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILK 226
           ++  S FPLY+A FPNGYS +FFIILS+GFHANL+H C   +Y+ MG+E+F+ A + I K
Sbjct: 175 DLIASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFK 234

Query: 227 EYELDLKITV-NSLAASYSYFALINTPNLEPAYRPSPESDPLKEEXXXXXXXXXXXKDQF 285
            Y+L  K+++ N ++  Y+YFA+INTPNLEP Y+PSP SDPL                + 
Sbjct: 235 NYDLKYKVSIPNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSEL 294

Query: 286 LTKVMKGYELGPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQD 345
           + ++ +G      D + +D+  IY    K FD+ ++     S R K EICCDG LLNL D
Sbjct: 295 IKRITRGRTAQKGDDI-MDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLD 353

Query: 346 LQA-DLEVSNKFSIEFLNHYSKFNIKAMS 373
           +Q  +        + FL  YS FN+K +S
Sbjct: 354 MQGTEGSFDGTIKVSFLQDYSPFNLKVLS 382

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  284 bits (726), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 208/319 (65%), Gaps = 15/319 (4%)

Query: 38  EDDRTVQNQP-----NLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRD 92
           +D++ + N+       L+++DSV SG GR    D  T V+   FE V + +RLIKTTS+ 
Sbjct: 45  DDEKLLANKKFEYSGELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKS 104

Query: 93  TIASYASTLDISQSHTVLFLSGDTSISEFINNLPQGAPSANLSILSFPMGSGNAWASSLG 152
           ++   AS++D ++ +TVLFLSGDTSISEF+NNLP       +S+L FPMG+GNAWASSL 
Sbjct: 105 SVIELASSIDSTRQYTVLFLSGDTSISEFVNNLPLNHDC--ISVLPFPMGTGNAWASSLK 162

Query: 153 IMCPVKTFGQFIRGEMSHSPFPLYKAVFPNGYSIVFFIILSMGFHANLVHACERPEYQRM 212
           +M P   F QF+ G++S + FPLY+A F NGY + FFIILS+GFHANL+H CE  EYQ+M
Sbjct: 163 LMDPAVIFSQFVNGKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKM 222

Query: 213 GIEKFQLAGSVILKEYELDLKITV-NSLAASYSYFALINTPNLEPAYRPSPESDPLKEEX 271
           GIE+F++A   IL+EY+L+ ++++ + L  S+SYFALINT NLEP Y PSP+SDPL+ + 
Sbjct: 223 GIERFRVASQRILREYKLESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQL 282

Query: 272 XXXXXXXXXXKDQFLTKVMKGYELGPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYK 331
                     + +F  +V  GY       + L + T Y P    F+V     +L+ P  K
Sbjct: 283 HVLAYQSSLDRVEFQKRVFMGYSNTKHSNI-LQNGTFYRPLPFCFNVE----VLDDPSQK 337

Query: 332 S--EICCDGVLLNLQDLQA 348
           S  E+CCDG LLNL +L+ 
Sbjct: 338 SNFEVCCDGQLLNLLELEG 356

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  277 bits (709), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 144/329 (43%), Positives = 210/329 (63%), Gaps = 13/329 (3%)

Query: 28  FQLVKTATTTEDDRTVQ--NQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRL 85
           F+LV  A   +DD+     +  N++VIDSV SG GR   N  Y IV+KPIF+   I H  
Sbjct: 34  FKLV--AKEVKDDKPCSPPHYENVVVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHY 91

Query: 86  IKTTSRDTIASYASTLDISQSHTVLFLSGDTSISEFINNLPQGAPSAN-----LSILSFP 140
            KTT   +I++YA +LD+S+S+TV+F+SGDTSISEFINNLP    ++N     +SIL  P
Sbjct: 92  FKTTGPKSISTYAKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLP 151

Query: 141 MGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVFPNGYSIVFFIILSMGFHANL 200
           MG+GNA++SS+G  CP++T   F+      S FPLY+ +FPNG +++FFIILS+G HAN+
Sbjct: 152 MGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHFPLYEVIFPNGKTVIFFIILSLGLHANV 211

Query: 201 VHACER-PEYQRMGIEKFQLAGSVILKEYELDLKITVNS--LAASYSYFALINTPNLEPA 257
           +H CE  P+Y++ G E+F+LA   ++  Y+L++++ +    L+ ++SYF LINTPNLE +
Sbjct: 212 LHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPELDLSGAFSYFILINTPNLESS 271

Query: 258 YRPSPESDPLKEEXXXXXXXXXXXKDQFLTKVMKGYELGPSDKLPLDSDTIYVPFTKGFD 317
           Y PSP SDP  E+            +  L  V +GY     D+L   S+ +Y P ++   
Sbjct: 272 YIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQGYSNKLGDELVESSNMVYKPISRNVS 331

Query: 318 VTLDFPLLESPRYKSEICCDGVLLNLQDL 346
           + L     ES +YK +ICCDG+L NL+D+
Sbjct: 332 IVLT-EDEESEKYKYDICCDGLLFNLRDM 359

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  275 bits (703), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 230/388 (59%), Gaps = 17/388 (4%)

Query: 1   MSSTEEIKLLNIHGICYSVISEPSESR---FQLVKT-----ATTTEDDRTVQNQPNLIVI 52
           M+   E+ L+  H   +SV+ E   S+   F L++      + T + +   + + +++V+
Sbjct: 1   MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVV 60

Query: 53  DSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLD-ISQSHTVLF 111
           DS+ SG GR  +ND  T V++P+F  + +D+R++KT + +++A          Q+ TV+F
Sbjct: 61  DSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIF 120

Query: 112 LSGDTSISEFINNL---PQGAPSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGEM 168
           LSGDTSISEF+NNL    QG     +++L+ P+G+GNAWA+SLG         +F++G +
Sbjct: 121 LSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFL 180

Query: 169 SHSPFPLYKAVFPNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEY 228
               FPLYKA+FPNGY IVFFIILS+GFHANL+H C++P ++++G+E+F+LA   I ++Y
Sbjct: 181 KPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDY 240

