Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B021405.706ON1147114757930.0
ZYRO0B16412g5.706ON137296032310.0
KAFR0H001805.706ON124196429530.0
KNAG0C066305.706ON1281123329330.0
Smik_11.3605.706ON118093429200.0
Suva_11.3335.706ON118793228700.0
Skud_11.3365.706ON118893528520.0
YKR096W5.706ON119593428420.0
CAGL0G02541g5.706ON129593328360.0
NCAS0A031705.706ON1319102228290.0
SAKL0E15004g5.706ON119696928280.0
Kpol_1043.735.706ON126093528080.0
Kwal_55.196785.706ON117895227590.0
KLTH0E00968g5.706ON114895427400.0
TPHA0E001905.706ON136197226510.0
Suva_9.375.706ON111794225930.0
YIL151C5.706ON111894125910.0
Skud_9.175.706ON111893925730.0
Smik_9.185.706ON111893825520.0
AFR290W5.706ON121795925300.0
Ecym_40155.706ON125796225120.0
CAGL0H06611g5.706ON1282101824560.0
KLLA0A00528g5.706ON122996124000.0
NDAI0E050705.706ON155637613611e-164
TBLA0E017105.706ON152640912001e-141
TPHA0D046405.706ON9625132991e-26
SAKL0H05852g8.704ON869143772.5
AEL256C8.555ON186655754.3
TBLA0C052408.93ON52377735.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02140
         (1147 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  2236   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1249   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1142   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...  1134   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...  1129   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...  1110   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...  1103   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...  1099   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...  1097   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...  1094   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1093   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...  1086   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...  1067   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...  1060   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...  1025   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...  1003   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...  1002   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   995   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   987   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   979   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   972   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   950   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   929   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   528   e-164
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   466   e-141
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   119   1e-26
SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly...    34   2.5  
AEL256C Chr5 complement(156109..161709) [5601 bp, 1866 aa] {ON} ...    33   4.3  
TBLA0C05240 Chr3 (1267099..1268670) [1572 bp, 523 aa] {ON} Anc_8...    33   5.5  

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 2236 bits (5793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1077/1147 (93%), Positives = 1077/1147 (93%)

Query: 1    MIETFNHTSDRLTKNTDYIEQEKRPMCQPRHLNGPLDEIPASAGRQKRHSSNPYNSAEST 60
            MIETFNHTSDRLTKNTDYIEQEKRPMCQPRHLNGPLDEIPASAGRQKRHSSNPYNSAEST
Sbjct: 1    MIETFNHTSDRLTKNTDYIEQEKRPMCQPRHLNGPLDEIPASAGRQKRHSSNPYNSAEST 60

Query: 61   GVKRRVANHDDGITQFLDNGAIPNTPCKEPVSSRRPSATRRTVNRTPRSTTSYVADASAS 120
            GVKRRVANHDDGITQFLDNGAIPNTPCKEPVSSRRPSATRRTVNRTPRSTTSYVADASAS
Sbjct: 61   GVKRRVANHDDGITQFLDNGAIPNTPCKEPVSSRRPSATRRTVNRTPRSTTSYVADASAS 120

Query: 121  PYCYSPNNSNLRIDHLSRMVNSSGVSIPNVCRDPSFLSKEAHIVSDGQDTGTISINSGEV 180
            PYCYSPNNSNLRIDHLSRMVNSSGVSIPNVCRDPSFLSKEAHIVSDGQDTGTISINSGEV
Sbjct: 121  PYCYSPNNSNLRIDHLSRMVNSSGVSIPNVCRDPSFLSKEAHIVSDGQDTGTISINSGEV 180

Query: 181  NDQSQDNSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAL 240
            NDQSQDNSA                                                QAL
Sbjct: 181  NDQSQDNSANDEGRDDNNENDSIRNKNSNNDNDNNRENNKDNNGNVPSVVVPSKKSSQAL 240

