Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B021505.705ON91914606e-61
KAFR0H001905.705ON82823094e-38
Kpol_YGOB_1043.725.705ON88823095e-38
NCAS0A031805.705ON88813071e-37
Smik_11.3595.705ON88823001e-36
TBLA0G010305.705ON89813001e-36
Skud_11.3355.705ON94882992e-36
YKR095W-A (PCC1)5.705ON88812983e-36
KLLA0A00539g5.705ON87802922e-35
SAKL0E14982g5.705ON89822905e-35
Suva_11.3325.705ON111802908e-35
Kwal_YGOB_Anc_5.7055.705ON88822741e-32
KLTH0E00990g5.705ON89802705e-32
TPHA0E002005.705ON85742689e-32
NDAI0E050605.705ON86842653e-31
ZYRO0B16368g5.705ON85792611e-30
KNAG0C066205.705ON101892515e-29
Ecym_40165.705ON125742441e-27
AFR289W5.705ON81791923e-20
CAGL0G02535g5.705ON140901694e-16
AFR048Wna 1ON38766631.5
Kpol_1065.363.330ON121931613.4
SAKL0H13574g8.402ON66837596.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02150
         (91 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   181   6e-61
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   123   4e-38
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   123   5e-38
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   122   1e-37
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   120   1e-36
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   120   1e-36
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   119   2e-36
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   119   3e-36
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...   117   2e-35
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   116   5e-35
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   116   8e-35
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   110   1e-32
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   108   5e-32
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...   107   9e-32
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...   106   3e-31
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   105   1e-30
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   101   5e-29
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    99   1e-27
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    79   3e-20
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    70   4e-16
AFR048W Chr6 (515705..516868) [1164 bp, 387 aa] {ON} NOHBY619; N...    29   1.5  
Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON} (76145...    28   3.4  
SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} simi...    27   6.3  

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  181 bits (460), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 91/91 (100%), Positives = 91/91 (100%)

Query: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60
          MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL
Sbjct: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60

Query: 61 RVGVSSVIDSIKTIVETIDELGPETKELQSL 91
          RVGVSSVIDSIKTIVETIDELGPETKELQSL
Sbjct: 61 RVGVSSVIDSIKTIVETIDELGPETKELQSL 91

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  123 bits (309), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 59/82 (71%), Positives = 69/82 (84%)

Query: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60
          M+L+H+LKLEIPF+ A QANIA  VL PDPIL+PQDFQV Y   DNV V  F+SIDDRVL
Sbjct: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60

Query: 61 RVGVSSVIDSIKTIVETIDELG 82
          RVGVS+VIDS+KTI+ET+DEL 
Sbjct: 61 RVGVSNVIDSLKTIIETMDELS 82

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  123 bits (309), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 57/82 (69%), Positives = 71/82 (86%)

Query: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60
          + ++H+L  EIPF+TA QA IA QVL PDPILKPQDFQV Y++ DN+L++ F+SIDDRVL
Sbjct: 7  IEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVL 66

Query: 61 RVGVSSVIDSIKTIVETIDELG 82
          RVGVSSVIDS+KTI+ET+DEL 
Sbjct: 67 RVGVSSVIDSVKTIIETMDELS 88

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  122 bits (307), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%)

Query: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60
          MSL++ L LEIPF T+ QA IA +VL+PDPILKPQDFQV+Y + DN+L V F+ IDDRVL
Sbjct: 7  MSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVL 66

Query: 61 RVGVSSVIDSIKTIVETIDEL 81
          RVGVSSVIDSIKTI+ETIDEL
Sbjct: 67 RVGVSSVIDSIKTIIETIDEL 87

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 71/82 (86%)

Query: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60
          M L+H+L+L++PF+T  QA IA +VL PDPILKPQDFQ+DY++  NV++V F+SIDDRVL
Sbjct: 7  MPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVL 66

Query: 61 RVGVSSVIDSIKTIVETIDELG 82
          RVGVSSVIDSIKT+VE +DEL 
Sbjct: 67 RVGVSSVIDSIKTVVEAMDELS 88

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 58/81 (71%), Positives = 67/81 (82%)

Query: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60
          M + H+L L IPF T+ QA+IA QVL PDPIL+PQDFQV YT+  N LV+ FQSIDDRVL
Sbjct: 8  MQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVL 67