Query: 229 ELD--LKITVNSLAASYSYFALINTPNLEPAYRPSPESDPLKEEXXXXXXXXXXXKDQFL 286
            LD  L++T   L   YSYFALINTPNLE  Y+PSP+S+PL  E           +   +
Sbjct: 241 ILDYPLQVTQRPL-EHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLI 299

Query: 287 TKVMKGYELGPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDL 346
            ++MKGY   P   +  +  T Y  F+   DV         PR   +ICCDG LLN+   
Sbjct: 300 NRIMKGYSNQPETDINEEGVT-YQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQ 358

Query: 347 Q-ADLEVSNKFSIEFLNHYSKFNIKAMS 373
           Q A      +  ++FL  +S F++K +S
Sbjct: 359 QPAHGSFDGRIHVKFLKEHSSFHLKVLS 386

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  273 bits (699), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 205/308 (66%), Gaps = 7/308 (2%)

Query: 48  NLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSH 107
           NLIV+DSVHSG GRT+ ND+   V++P+   ++  ++++K+ +  ++A + + LD +QS+
Sbjct: 52  NLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSY 111

Query: 108 TVLFLSGDTSISEFINNLPQGAPS--ANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIR 165
           T+LF+SGDTS+SEF N +  G PS  ++L+IL   MG+GNA A+SL + CPV+ F  F+R
Sbjct: 112 TILFVSGDTSVSEFFNGVGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLR 171

Query: 166 GEMSHSPFPLYKAVFPNG-YSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVI 224
           GE+  + FPLY+A+ P+G  S+VFFI+LS+GFHANL+HA E  +Y+ MG+E+FQ A   I
Sbjct: 172 GELVTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDI 231

Query: 225 LKEYELDLKITVN--SLAASYSYFALINTPNLEPAYRPSPESDPLKEEXXXXXXXXXXXK 282
           L+ Y+L  +IT++   +A SY+YFAL+N PNLE +Y PSP+SDP K E           +
Sbjct: 232 LQNYKLQEQITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNR 291

Query: 283 DQFLTKVMKGYELGPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYKS-EICCDGVLL 341
            Q L ++M GY+    D+L  D  T Y   ++GF++ L     E P   + E+C DG L 
Sbjct: 292 KQLLERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNK-QEGPNDPAFELCLDGQLY 350

Query: 342 NLQDLQAD 349
           NL   ++D
Sbjct: 351 NLLQYKSD 358

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  271 bits (692), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 150/385 (38%), Positives = 219/385 (56%), Gaps = 27/385 (7%)

Query: 1   MSSTEEIKLLNIHGICYSVISEPSESRFQLVKTAT--TTEDDRTVQ-----NQPNLIVID 53
           + S E +KL+ I  + Y V++E   S++   K  +   TE+   ++         L+VID
Sbjct: 5   IDSLERLKLVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVID 64

Query: 54  SVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHTVLFLS 113
           S+ SG GRT QND Y  VMKP+F+  N  H+ I+T   D+I   A+  + S+ +T++FLS
Sbjct: 65  SICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLS 124

Query: 114 GDTSISEFINNLPQ---------GAPSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFI 164
           GDTS+SEFINNL +               ++I + P+G+GNA ASS+ +  P + F +F+
Sbjct: 125 GDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFL 184

Query: 165 RGEMSHSPFPLYKAVFPNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVI 224
             E+    FPLY    PN  +I+FFII SMGFHANL+HAC+  EYQ+MG E+F  A   I
Sbjct: 185 NNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENI 244

Query: 225 LKEYELDLKITVN----SLAASYSYFALINTPNLEPAYRPSPESDPLKEEXXXXXXXXXX 280
            K Y+L++ +T      S++ +Y+YFA+INTPNLE  Y PSP+SD  K E          
Sbjct: 245 FKNYDLNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASL 304

Query: 281 XKDQFLTKVMKGYELGPSDKL-PLDSDTIYVPFT---KGFDVTLDFPLLES-PRYKSEIC 335
             ++ + K+M GY     +K+   D+ T Y P      G  + L+    +   +YK +IC
Sbjct: 305 STEKLVNKIMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLEKYKYDIC 364

Query: 336 CDGVLLNLQDL--QADLEVSNKFSI 358
           CDG+LLNL D+  Q  +  SNK  I
Sbjct: 365 CDGLLLNLDDINNQHGVAESNKNKI 389

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  266 bits (680), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 139/363 (38%), Positives = 218/363 (60%), Gaps = 16/363 (4%)

Query: 17  YSVISEPSESRFQLVKTATTTEDDRTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIF 76
           +S++S P+E           + D +  + Q +++++DS+ SG GR ++N+    V++P+F
Sbjct: 31  FSLVSRPNE-------YGDASLDPQLTRGQKDILIVDSIKSGTGRDSRNNFGKNVLEPLF 83

Query: 77  EAVNIDHRLIKTTSRDTIASYASTLDISQSHTVL-FLSGDTSISEFINNLPQGAPSA--- 132
             + I H++++T   D       T   S  +T+L FLSGDT+ISEF+N L +        
Sbjct: 84  TLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFLSGDTTISEFLNGLNRRVFEGLRH 143

Query: 133 NLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVFPNGYSIVFFIIL 192
            LS++  P+G+GNAWA+SLG+ CP  +   F++G+++   FPLYKA FPNG+ ++FFIIL
Sbjct: 144 TLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLTPRKFPLYKATFPNGFEMIFFIIL 203

Query: 193 SMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVNSL-AASYSYFALINT 251
           S+GFHANL+H C++  +Q +G+E+F++A   IL++Y L+ ++ V+ L    YSYFALINT
Sbjct: 204 SIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYPLEYRLQVSGLPTRDYSYFALINT 263

Query: 252 PNLEPAYRPSPESDPLKEEXXXXXXXXXXXKDQFLTKVMKGYELGPSDKLPLDSDTIYVP 311
           PNLE +Y+PSP+S+ L  +           +   ++K+MKGY     D +  D   IY P
Sbjct: 264 PNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSKIMKGYSNRAGDDISGDG-VIYEP 322

Query: 312 FTKGFDVTLD-FPLLESPRYKSEICCDGVLLNLQDLQ-ADLEVSNKFSIEFLNHYSKFNI 369
           +    +V  D  P   S  Y  EICCDG LLN+  LQ  D +   +  I+FL ++S F +
Sbjct: 323 YNHALEVVFDQVPENVSNTY-FEICCDGHLLNMLSLQPQDQKFDGRIRIQFLKNFSSFEL 381