Query: 241  VQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTALLP 300
            VQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTALLP
Sbjct: 241  VQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTALLP 300

Query: 301  PQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISISN 360
            PQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISISN
Sbjct: 301  PQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISISN 360

Query: 361  MLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYYHM 420
            MLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYYHM
Sbjct: 361  MLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYYHM 420

Query: 421  STVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLIEYL 480
            STVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLIEYL
Sbjct: 421  STVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLIEYL 480

Query: 481  KHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRHAP 540
            KHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRHAP
Sbjct: 481  KHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRHAP 540

Query: 541  AFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMAIDEEE 600
            AFAESHILQLVGFGDPKNPFALLFELPRCL                      AMAIDEEE
Sbjct: 541  AFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSVTTETSSAMAIDEEE 600

Query: 601  YIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEG 660
            YIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEG
Sbjct: 601  YIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEG 660

Query: 661  PMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIAYTL 720
            PMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIAYTL
Sbjct: 661  PMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIAYTL 720

Query: 721  DNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQMDSY 780
            DNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQMDSY
Sbjct: 721  DNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQMDSY 780

Query: 781  ESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQAQV 840
            ESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQAQV
Sbjct: 781  ESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQAQV 840

Query: 841  HCRRTDPMNHVLKSFCFKLRDTFYNSNSVLQNTIEVFEEGSDANKDMQMTPQLSVLENES 900
            HCRRTDPMNHVLKSFCFKLRDTFYNSNSVLQNTIEVFEEGSDANKDMQMTPQLSVLENES
Sbjct: 841  HCRRTDPMNHVLKSFCFKLRDTFYNSNSVLQNTIEVFEEGSDANKDMQMTPQLSVLENES 900

Query: 901  IFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEIPQSEPTQQQTANEADLFIE 960
            IFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEIPQSEPTQQQTANEADLFIE
Sbjct: 901  IFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEIPQSEPTQQQTANEADLFIE 960

Query: 961  GINTSLTEFNIDFPECKMNGKDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQEL 1020
            GINTSLTEFNIDFPECKMNGKDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQEL
Sbjct: 961  GINTSLTEFNIDFPECKMNGKDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQEL 1020

Query: 1021 RFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHV 1080
            RFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHV
Sbjct: 1021 RFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHV 1080

Query: 1081 DEFVFEAIKKAQARLSQENRDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGN 1140
            DEFVFEAIKKAQARLSQENRDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGN
Sbjct: 1081 DEFVFEAIKKAQARLSQENRDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGN 1140

Query: 1141 RLKICTN 1147
            RLKICTN
Sbjct: 1141 RLKICTN 1147

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1249 bits (3231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 621/960 (64%), Positives = 714/960 (74%), Gaps = 52/960 (5%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            QALVQKLQDIYKVIVKQEIELQERCSQLT SQTTELK LW IYK+NSDLINNYVTF+TTA
Sbjct: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LLP Q++QD+ IG+EIVEIYRIERRLWVYGTITFLD+ KNFSNFMDPEVC QFITHVFIS
Sbjct: 475  LLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            ISNML DIP +Y IPW QRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMK+ Y HGKLY
Sbjct: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLI 477
            YHMSTVQQNTLEAFVNLGKSVFCQDTF PSQQYMQLVIDNIYQRAFVERNNGNHRN+QLI
Sbjct: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654

Query: 478  EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFR 537
            EYLKHSEVMLLPSFLES DLQQVVLIYF+ KFG D+N  NIFDTR+MF QNPD L+YFFR
Sbjct: 655  EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFR 714

Query: 538  HAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMAID 597
            HAPAFAESHILQLVGFGDPKNPFALLFELPR L                       MAID
Sbjct: 715  HAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTVTETSSTMAID 774

Query: 598  EEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKF 657
            + E  D      +  + FF NI++L  PY  P +LE+WN SL Y+N+TSL CSM+VL+KF
Sbjct: 775  DLE--DEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKF 832