Query: 61 RVGVSSVIDSIKTIVETIDEL 81
          RVGVSSVIDS+KTI+ET DEL
Sbjct: 68 RVGVSSVIDSVKTIIETFDEL 88

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 6/88 (6%)

Query: 1  MSLNHSL------KLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQS 54
          MSL+++L      +L+IPF+T  QA+IA +VL PDPILKPQDFQVDY++  N+++V F+S
Sbjct: 7  MSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRS 66

Query: 55 IDDRVLRVGVSSVIDSIKTIVETIDELG 82
          IDDRVLRVGVSSVIDSIKTIVETIDEL 
Sbjct: 67 IDDRVLRVGVSSVIDSIKTIVETIDELS 94

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  119 bits (298), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%)

Query: 2  SLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLR 61
          SL+H+L+L+IPF+T  QA IA +VL PDPILKPQDFQVDY++  NV++V F+SIDDRVLR
Sbjct: 8  SLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLR 67

Query: 62 VGVSSVIDSIKTIVETIDELG 82
          VGVSS+IDSIKTIVE +D L 
Sbjct: 68 VGVSSIIDSIKTIVEAMDVLS 88

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score =  117 bits (292), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%)

Query: 2  SLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLR 61
          S  HSL LEIPF++  QA++A++VLLPDPI+KP+DFQV Y+T D  L+  F+S+D+R+LR
Sbjct: 7  SFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILR 66

Query: 62 VGVSSVIDSIKTIVETIDEL 81
          VGV+SVI+SIKTIVETIDEL
Sbjct: 67 VGVNSVIESIKTIVETIDEL 86

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  116 bits (290), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 67/82 (81%)

Query: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60
          MSL+H L LEIP +T +QA IA + L PDP+LKP+DFQV+Y+  D  L V F+SIDDRVL
Sbjct: 7  MSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVL 66

Query: 61 RVGVSSVIDSIKTIVETIDELG 82
          RVGVSSVI+S+KTI+ET+DE G
Sbjct: 67 RVGVSSVIESVKTIIETMDEFG 88

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  116 bits (290), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 68/80 (85%)

Query: 3   LNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRV 62
             ++ +L+IPF+T  QANIA +VL PDPILKPQDFQ DY++ +NV++  F+SIDDRVLRV
Sbjct: 32  FQNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRV 91

Query: 63  GVSSVIDSIKTIVETIDELG 82
           GVSSVIDSIKTI+ET+DEL 
Sbjct: 92  GVSSVIDSIKTIIETMDELS 111

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  110 bits (274), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 65/82 (79%)

Query: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60
          ++L ++L LE+PFQ   QA  A QVL PDPILKPQDF V+YT++ N L V F+ +DDRVL
Sbjct: 7  LNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVL 66

Query: 61 RVGVSSVIDSIKTIVETIDELG 82
          RVGVSSVI+SIKTIVETIDE  
Sbjct: 67 RVGVSSVIESIKTIVETIDEFS 88

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  108 bits (270), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 64/80 (80%)

Query: 3  LNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRV 62
          L ++L LE+PF+TA QA  A +VL PDPILKPQDF V+Y++  + L V F+ +DDRVLRV
Sbjct: 9  LAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRV 68

Query: 63 GVSSVIDSIKTIVETIDELG 82
          GVSSVI+SIKTI+ETIDE  
Sbjct: 69 GVSSVIESIKTIIETIDEFS 88

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score =  107 bits (268), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (87%)

Query: 8  KLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRVGVSSV 67
          KL IPF+T+ QA+IA QVL PDP L+P++F+VDY++  + LVV FQS+DDRVLRVGVS+V
Sbjct: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68

Query: 68 IDSIKTIVETIDEL 81
          IDSIKTI+ETIDEL
Sbjct: 69 IDSIKTIIETIDEL 82

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score =  106 bits (265), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 4/84 (4%)

Query: 2  SLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDY----TTTDNVLVVGFQSIDD 57
          +L+++L++ IPF     A IA+QVL PDPILKP+DFQV+Y    T  +NVL+V FQSID+
Sbjct: 3  TLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDE 62