Query: 370 KAM 372
             M
Sbjct: 382 NVM 384

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  259 bits (663), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 156/373 (41%), Positives = 207/373 (55%), Gaps = 43/373 (11%)

Query: 44  QNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDI 103
           +N   LI+IDS HSG GR  +ND Y I+M+PI   +NI   L KTTS+D+I S+A+   I
Sbjct: 79  KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSI 138

Query: 104 SQSHT------VLFLSGDTSISEFINNLPQGAPSA---NLSILSFPMGSGNAWASSLGIM 154
               T      ++FLSGDT+ISEF NNLP   P     NL+IL+ PMG+ NAW++SL + 
Sbjct: 139 KTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSNSLNLN 198

Query: 155 CPVKTFGQFIRGEMSHSPFPLYKAVFPNGY-------------SIVFFIILSMGFHANLV 201
           CP+  F +F+  +++ SPFPLY  + P+               +I FFI+LSMGFHANL+
Sbjct: 199 CPIDIFQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVLSMGFHANLL 258

Query: 202 HACERPE-YQRMGIEKFQLAGSVILKEYELDLKITVNS--------LAASYSYFALINTP 252
           H C   E Y  +G+E+F+LA   IL  Y L+L IT+ S        L  S+SYF L+NTP
Sbjct: 259 HLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTP 318

Query: 253 NLEPAYRPSPESDPLKEEXXXXXXXXX-XXKDQFLTKVMKGY--ELGPSDKLPLDSD-TI 308
            LE  Y PSP SDPLK              K Q +  +MKGY  ELG  +   +D D  I
Sbjct: 319 KLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGII 378

Query: 309 YVPFT-KGFDVTLD----FPLLESPRYKSEICCDGVLLNLQDLQADLEVSNKFSIEF--- 360
           Y P   K F +TL+         S  +  E+CCDG+L NL + Q +    +K S E    
Sbjct: 379 YFPINDKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNYQTNQGKQDKISFEIEAN 438

Query: 361 LNHYSKFNIKAMS 373
            N  S F I A+S
Sbjct: 439 SNKISSFRIFALS 451

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  246 bits (629), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 143/374 (38%), Positives = 219/374 (58%), Gaps = 23/374 (6%)

Query: 7   IKLLNIHGICYSV----ISEPSESRFQLVKTATTTED-----DRTVQNQPNLIVIDSVHS 57
           ++L   +GI YSV    +    ES ++L+K    + D     DR  Q    +IVIDSV S
Sbjct: 5   VELCRNNGIKYSVEIVEVKGKVES-YKLIKANDRSTDCFLKFDRDTQ----IIVIDSVKS 59

Query: 58  GKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQS--HTVLFLSGD 115
           G  R  ++DLY +V++P+F+++ ++++ IKT S ++I  +A          + +LFLSGD
Sbjct: 60  GTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGD 119

Query: 116 TSISEFINNLPQG---APSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSP 172
           TSISEFIN L      +    +SIL  P+GSGNA A+SLG   P++    ++      SP
Sbjct: 120 TSISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSP 179

Query: 173 FPLYKAVFPNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEYELDL 232
            PLY A  PN  S++FFIILS+GFHANL+H  E P+Y+ MG+E+FQ+A   + + Y+L++
Sbjct: 180 LPLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNV 239

Query: 233 KITVNSL-AASYSYFALINTPNLEPAYRPSPESDPLKEEXXXXXXXXXXXKDQFLTKVMK 291
            I VN L + SYSYFA+I  PNLEP Y+PSP+S  LK+E            +    K+M+
Sbjct: 240 GIAVNGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMR 299

Query: 292 GYELGPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQADLE 351
           GY     + +  +  TIY  F K  ++++      +P+Y+ ++C DG LLNL+D  +  +
Sbjct: 300 GYHNKDGEDIQ-EIGTIYQCFQKNLELSIKTG-HNAPKYRYDMCIDGYLLNLEDCNSK-D 356

Query: 352 VSNKFSIEFLNHYS 365
              K  I F++ ++
Sbjct: 357 NEYKILIRFIDDHA 370

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  245 bits (626), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 144/378 (38%), Positives = 206/378 (54%), Gaps = 20/378 (5%)

Query: 5   EEIKLLNIHGICYSVISEPSESRFQLVKTATTTEDDRTVQNQPN--LIVIDSVHSGKGRT 62
           +E +L    G+ Y+V     E + + V+ A   E        P   L+V+DSV SG GR 
Sbjct: 92  KETELFCKEGLEYAVAELWEEGKLRSVELAVR-EGRGAEARAPGGPLVVLDSVRSGAGRE 150

Query: 63  AQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHTVLFLSGDTSISEFI 122
              D Y  VM P+   ++++H  ++T+S  ++   A T   +   TVL +SGDT+ISEF+
Sbjct: 151 PATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETTVLVMSGDTTISEFV 210

Query: 123 NNLPQGAPSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVFPN 182
           N L  GA    +++ + P+G+ NAWA S+G+  P K    F++G +   PFPLY+A FP+
Sbjct: 211 NALGSGA---GVTVYALPLGTANAWAHSVGLGTPAKALQAFVQGRVHAVPFPLYRARFPS 267

Query: 183 GYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVNS---- 238
           GYSI FFI+LS GFHANL+H C    YQR+G+E+F+ A + IL  Y L   + V +    
Sbjct: 268 GYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDRYALAEHVRVRAADGS 327

Query: 239 --LAASYSYFALINTPNLEPAYRPSPESDPLKEEXXXXXXXXXXXKDQFLTKVMKGYEL- 295
             LA  Y+YFAL+NTP+LE  Y PSP SDPL ++           +D+    +M GY   
Sbjct: 328 EQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELSRDKLNELLMAGYSTI 387

Query: 296 -GPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQADLEVSN 354
            G +   P     +Y      F  TL      S R  +E+C DG LLNL DLQA  +V +
Sbjct: 388 RGSALSAP---GLVYRNLGDSF--TLSIENGASDRVANELCVDGHLLNLVDLQAPGDVFD 442