Query: 658  LEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIA 717
            L+GP+VVALPH +PW YFII++  K++ +   +SR+FW+E V+RIFPWNTIV+FLNVLIA
Sbjct: 833  LKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIA 892

Query: 718  YTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQM 777
            Y LDN   S  +D LC + S+MGL+ L+++FNNNE LPEVWKCWG LWFD IC+K++  +
Sbjct: 893  YMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHV 952

Query: 778  DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQ 837
            +  ES GIK+HMFLD PIDGI FD +DESG  FWKRACR+IFLFK +AENF   + +S  
Sbjct: 953  EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPV 1012

Query: 838  AQVHCRRTD-PMNHVLKSFCFKLR---------------DTFYNSNSVLQNTIEVFEEGS 881
            A V+CRR D    H+LKSF FKLR                T       L+NT+E+FEE S
Sbjct: 1013 APVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEAS 1072

Query: 882  DANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSW---GNETSK 938
              N  M   P LSV+E ESIF Y GY+RL  D   YD+ GEF+S SLYTSW    N  + 
Sbjct: 1073 WENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNT 1132

Query: 939  NEIP------QSEPTQQQTANEADLFIEGINTSLTE------FNIDFPECKMNGKDTFFV 986
              IP       S+    Q+  E  +F + +            F  D      +   T+FV
Sbjct: 1133 GVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTAHSSTTYFV 1192

Query: 987  LDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLY 1046
            LD T+WLRHF H+YKLAS+ VL+FAICLTTF ELRFLRK KDENVVEAATRA+ITVRQLY
Sbjct: 1193 LDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLY 1252

Query: 1047 TENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQEN------- 1099
            +E ++LPLRFTGNVATHIEEHLEFEE+ITWRSHVDEFV EA+ KAQ++  + N       
Sbjct: 1253 SEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMNQLQLEQE 1312

Query: 1100 ------------RDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
                             VVLVTDD+NMR+KAQ   + T ST+FVF+ CN++G R KICTN
Sbjct: 1313 EQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLRSKICTN 1372

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 51/101 (50%), Gaps = 17/101 (16%)

Query: 45  RQKRHSSNPYNSAESTGVKRRVANHDDGI---TQFLD---NGAI------PNTPCKEPVS 92
           R KR SSN YN   +  VKRR+ N ++     +QFLD    GAI      PNTP K P +
Sbjct: 100 RLKRSSSNTYNYVSANFVKRRLPNQEEIFPQQSQFLDTSLTGAINQSISVPNTPSKAP-T 158

Query: 93  SRRPSATRRTVNRTPRST----TSYVADASASPYCYSPNNS 129
           SRRPS  ++ ++ +  S           A  SPYC  PN S
Sbjct: 159 SRRPSLPKKAIDTSSASNYGGAGGGGTYALGSPYCSLPNVS 199

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/964 (59%), Positives = 710/964 (73%), Gaps = 58/964 (6%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            + L++KLQ+IYK+IVKQE+ELQ+RCSQLT SQTTELK LW IYK+N+DLINNY+TFITTA
Sbjct: 282  RVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFITTA 341

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LLP QS QD+ IG+EIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC+QFITHVFIS
Sbjct: 342  LLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFIS 401

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            +S ML D+P +++IPW QRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMK+ Y HGKLY
Sbjct: 402  LSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 461

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERN-NGNHRNSQL 476
            YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQR FV+RN NGN RNS L
Sbjct: 462  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRNSDL 521

Query: 477  IEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFF 536
            I+YLKHSEVMLLPSFLE+ DLQQVVL YF D+FG+D N+NNIF+T+ MF Q P  L+++F
Sbjct: 522  IDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASLRFYF 581