Query: 58 RVLRVGVSSVIDSIKTIVETIDEL 81
          RVLRVGVSSV+DSIKTI+ET+DEL
Sbjct: 63 RVLRVGVSSVLDSIKTILETMDEL 86

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  105 bits (261), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 64/79 (81%)

Query: 3  LNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRV 62
          L+H+L L IPF     + +A +VL PDPIL+P+DFQV+Y +  N+L + F+S+DDRVLRV
Sbjct: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63

Query: 63 GVSSVIDSIKTIVETIDEL 81
          GVSSVIDS+KTIVETIDEL
Sbjct: 64 GVSSVIDSVKTIVETIDEL 82

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  101 bits (251), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 62/89 (69%), Gaps = 3/89 (3%)

Query: 2  SLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLR 61
          +L+H+L L +PF+T  QA IA QVL PDPILKPQDF V Y      L   F   D RVLR
Sbjct: 10 ALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLR 69

Query: 62 VGVSSVIDSIKTIVETIDEL---GPETKE 87
          VGVSSVIDS+KTI+E++DEL   GP + E
Sbjct: 70 VGVSSVIDSLKTIIESLDELDQTGPSSTE 98

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 98.6 bits (244), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 57/74 (77%)

Query: 9   LEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRVGVSSVI 68
           LE+PF+   QA IA++VL  DP+L+P+DF+VDYT     L+V F SID R LRVGVSSVI
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 69  DSIKTIVETIDELG 82
           +SIKT+VET+DE  
Sbjct: 111 ESIKTVVETMDEFS 124

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 78.6 bits (192), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 55/79 (69%)

Query: 3  LNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRV 62
          ++H+L L +PF++A  A+IA + L PDP+L+P++  V + +    L +   +ID RVLRV
Sbjct: 1  MDHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRV 60

Query: 63 GVSSVIDSIKTIVETIDEL 81
            +S+ +++KT+VET DEL
Sbjct: 61 ATNSIFEALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
           [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
           Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
           unknown function
          Length = 140

 Score = 69.7 bits (169), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 8/90 (8%)

Query: 9   LEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRV----GV 64
           L +PF+TA  A IA++VL PDPIL+P+DFQV+Y     VL + F++IDDRVLR     G 
Sbjct: 31  LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRTYAYQGS 90

Query: 65  SSVIDSIKT----IVETIDELGPETKELQS 90
            S+   + T    +V  +  +G   + L+S
Sbjct: 91  MSIFHLLGTDDSEVVSKLRYIGQGRRGLKS 120

>AFR048W Chr6 (515705..516868) [1164 bp, 387 aa] {ON} NOHBY619; No
           homolog in Saccharomyces cerevisiae
          Length = 387

 Score = 28.9 bits (63), Expect = 1.5,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 6/66 (9%)

Query: 3   LNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTT------TDNVLVVGFQSID 56
           LNH   L   FQ    ++    V L   +  P DF  D          D +L +G Q + 
Sbjct: 203 LNHGTMLWEAFQHGLLSDHNVHVGLRSNLAHPDDFHRDDAAGFYRIHADEILDIGPQGVV 262

Query: 57  DRVLRV 62
           DR+LRV
Sbjct: 263 DRILRV 268

>Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON}
           (76145..79804) [3660 nt, 1220 aa]
          Length = 1219

 Score = 28.1 bits (61), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 22/31 (70%)

Query: 60  LRVGVSSVIDSIKTIVETIDELGPETKELQS 90
           L++ +  ++DS KT++  I +L  E+KEL+S
Sbjct: 716 LKIKIDGLVDSNKTLLNQISDLKIESKELES 746

>SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 668

 Score = 27.3 bits (59), Expect = 6.3,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 2/37 (5%)

Query: 50  VGFQSID--DRVLRVGVSSVIDSIKTIVETIDELGPE 84
           V F+ +D  DR+L +G    +++I + + +I+E GPE
Sbjct: 274 VDFKILDEADRLLEIGFKQDLENISSQLNSINEKGPE 310

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,850,185
Number of extensions: 311631
Number of successful extensions: 885
Number of sequences better than 10.0: 26
Number of HSP's gapped: 884
Number of HSP's successfully gapped: 26
Length of query: 91
Length of database: 53,481,399
Length adjustment: 62
Effective length of query: 29
Effective length of database: 46,372,107
Effective search space: 1344791103
Effective search space used: 1344791103
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)