Query: 355 KFSIEFLNHYSKFNIKAM 372
             SIE     + F +KA+
Sbjct: 443 G-SIEVGVVPASFGLKAL 459

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  150 bits (379), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 79/200 (39%), Positives = 112/200 (56%), Gaps = 3/200 (1%)

Query: 178 AVFPNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVN 237
           A FP+   I FFIILS+GFHA L+HAC RPE  +MG E+FQLA   IL+ Y+LDL I VN
Sbjct: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61

Query: 238 SLAASYSYFALINTPNLEPAYRPSPESDPLKEEXXXXXXXXXXXKDQFLTKVMKGYELGP 297
                Y+YFA+INT NLE  Y PSP+S+ L+             + + + K+MKGY +  
Sbjct: 62  KSTRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIRK 121

Query: 298 SDKLPLDSDTIYVPF---TKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQADLEVSN 354
            D +  D  T Y        G D+ +D  +  S  +K EICCDG+LL+L +       + 
Sbjct: 122 GDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLMEKSKGRTDNL 181

Query: 355 KFSIEFLNHYSKFNIKAMSS 374
              I  +  Y  F+++ +++
Sbjct: 182 TIHINSVKDYLSFDLQVLTT 201

>NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {ON}
           Anc_6.48 YLR260W
          Length = 662

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 62/136 (45%), Gaps = 14/136 (10%)

Query: 41  RTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYAST 100
           + V  Q ++++I + H GKG+ ++  L+    KPI    N    +I TT        A +
Sbjct: 255 KNVSQQRSILIIINPHGGKGKASK--LFNKWSKPILSTSNCKFEIINTTYSSHATDIAKS 312

Query: 101 LDISQSHTVLFLSGDTSISEFINNLPQGAPSAN----LSILSFPMGSGNA------WA-- 148
           LDIS+   +   SGD    E IN L Q     +    L+I   P GSGNA      W   
Sbjct: 313 LDISKYDIIACASGDGIPYEVINGLYQRPDRVDAFNKLTITQIPCGSGNAMSISCHWTDN 372

Query: 149 SSLGIMCPVKTFGQFI 164
           +S   +C +K+  + I
Sbjct: 373 TSHATLCLLKSIEKRI 388

>SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} similar
           to uniprot|Q12246 Saccharomyces cerevisiae YLR260W LCB5
           Minor sphingoid long-chain base kinase paralog of Lcb4p
           responsible for few percent of the total activity
           possibly involved in synthesis of long-chain base
           phosphates which function as signaling molecules and
           similar to YOR171c
          Length = 558

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 53/114 (46%), Gaps = 6/114 (5%)

Query: 41  RTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYAST 100
           ++ +   +++VI + H GKGR   N LY    KPI  A      +++TT        A  
Sbjct: 174 KSTKRNKSILVIINPHGGKGRA--NKLYVSKAKPILIASQCTVEILETTYHRHAIDIAQN 231

Query: 101 LDISQSHTVLFLSGDTSISEFINNLPQGAPSA----NLSILSFPMGSGNAWASS 150
           +DI +   +   SGD    E +N L + A  A     ++I   P GSGNA + S
Sbjct: 232 IDIDKYDVIACASGDGIPHEVLNGLYRRADRAKAFNKVAITQLPCGSGNAMSVS 285

>NCAS0F00230 Chr6 (35422..37239) [1818 bp, 605 aa] {ON} Anc_6.48
           YLR260W
          Length = 605

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 51/114 (44%), Gaps = 6/114 (5%)

Query: 41  RTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYAST 100
           + V    +++VI + H GKG+     L+    KPI  A N    +I T         A  
Sbjct: 214 KNVNRNRSILVIINPHGGKGKAKL--LFEKKAKPILIASNCSLEIIHTKYSRHALDIAKD 271

Query: 101 LDISQSHTVLFLSGDTSISEFINNLPQGAPSAN----LSILSFPMGSGNAWASS 150
           LDI++   +   SGD    E IN L Q    A+    L+I   P GSGNA + S
Sbjct: 272 LDITKYDVIACASGDGIPYEVINGLYQRPDRADAFNKLTITQVPCGSGNAMSIS 325

>AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR260W (LCB5) and
           YOR171C (LCB4)
          Length = 579

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 7/113 (6%)

Query: 42  TVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTL 101
           T +N+  L++I+  + GKG+   + LY    KPI  A +    +++T      A  A+T+
Sbjct: 190 TKRNKSILVIINP-YGGKGKA--HKLYVTKAKPILVASDCQIDVVETKYSSHAAEIAATM 246

Query: 102 DISQSHTVLFLSGDTSISEFINNL---PQGAPSAN-LSILSFPMGSGNAWASS 150
           DI++   +   SGD    E +N L   P    + N L+I   P GSGNA + S
Sbjct: 247 DINKYDVIACASGDGIPHEVLNGLFTRPDRVAAFNKLAITQLPCGSGNAMSIS 299

>KLTH0C10406g Chr3 complement(862020..863681) [1662 bp, 553 aa] {ON}
           similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of long-
           chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 553

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 50/114 (43%), Gaps = 6/114 (5%)

Query: 41  RTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYAST 100
           +  +    ++VI + H GKG   +  LY   +KPI  A N     ++TT        A T
Sbjct: 172 KGTKRNKTILVIMNPHGGKGHAKK--LYLSKVKPILAASNCTVETVETTYHGHATDLAKT 229

Query: 101 LDISQSHTVLFLSGDTSISEFINNLPQGAPSAN----LSILSFPMGSGNAWASS 150
           +D  +   +   SGD    E +N L Q    A+    L I   P GSGNA + S
Sbjct: 230 VDADKFDIIACASGDGIPHEVLNGLFQRPDRADAFNKLIITQLPCGSGNAMSVS 283

>Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR256W
          Length = 588

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 53/113 (46%), Gaps = 7/113 (6%)

Query: 42  TVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTL 101
           T +N+  L++I+  H G+GR   N +Y    KPI  A      + +T+  +     A T+
Sbjct: 197 TKRNKSILVIINP-HGGRGRA--NKIYVTKAKPILIASGCYVEVFQTSYPEHAIEIARTM 253