Query: 537  RHAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMAI 596
            RHAPAFAESHILQLVGFG+PKNPFALLF+LP  L                       M+I
Sbjct: 582  RHAPAFAESHILQLVGFGNPKNPFALLFDLPNFL---KERKDKKEKNKSKSSTEISTMSI 638

Query: 597  DEEE----YIDSSFSL--GAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCS 650
            D  +     +++S  +  G  V ++FDNIDSL  P +  P++ VW  SL++LN+TSL CS
Sbjct: 639  DTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLP-IDHPNILVWLKSLEHLNMTSLKCS 697

Query: 651  MIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVN 710
            +IVL+KFL GP+++ALPH+LPW YFIIA   K Q   + +S +FW  ++ RI PWNT+ +
Sbjct: 698  VIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLTS 757

Query: 711  FLNVLIAYTLDNIHPSLPIDPLCEELSTM-GLDQLVEHFNNNEDLPEVWKCWGLLWFDAI 769
            FLNVL+AY LDN + +  I  LCE  S      +L+++FN NE+LPE+WKCWG LWFD I
Sbjct: 758  FLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDVI 817

Query: 770  CDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQ 829
             +K  +  D++   GI+DHMFLD P+DGIGFD  DE+G  FW RA R++FLFK IAEN Q
Sbjct: 818  SNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAENLQ 877

Query: 830  TRLVVSSQAQVHCRRTD-PMNHVLKSFCFKLR---DTFYNSN--SVLQNTIEVFEEGSDA 883
            T L VS  A VHCRR D   NH+LKSF FK+    ++ Y+    S +   + +FE   + 
Sbjct: 878  TGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINKLLPLFENIDET 937

Query: 884  NKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSW----------- 932
            N D    P LSV++ E+IF YVGYK+L  +   +DR GE VS+S+YT+W           
Sbjct: 938  NLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDNDNSLNNS 997

Query: 933  -GNE-TSKNEIPQSE----PTQQQ-------TANEA-------DLFI--EGINTSLTEFN 970
             GN+ TS  ++ Q +    P +QQ        +NE        +L++  E +N ++ + +
Sbjct: 998  QGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNPEKLNKNMDQAS 1057

Query: 971  I-DFPECKMNGKDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDE 1029
            I      ++N   T+FV DATSWLRHFAH+YKL++N VL FA+CLTTFQELRFLRKSKDE
Sbjct: 1058 IWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDE 1117

Query: 1030 NVVEAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIK 1089
            NVV AA RA+IT+RQLY+E ++LPLRFTGNVAT IEEHLEFEEQITWRSHVDEFV EA+ 
Sbjct: 1118 NVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVV 1177

Query: 1090 KAQARLSQEN------RDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLK 1143
            KAQ +    N      + F+HVVLVTDD NM+RKAQ+  I T +T F+F+ C  +G +  
Sbjct: 1178 KAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFIFSVCRKLGIQDN 1237

Query: 1144 ICTN 1147
            +CTN
Sbjct: 1238 VCTN 1241

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 55/104 (52%), Gaps = 16/104 (15%)

Query: 40  PASAGRQKRHSSNPYNSAESTGVKRRVANHDDGI------TQFLDNGAIPN---TPCKEP 90
           P++A RQKRH SN Y        ++R+A  DD I        ++D+ +I N   TP K  
Sbjct: 40  PSAALRQKRHGSNSYIYKN----QKRIARPDDKILNANININYIDHNSIVNENATPVKS- 94

Query: 91  VSSRRPSATRRTVNRTPRSTTSYVADASASPYCYSPNNSNLRID 134
           V SRRPS ++++ N TP+ +   V +   SP+ Y  N S   ID
Sbjct: 95  VLSRRPSLSKKSNNVTPQPSF-LVTEPPKSPF-YVTNQSYTNID 136

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 1134 bits (2933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1233 (50%), Positives = 761/1233 (61%), Gaps = 117/1233 (9%)