Query: 102 DISQSHTVLFLSGDTSISEFINNLPQGAPSA----NLSILSFPMGSGNAWASS 150
           DI +   +   SGD    E +N L +    A     +++   P GSGNA + S
Sbjct: 254 DIDKYDVIACASGDGIPYEVLNGLYRREDRAKAFNKVAVTQLPCGSGNAMSVS 306

>TDEL0G04220 Chr7 complement(765502..767400) [1899 bp, 632 aa] {ON}
           Anc_6.48 YOR171C
          Length = 632

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 62/152 (40%), Gaps = 14/152 (9%)

Query: 20  ISEPSESRFQLVKTATTTEDDRTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAV 79
           IS PS SR   +         +  + + +++VI +   GKG+  +  ++    KPI  A 
Sbjct: 216 ISYPSLSRGADIVEEILKRSYKNAKRERSILVIVNPFGGKGKAKK--MFMSKCKPILLAS 273

Query: 80  NIDHRLIKTTSRDTIASYASTLDISQSHTVLFLSGDTSISEFINNLPQGAPSA----NLS 135
           N       T         A  +D+ +  T+   SGD    E IN L Q    A     L+
Sbjct: 274 NCSIDTAYTKYAMHAVDIAREIDLDKYDTIACASGDGIPYEVINGLYQRPDRAEAFTKLA 333

Query: 136 ILSFPMGSGNA------WAS--SLGIMCPVKT 159
           I   P GSGNA      W S  S   +C VK+
Sbjct: 334 ITQLPCGSGNAMSVSCHWTSNPSYAALCLVKS 365

>KLLA0F20504g Chr6 complement(1902726..1904429) [1704 bp, 567 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of
           long-chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 567

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 49/114 (42%), Gaps = 6/114 (5%)

Query: 41  RTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYAST 100
           +  +   +++VI + H GKG+   N L+    KPI  A      + +TT        A  
Sbjct: 171 KNTKRNKSILVIINPHGGKGKA--NKLFLSKAKPILLASGCKIVVKETTYHLHAVDIAKN 228

Query: 101 LDISQSHTVLFLSGDTSISEFINNL----PQGAPSANLSILSFPMGSGNAWASS 150
           LDI +   V   SGD    E +N L     +      L+I   P GSGNA + S
Sbjct: 229 LDIDEYDVVACASGDGIPHEIMNGLFLRSDRAKAFQKLAITQLPCGSGNAMSIS 282

>TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6.48
           YOR171C
          Length = 589

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 58/133 (43%), Gaps = 17/133 (12%)

Query: 41  RTVQNQP---NLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASY 97
           R+ QN      ++VI + H GKG   +  +Y    +PI +A      +  T         
Sbjct: 192 RSYQNAKMYRRILVIVNPHGGKGNAKK--IYLSKCEPILKASTATVDIAYTKYAGHAIDI 249

Query: 98  ASTLDISQSHTVLFLSGDTSISEFINNLPQGAPSAN----LSILSFPMGSGNA------W 147
           A  +D+S+  T+   SGD    E IN L Q +   +    L++   P GSGNA      W
Sbjct: 250 AREVDLSKYDTIACASGDGIPYEVINGLNQRSDRVDAFNKLAVTQIPCGSGNAMSVSCHW 309

Query: 148 AS--SLGIMCPVK 158
            +  SL  +C +K
Sbjct: 310 TTDPSLATLCVLK 322

>YOR171C Chr15 complement(652010..653884) [1875 bp, 624 aa] {ON}
           LCB4Sphingoid long-chain base kinase, responsible for
           synthesis of long-chain base phosphates, which function
           as signaling molecules, regulates synthesis of ceramide
           from exogenous long-chain bases, localizes to the Golgi
           and late endosomes
          Length = 624

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 55/124 (44%), Gaps = 14/124 (11%)

Query: 49  LIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHT 108
           ++VI + H GKG TA+N L+    +PI         +  T         A  LDIS+  T
Sbjct: 229 ILVIINPHGGKG-TAKN-LFLTKARPILVESGCKIEIAYTKYARHAIDIAKDLDISKYDT 286

Query: 109 VLFLSGDTSISEFINNL---PQGAPSAN-LSILSFPMGSGNA------WAS--SLGIMCP 156
           +   SGD    E IN L   P    + N L++   P GSGNA      W +  S   +C 
Sbjct: 287 IACASGDGIPYEVINGLYRRPDRVDAFNKLAVTQLPCGSGNAMSISCHWTNNPSYAALCL 346

Query: 157 VKTF 160
           VK+ 
Sbjct: 347 VKSI 350

>Kwal_56.22550 s56 (176751..178412) [1662 bp, 553 aa] {ON} YLR260W
           (LCB5) - sphingoid long chain base (LCB) kinase [contig
           185] FULL
          Length = 553

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 49/107 (45%), Gaps = 6/107 (5%)

Query: 48  NLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSH 107
           ++++I + H GKG   +  LY   +KPI  A       I+TT        A  ++I +  
Sbjct: 177 SILIIMNPHGGKGHAKK--LYLSKVKPILTASPSFVEAIETTYHGHAIELAKNINIDKYD 234

Query: 108 TVLFLSGDTSISEFINNL---PQGAPSAN-LSILSFPMGSGNAWASS 150
            +   SGD    E +N L   P  A + N L I   P GSGNA + S
Sbjct: 235 VIACASGDGIPHEVLNGLYQRPDRAAAFNKLVITQLPCGSGNAMSVS 281

>Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260W
           (REAL)
          Length = 678

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 55/132 (41%), Gaps = 14/132 (10%)

Query: 41  RTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYAST 100
           +  +   ++ VI +   GKG+  +  L+    KP+  A      ++ T         A  
Sbjct: 254 KNTRRNKSIFVIINPFGGKGKAKK--LFMTKAKPLLLASQCSIEVVYTKYPGHAIEIARE 311

Query: 101 LDISQSHTVLFLSGDTSISEFINNL---PQGAPSAN-LSILSFPMGSGNA------WAS- 149
           +DI Q  T+   SGD    E IN L   P    + N L+I   P GSGNA      W + 
Sbjct: 312 MDIDQYDTIACASGDGIPHEVINGLYRRPDHVKAFNKLAITEIPCGSGNAMSVSCHWTNN 371

Query: 150 -SLGIMCPVKTF 160
            S   +C +K+ 
Sbjct: 372 PSYSTLCLIKSI 383

>ZYRO0C07084g Chr3 complement(533008..534951) [1944 bp, 647 aa] {ON}
           similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of
           long-chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 647

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 46/103 (44%), Gaps = 6/103 (5%)

Query: 48  NLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSH 107
           +++VI + H G+G+  +  L+    +PI  A      +  T         A  +D+++  
Sbjct: 261 SVLVIINPHGGQGKAKK--LFMTKCRPILLASRCPIEIAYTKYGRHAVDIAREVDLNKYD 318

Query: 108 TVLFLSGDTSISEFINNLPQGAPSA----NLSILSFPMGSGNA 146
           T+   SGD    E IN L Q    A     LSI   P GSGNA
Sbjct: 319 TIACASGDGIPYEVINGLYQRKDRAAAFNKLSITQLPCGSGNA 361

>TPHA0F02490 Chr6 (549495..551528) [2034 bp, 677 aa] {ON} Anc_6.48
           YOR171C
          Length = 677

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 51/113 (45%), Gaps = 7/113 (6%)

Query: 42  TVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTL 101
           T +N+  L +I+    GKG   +  LY    KPI  A      ++ T       + A  +
Sbjct: 285 TRRNRKILAIINEF-GGKGNAKK--LYFSKAKPILAASRCKVDIVFTEYTGHAINVAKEM 341

Query: 102 DISQSHTVLFLSGDTSISEFINNLPQ----GAPSANLSILSFPMGSGNAWASS 150
           DI++  T++  SGD    E IN L Q     A  + L+I   P GS NA + S
Sbjct: 342 DINKYDTIVCASGDGIPYEIINGLYQRKDRAAAFSKLAITQLPCGSANAMSVS 394

>YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor
           sphingoid long-chain base kinase, paralog of Lcb4p
           responsible for few percent of the total activity,
           possibly involved in synthesis of long-chain base
           phosphates, which function as signaling molecules
          Length = 687

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 54/132 (40%), Gaps = 14/132 (10%)

Query: 41  RTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYAST 100
           +  +   ++ VI +   GKG+  +  L+    KP+  A      ++ T         A  
Sbjct: 263 KNTRRNKSIFVIINPFGGKGKAKK--LFMTKAKPLLLASRCSIEVVYTKYPGHAIEIARE 320

Query: 101 LDISQSHTVLFLSGDTSISEFINNLPQGAPSA----NLSILSFPMGSGNA------WAS- 149
           +DI +  T+   SGD    E IN L Q         N++I   P GSGNA      W + 
Sbjct: 321 MDIDKYDTIACASGDGIPHEVINGLYQRPDHVKAFNNIAITEIPCGSGNAMSVSCHWTNN 380

Query: 150 -SLGIMCPVKTF 160
            S   +C +K+ 
Sbjct: 381 PSYSTLCLIKSI 392

>Suva_8.224 Chr8 complement(402084..403958) [1875 bp, 624 aa] {ON}
           YOR171C (REAL)
          Length = 624

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 53/125 (42%), Gaps = 14/125 (11%)

Query: 48  NLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSH 107
           N++VI + + GKG+     L+    +PI         +  T         A  LDIS+  
Sbjct: 233 NVLVIINPYGGKGKAKT--LFLTKARPILLESGCKIEIAYTKYARHAIDIAKDLDISKYD 290

Query: 108 TVLFLSGDTSISEFINNL---PQGAPSAN-LSILSFPMGSGNA------WAS--SLGIMC 155
           T+   SGD    E IN L   P    + N L++   P GSGNA      W +  S   +C
Sbjct: 291 TIACASGDGIPYEVINGLYRRPDRVEAFNKLAVTQLPCGSGNAMSISCHWTNNPSYAALC 350

Query: 156 PVKTF 160
            VK+ 
Sbjct: 351 LVKSI 355

>KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {ON}
           Anc_6.48 YOR171C
          Length = 601

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 6/106 (5%)

Query: 49  LIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHT 108
           L++I + H GKG+  +  L+   ++PI +       +  T         A  LD+ +  T
Sbjct: 229 LLIIINPHGGKGKALK--LFQEHVEPILKLTFFKFEVKLTEYHRHAMQIARKLDLDKFDT 286

Query: 109 VLFLSGDTSISEFINNLPQGAPSAN----LSILSFPMGSGNAWASS 150
           ++  SGD    E IN L Q    +N    L +   P GSGNA + S
Sbjct: 287 IVCASGDGIPYEVINGLYQRTDRSNAFNKLCVTQLPCGSGNAMSIS 332

>Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 55/131 (41%), Gaps = 14/131 (10%)

Query: 41  RTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYAST 100
           +  +   ++ VI +   GKG+  +  L+    KP+  A      ++ T         A  
Sbjct: 254 KNTRKNKSIFVIINPFGGKGKAKK--LFMTKAKPLLLASRCSIEVVYTKYPGHAIEIARE 311

Query: 101 LDISQSHTVLFLSGDTSISEFINNL---PQGAPSAN-LSILSFPMGSGNA------WAS- 149
           +DI +  T+   SGD    E IN L   P    + N L+I   P GSGNA      W + 
Sbjct: 312 MDIDKYDTIACASGDGIPHEVINGLYRRPDRVKAFNQLAITEIPCGSGNAMSVSCHWTNN 371

Query: 150 -SLGIMCPVKT 159
            S   +C +K+
Sbjct: 372 PSYSTLCLIKS 382

>KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {ON}
           Anc_6.48 YOR171C
          Length = 598

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 58/131 (44%), Gaps = 14/131 (10%)

Query: 41  RTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYAST 100
           +  +    ++VI +   GKG+ A+N L+     PI +A   D+ +  T         A +
Sbjct: 184 KNARRNKKMLVIINPFGGKGQ-AKN-LFFQRAAPILDASGSDYDIAYTERSRHAVEIAES 241