Query: 19   IEQEKRPMCQPRHLNGPLDEIPASAGRQKRHSSNPYNSAEST-GVKRRVANHDDG---IT 74
            +E+E    CQ         +  A+   QKRH S  Y+ A +    KRR+AN ++    I+
Sbjct: 62   VEKEMEAHCQ--------GDDGANHSGQKRHGSASYSFANANFPSKRRIANAEEDSKRIS 113

Query: 75   QFLDNGAIP-NTPCKEPVSSRRPSATRRTVNRTPRSTTSYVADASASPYCYSPNNSNLRI 133
             + DN  +  NTP +    +R+ ++   +  R+   + S   +   SP+C     S   +
Sbjct: 114  SYSDNLLLQQNTPRRSRDVARKSASGSASGCRSASGSGSAPQE---SPFCME-FTSLANV 169

Query: 134  DHL------SRMVNS-SGVSIPNVC--RDPSFLSKE---AHIVSDGQDTGTISINS-GEV 180
            D L      +  VN+  G+ + N+   +   F+ K     H  +     G I  N  GEV
Sbjct: 170  DPLPTTGGAATGVNTPGGLGVDNISSGKQTVFIDKSIGATHRYATETQQGEIDNNGEGEV 229

Query: 181  --NDQSQDNSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQ 238
              N+ + DN                                                  Q
Sbjct: 230  AGNNDNADNDGLPTNGNGDNNEKNLSNDNDNSNNNSNNNNNYPADQSDAQNTSVTRKSSQ 289

Query: 239  ALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTAL 298
            ALVQKLQDIYKVIVKQEIELQERCSQLT SQTTELK LW IYK+N+DLINNY TFITTAL
Sbjct: 290  ALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFITTAL 349

Query: 299  LPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISI 358
            LP Q  QD+ IG+EIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC+QFITHVFIS+
Sbjct: 350  LPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISL 409

Query: 359  SNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYY 418
            S +L DIP ++AIPW QRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMK+ Y HGKLYY
Sbjct: 410  SAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYY 469

Query: 419  HMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERN-NGNHRNSQLI 477
            HMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQR FV+RN  GN+RN  LI
Sbjct: 470  HMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRNPDLI 529

Query: 478  EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFR 537
            +YLKHSEVMLLPSFL S DLQQVVL YF+D+FG+D +ENNIFDT+ MF Q P  L++FFR
Sbjct: 530  DYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLRFFFR 589

Query: 538  HAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMA-- 595
            HAPAFAESHILQLVGFG+PKNPFALLFELP+ L                           
Sbjct: 590  HAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVSSTAPKT 649

Query: 596  --------IDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSL 647
                    ++E    D   +      ++ DNI++L    +  P +  W  SL ++N+TSL
Sbjct: 650  VDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYA-IETPDICTWIKSLDFINMTSL 708

Query: 648  HCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNT 707
             CSMIVLKKFL GP+++ALPH LPW  FIIA   KV  + +  + +FW  L+ RIFPW+T
Sbjct: 709  KCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIFPWDT 768

Query: 708  IVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFD 767
            I +FLNVL+AY LDN   +  I+ LC + S M LD ++ HFN +EDLPEVWKCWG LW+D
Sbjct: 769  ITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTLWYD 828

Query: 768  AICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAEN 827
            AIC+K+ V  D++   GI DHMFLD PIDGI FD +DE+G KFWKRA RVIFLFK I++ 
Sbjct: 829  AICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGISKK 888

Query: 828  FQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSVLQNTIEVFEEGSDANKDM 887
            F   L +S +A V+CR     +  L+ F FKL      ++S     I + EE S  N D 
Sbjct: 889  FDFGLKISHEAGVYCRNEKAADSPLRRFTFKLESYDEPTSSKFNEFIPLCEEVSAINNDA 948

Query: 888  QMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEIPQSEPT 947
              TP LSV++ E+IF Y+GY+ L  D + +D+ GE VS+S+YTSW  +T +     S  T
Sbjct: 949  LATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEAAAAASSAT 1008

Query: 948  QQQTANE--ADLFIEG--INTSL-------TEFNIDFPECKMNGKDTF------------ 984
                 +E   DL   G  I+ SL       T    D  +  +N  D F            
Sbjct: 1009 DNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMSLGDPRDR 1068

Query: 985  -------------------------------FVLDATSWLRHFAHVYKLASNQVLQFAIC 1013
                                           F+ DATSWLRHFAH+YK+A+N VL+F +C
Sbjct: 1069 NVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVC 1128

Query: 1014 LTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQ 1073
            LTTFQELRFLRKSKDENVVEAA RA+IT+RQLY ENR+LPLRFTGNVA  IEEHLEFEEQ
Sbjct: 1129 LTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQ 1188

Query: 1074 ITWRSHVDEFVFEAIKKAQ-------------------ARLSQENRDFHHVVLVTDDANM 1114
            ITWRSHVDEFV EA+ KAQ                    R+    + FH+V LVT+D NM
Sbjct: 1189 ITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNM 1248

Query: 1115 RRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
            +RKAQ   I T ST FVF+ C+ +G  L +CTN
Sbjct: 1249 KRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 1129 bits (2920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/934 (59%), Positives = 690/934 (73%), Gaps = 33/934 (3%)

Query: 239  ALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTAL 298
            AL+QKLQ++Y+VIVKQEIELQERCSQLTNSQTTELK LW IYK+N++L+NNYVTFITTAL
Sbjct: 255  ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314

Query: 299  LPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISI 358
            LP Q   DL IGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFITHVFIS+
Sbjct: 315  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374

Query: 359  SNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYY 418
            S M++DIPS+Y+I W QRLGDLSRMAIALYPS FIDWKLSAEHWY EAMKY Y HGKLYY
Sbjct: 375  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434

Query: 419  HMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLIE 478
            HMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQRAFVERNNGN RNS LIE
Sbjct: 435  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 494

Query: 479  YLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRH 538
            YLKHSE MLLPSFLES DLQ VVL YF +KFG+D N  NIF+   MF QNPD  KYFFRH
Sbjct: 495  YLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFFKYFFRH 554

Query: 539  APAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMA--- 595
             P+FA+SHILQ+VGFG+PKNPFA+LFELP+ L                      +     
Sbjct: 555  GPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTESSTGNSR 614

Query: 596  ---IDEEEYIDSSFSLGAQ--VQQFFDNIDSLTSPYLFPPSL---EVWNCSLKYLNITSL 647
                D++E + S+ S+     + +FF++ID+L  P L  PS+   E W  +LK+LN+TSL
Sbjct: 615  NGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPIL--PSMLTNEAWLETLKFLNMTSL 672

Query: 648  HCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNT 707
             C MIVL+KFL GP+ VALPH+LPW YFII++  K   + D  S+EFW+ ++ R+FPW+T
Sbjct: 673  KCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWDT 732

Query: 708  IVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFD 767
            +V F+NVLIAY LDN   +  I  LC E S + L +L+  FN NEDLPE+W CWG LWFD
Sbjct: 733  MVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGTLWFD 792

Query: 768  AICDKDKVQM---DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRI 824
            AIC K+   +   D+++  GI+D+M LD P DGI FD  DE+G KFWKRACR+IFLF+ +
Sbjct: 793  AICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFREV 852

Query: 825  AENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSV-----LQNTIEVFEE 879
            + +F   ++V     V+C      N++L+   +KL       +SV     L++  ++ E 
Sbjct: 853  SRSFPLGVIVRHDPLVNCSSLQS-NNILRDLVYKLEPLTNIRSSVPVLSTLESIFDISEA 911