Query: 101 LDISQSHTVLFLSGDTSISEFINNL----PQGAPSANLSILSFPMGSGNA------WA-- 148
           LDI +  T++  SGD    E +N L     + A    + +   P GSGNA      W   
Sbjct: 242 LDIDKYDTIVCASGDGIPYEVLNGLYRRIDRVAAFNKIVVTQLPCGSGNAMSISCHWTMN 301

Query: 149 SSLGIMCPVKT 159
           +S   +C +K+
Sbjct: 302 TSYAALCLLKS 312

>TBLA0G00430 Chr7 (86333..89197) [2865 bp, 954 aa] {ON} Anc_6.48
           YOR171C
          Length = 954

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 48/111 (43%), Gaps = 7/111 (6%)

Query: 44  QNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDI 103
           +N+  L++I+    GKG+  +  ++    KPI  A      +  T            LDI
Sbjct: 575 RNRSILVIINQF-GGKGKAKK--MFITKAKPILLASGCKIDVTYTRYARHAIDIGKHLDI 631

Query: 104 SQSHTVLFLSGDTSISEFINNLPQGAPSA----NLSILSFPMGSGNAWASS 150
            +  T+L  SGD    E IN L Q    A     L+I   P GSGNA + S
Sbjct: 632 DKYDTILCASGDGIPYEIINGLYQRPDRAKAFEKLAITELPCGSGNAMSVS 682

>Smik_15.349 Chr15 complement(608112..609989) [1878 bp, 625 aa] {ON}
           YOR171C (REAL)
          Length = 625

 Score = 36.6 bits (83), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 52/124 (41%), Gaps = 14/124 (11%)

Query: 49  LIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHT 108
           ++VI + H GKG TA+  L+    +PI         +  T         A  LDI +  T
Sbjct: 231 ILVIINPHGGKG-TAKT-LFLTKAQPILAESGCKIEIAYTKYARHAIDIAKDLDIRKYDT 288

Query: 109 VLFLSGDTSISEFINNLPQGAPSA----NLSILSFPMGSGNA------WAS--SLGIMCP 156
           +   SGD    E IN L + +        L++   P GSGNA      W +  S   +C 
Sbjct: 289 IACASGDGIPYEVINGLYRRSDRVEAFNKLAVTQLPCGSGNAMSISCHWTNNPSYAALCL 348

Query: 157 VKTF 160
           VK+ 
Sbjct: 349 VKSI 352

>Suva_10.358 Chr10 (627071..629113) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 56/131 (42%), Gaps = 14/131 (10%)

Query: 41  RTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYAST 100
           +  +   ++ VI +   GKG+  +  L+    KP+  A      ++ T         A  
Sbjct: 254 KNTKRNKSIFVIINPFGGKGKAKK--LFMTKAKPLLLASRCSIEVVYTKYPGHAVEIAED 311

Query: 101 LDISQSHTVLFLSGDTSISEFINNL---PQGAPSAN-LSILSFPMGSGNA------WAS- 149
           ++I +  TV+  SGD    E +N L   P    + N L+I   P GSGNA      W + 
Sbjct: 312 MNIDKYDTVVCASGDGIPHEVMNGLYRRPDHVKAFNKLAITQIPCGSGNAMSVSCHWTNN 371

Query: 150 -SLGIMCPVKT 159
            S   +C +K+
Sbjct: 372 PSYSTLCLIKS 382

>Skud_15.333 Chr15 complement(600768..602651) [1884 bp, 627 aa] {ON}
           YOR171C (REAL)
          Length = 627

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 53/124 (42%), Gaps = 14/124 (11%)

Query: 49  LIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHT 108
           ++VI + H GKG TA+  L+     PI         +  T         A  LDIS+  T
Sbjct: 233 ILVIINPHGGKG-TAKT-LFLTKASPILVESGCKIEIAYTKYARHAIDIARDLDISKYDT 290

Query: 109 VLFLSGDTSISEFINNL---PQGAPSAN-LSILSFPMGSGNA------WAS--SLGIMCP 156
           +   SGD    E IN L   P    + N +++   P GSGNA      W +  S   +C 
Sbjct: 291 IACASGDGIPYEVINGLFRRPDRVDAFNKVAVTQLPCGSGNAMSISCHWTNNPSYAALCL 350

Query: 157 VKTF 160
           VK+ 
Sbjct: 351 VKSI 354

>CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} similar
           to uniprot|Q06147 Saccharomyces cerevisiae YLR260w
           sphingolipid long chain base kinase
          Length = 794

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 51/113 (45%), Gaps = 7/113 (6%)

Query: 42  TVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTL 101
           T Q++  L +I+    GKG+  +  L+    KP+  A      +  T         A  +
Sbjct: 397 TKQSRSILAIINPF-GGKGKAKK--LFMTKAKPLLSASRSTVEIKYTKYPQEAIDIAREM 453

Query: 102 DISQSHTVLFLSGDTSISEFINNL---PQGAPSAN-LSILSFPMGSGNAWASS 150
           DIS+  T++  SGD    E IN L   P    + N L+I   P GSGNA + S
Sbjct: 454 DISKYDTIVCASGDGIPYEVINGLYRRPDRVEAFNKLAITQLPCGSGNAMSVS 506

>Kpol_1042.1 s1042 (2298..4259) [1962 bp, 653 aa] {ON} (2298..4259)
           [1962 nt, 654 aa]
          Length = 653

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 48/114 (42%), Gaps = 6/114 (5%)

Query: 41  RTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYAST 100
           R  + +  ++VI + + GKG   +  L+     P+  A      L  T       + A  
Sbjct: 264 RGTKRKRKILVIINPYGGKGNAKK--LFMTKCYPLLIASRCTVDLAYTKFSGHAITLAEA 321

Query: 101 LDISQSHTVLFLSGDTSISEFINNLPQGAPSA----NLSILSFPMGSGNAWASS 150
           LDI++  T+   SGD    E IN L +          L+I   P GSGNA + S
Sbjct: 322 LDINKYDTIACASGDGIPYEVINGLYRRKDRVEAFNKLTITQLPCGSGNAMSVS 375

>KAFR0A05250 Chr1 (1038486..1040639) [2154 bp, 717 aa] {ON} Anc_6.48
           YOR171C
          Length = 717

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 49/114 (42%), Gaps = 6/114 (5%)