Query: 880  GSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKN 939
             S+ N D+   P+LSV+  ++IF YVGYK+L  D +C+D+ GEF+S SLYTSW      N
Sbjct: 912  RSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWYVPNCNN 971

Query: 940  EIPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDTFFVLDATSWLRHFAHV 999
             +  +     +  NEA LF+E + +   E  I +PE  ++ K T+FV DATSWLRH A +
Sbjct: 972  NLETNISYANERENEA-LFLECMKSVHPE--IAYPE--IDFKTTYFVFDATSWLRHSARI 1026

Query: 1000 YKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGN 1059
            +KLA N++L+FAICLTTFQELRFLRKSKDENV+EAATR +IT+RQLY E+++LPLRFTGN
Sbjct: 1027 FKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGN 1086

Query: 1060 VATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQENRD------FHHVVLVTDDAN 1113
            VATHIEE+LEFEEQITWR+HVDEFV E+I KAQ +L    +       F++VVL++DD  
Sbjct: 1087 VATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRFNYVVLISDDDT 1146

Query: 1114 MRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
            M++KA++  I TLSTRFVF+ C  +G +  +CT+
Sbjct: 1147 MKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score = 1110 bits (2870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/932 (59%), Positives = 690/932 (74%), Gaps = 34/932 (3%)

Query: 239  ALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTAL 298
            AL+QKLQ++YKVIVKQEIELQERCSQLTNSQTTELK LW IY++N++L+NNYVTFITTAL
Sbjct: 267  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTAL 326

Query: 299  LPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISI 358
            LP Q   DL IGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFITHVF+S+
Sbjct: 327  LPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 386

Query: 359  SNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYY 418
            S M++DIPS+Y+I W QRLGDLSRMAIALYPS FIDWKLSAEHWY EAMKY+Y HGKLYY
Sbjct: 387  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYY 446

Query: 419  HMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLIE 478
            HMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQRAFVERNNGN RNS LIE
Sbjct: 447  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 506

Query: 479  YLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRH 538
            YLKHSE MLLPSFLES DLQ VVL YF +KFG+D N  NIF+   MF QNPD  KYFFRH
Sbjct: 507  YLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRH 566

Query: 539  APAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMAI-- 596
            AP+FA+SHILQ+VGFG+PKNPFA+LFELP+ L                      + +   
Sbjct: 567  APSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESSTSNSR 626

Query: 597  ----DEEEYIDSSFSLGAQ--VQQFFDNIDSLTSPYLFPP-SLEVWNCSLKYLNITSLHC 649
                D +E + S+ S+  +  + +FF++ID+L  P +    + E W  SLK+LN+TSL C
Sbjct: 627  NENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLNMTSLKC 686

Query: 650  SMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIV 709
             MIVL+KFL GP+ +ALPH LPW YFII++  K   ++D  S+EFW+ +V RIFPW+T+V
Sbjct: 687  GMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMV 746

Query: 710  NFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAI 769
             F+N+LIA  LDN   S  I  LC+E S + L +L++ F   E+LPE+W CWG LWFD I
Sbjct: 747  TFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDTI 806

Query: 770  CDKDKVQM---DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAE 826
            C K+   +   D +E  GIKD+M LD PIDGI FD +DE+G KFWKRACR IFLF+ ++ 
Sbjct: 807  CQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSR 866

Query: 827  NFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSV-----LQNTIEVFEEGS 881
            +FQ  +++++++ ++ R +   N++L +  +KL       +S+     L+  I+VFE  S
Sbjct: 867  SFQIGVIINNESSIN-RSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGIIDVFETRS 925

Query: 882  DANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEI 941
            + N D+   P+LSV++  SIF Y GYK+L  + +C+D+ GEF+S SLYTSW      N  
Sbjct: 926  ENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVPNGSNNP 985