Query: 41  RTVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYAST 100
           R  + + +L+VI +   GKG   +  ++    +P+ +A      +  T         A  
Sbjct: 310 RNTKRRRSLLVIVNPFGGKGNAKK--IFMRKARPLLQASGFKIDVKYTKYSGHAVQIAQG 367

Query: 101 LDISQSHTVLFLSGDTSISEFINNL----PQGAPSANLSILSFPMGSGNAWASS 150
           +DI +  T+   SGD    E IN L     + A    L+I   P GSGNA + S
Sbjct: 368 IDIHKYDTICCASGDGIPHEVINGLYRRKDRVAAFNKLTITQIPCGSGNAMSVS 421

>Kpol_1037.37 s1037 (90148..92016) [1869 bp, 622 aa] {ON}
           (90148..92016) [1869 nt, 623 aa]
          Length = 622

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 54/127 (42%), Gaps = 15/127 (11%)

Query: 44  QNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDI 103
           +N+  L+VI+  + GKG+  +  LY      I         ++ T            LDI
Sbjct: 241 RNRSILVVINP-YGGKGKAKK--LYLNKCHDILIQSKCKVDIVYTNYGGHAIDIGRELDI 297

Query: 104 SQSHTVLFLSGDTSISEFINNL---PQGAPSAN-LSILSFPMGSGNA------WAS--SL 151
           S+  T+   SGD    E +N L   P    + N L+I   P GSGNA      W+S  S 
Sbjct: 298 SKYDTIACASGDGIPYEILNGLYQRPDRVEAFNKLAITQLPCGSGNAMSISCHWSSNPSY 357

Query: 152 GIMCPVK 158
             +C VK
Sbjct: 358 SALCLVK 364

>NCAS0D02510 Chr4 complement(474974..476914) [1941 bp, 646 aa] {ON}
           Anc_6.48 YLR260W
          Length = 646

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 61/152 (40%), Gaps = 17/152 (11%)

Query: 42  TVQNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTL 101
           T +N+  L+VI+      G+     ++    KP+  A      +  T         A  L
Sbjct: 249 TKRNRSILVVINPF---GGKRKAKKVFMSKAKPLLLASECSIDIAYTEYIGHGIKIAQEL 305

Query: 102 DISQSHTVLFLSGDTSISEFINNL---PQGAPSAN-LSILSFPMGSGNA------WAS-- 149
           DI +  T+   SGD    E +N L   P    + N L+I   P GSGNA      W +  
Sbjct: 306 DIDKYDTIACASGDGIPHEIMNGLYRRPDRVKAFNKLAITQIPCGSGNAMSVSCHWTNNP 365

Query: 150 SLGIMCPVKTFGQFIRGEMSHSPFPLYKAVFP 181
           S   +C +K+    +R ++     P Y   FP
Sbjct: 366 SYATLCLIKSIE--VRVDVMLCSQPSYVDQFP 395

>NDAI0K02640 Chr11 (586470..587726) [1257 bp, 418 aa] {ON} Anc_4.142
           YGR005C
          Length = 418

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 85  LIKTTSRDTIASYASTLDISQSHTVLFLSGDTSISEFINNLPQGAPSANLSILSFPM 141
           ++KT +++ I + A T+ ++ SHT + +  DTS     N L  G   A  +I S  M
Sbjct: 248 IVKTNNKERITTLAETVGVTMSHTGMSMRSDTS-----NFLKVGREKAKSNIKSIRM 299

>NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.48
           YLR260W
          Length = 760

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 70/175 (40%), Gaps = 24/175 (13%)

Query: 7   IKLLNIHGICYSVISEPSESRFQLVKTATTTEDD----------RTVQNQPNLIVIDSVH 56
           I+ LN     Y      +++R +  + AT+ E D          +  + + +++VI +  
Sbjct: 302 IEPLNSQSHTYLYSQTQAQTREEEEEEATSMEHDIIEEIFKRSYKNTKRKRSILVIINPF 361

Query: 57  SGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHTVLFLSGDT 116
            GK +  +  L+    +P+  A +    +  T         A  +DI +  T+   SGD 
Sbjct: 362 GGKRKAKK--LFMTKARPLLLASDCFLEVHYTKYVGHAIEIAKEMDIDKFDTIACASGDG 419

Query: 117 SISEFINNLPQGAPSA----NLSILSFPMGSGNA------WAS--SLGIMCPVKT 159
              E IN L +          L+I   P GSGNA      W +  S   +C +K+
Sbjct: 420 IPHEVINGLYRREDRVKAFNKLTITQIPCGSGNAMSVSCHWTNNPSYATLCLIKS 474

>CAGL0M01936g Chr13 complement(234892..237735) [2844 bp, 947 aa]
           {ON} similar to uniprot|P38244 Saccharomyces cerevisiae
           YBR074w
          Length = 947

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 9/58 (15%)

Query: 69  TIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHTVLFLSGDTSISEFINNLP 126
           ++VM+P  E   +  R ++T ++          DIS+S   LF + DT I E I +LP
Sbjct: 684 SLVMQPFSEIAPLKVRFLQTVNQH---------DISKSSVSLFTAKDTPIKEMIYDLP 732

>KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {ON}
           Anc_6.48 YOR171C
          Length = 748

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 47/111 (42%), Gaps = 7/111 (6%)

Query: 44  QNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDI 103
           +N+  L++I+    G  R A+  ++    K +  A +    L+ T         A  +DI
Sbjct: 352 RNRSLLVIINPF--GGKRNAKK-IFMRKAKRLLMASDFMFDLVYTKYSGHAIEIAKNMDI 408

Query: 104 SQSHTVLFLSGDTSISEFINNLPQGAPSAN----LSILSFPMGSGNAWASS 150
            +  T+   SGD    E IN L +          L+I   P GSGNA + S
Sbjct: 409 EKYDTIACASGDGIPHEVINGLYRRHDRVRAFNKLAITEIPCGSGNAMSVS 459

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,448,177
Number of extensions: 1647138
Number of successful extensions: 4165
Number of sequences better than 10.0: 49
Number of HSP's gapped: 4221
Number of HSP's successfully gapped: 49
Length of query: 375
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 264
Effective length of database: 40,753,473
Effective search space: 10758916872
Effective search space used: 10758916872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)