Query: 942  PQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDTFFVLDATSWLRHFAHVYK 1001
              +  +  +  NE   F+E + +   E +++          T+FV DATSWLRH A ++K
Sbjct: 986  ETNINSNCEKENEGQ-FLECLKSDDREIDLN---------TTYFVFDATSWLRHSARIFK 1035

Query: 1002 LASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGNVA 1061
            LA N++L+FAICLTTFQELRFLRKSKDENV+EAATR +IT+RQLY EN++LPLRFTGNVA
Sbjct: 1036 LAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVA 1095

Query: 1062 THIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQENR------DFHHVVLVTDDANMR 1115
            THIEE+LEFEEQITWR+HVDEFV E+I KAQ +L   N+       F++V+L++DD  M+
Sbjct: 1096 THIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRFNYVILISDDDTMK 1155

Query: 1116 RKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
            +KA++  I TLSTRFVF+ C  +G +  +CT+
Sbjct: 1156 KKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 1103 bits (2852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/935 (59%), Positives = 688/935 (73%), Gaps = 40/935 (4%)

Query: 239  ALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTAL 298
            AL+QKLQ++YKVIVKQEIELQERCSQLTNSQTTELK LW IY++N++LINNYVTFITTAL
Sbjct: 268  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTFITTAL 327

Query: 299  LPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISI 358
            LP Q   DL IGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFITHVF+S+
Sbjct: 328  LPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 387

Query: 359  SNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYY 418
            S M++DIPS+Y+I W QRLGDLSRMAIALYPS FIDWKLSAEHWY EAMKYIY HGKLYY
Sbjct: 388  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 447

Query: 419  HMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLIE 478
            HMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQRAFVERNNGN RNS LIE
Sbjct: 448  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 507

Query: 479  YLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRH 538
            YLKHSE MLLPSFLES DLQ VV+ YF +KFG+D N  NIF+   MF QNPD  KYFFRH
Sbjct: 508  YLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRH 567

Query: 539  APAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMA--- 595
            AP+FA+SHILQ+VGFG+PKNPFA+LFELP+ L                      +     
Sbjct: 568  APSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTGNSR 627

Query: 596  ---IDEEEYIDSSFSLGAQ--VQQFFDNIDSLTSPYLFPPSL---EVWNCSLKYLNITSL 647
                D++E + S+ S+     + +FF++ID+L  P L  PS+   E W  +LK+LN+TSL
Sbjct: 628  NDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPIL--PSMLTSEAWLETLKFLNMTSL 685

Query: 648  HCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNT 707
             C MIVL+KFL GP+ +ALPH+LPW YFIIA   K   ++D  S++FW+ +V R+FPW+T
Sbjct: 686  KCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFPWDT 745

Query: 708  IVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFD 767
            IV F+NVLIAY LDN   +  I  LC +  T+ L  L+E FN +E+LPE+W CWG LWFD
Sbjct: 746  IVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTLWFD 805

Query: 768  AICDKDKVQM---DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRI 824
             IC K+   +   D+++  GIKD+M LD P DGI FD  DESG KFWKRACR+IFLF+ +
Sbjct: 806  TICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFREL 865

Query: 825  AENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRD-TFYNSN----SVLQNTIEVFEE 879
            +  F   ++VS+   + C  +   + +L++  +KL   +   SN    + L+N++++ E 
Sbjct: 866  SRTFPIGVIVSNDPLIKCSSSQS-SIILRNLVYKLEPLSNIRSNTPILTALENSVDISEA 924

Query: 880  GSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKN 939
             S  N D+   P+LSV   ++IF Y GYK+L  D +C+DR GEF+S SLYT W    + N
Sbjct: 925  RSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRWY-LPNGN 983

Query: 940  EIPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPEC-KMNGKDTFFVLDATSWLRHFAH 998
             I ++         + DLF+E +           P+C  ++ + T+FV DATSWLRH A 
Sbjct: 984  NISEALVNSDIEKGDEDLFLECMK----------PDCPGIDFETTYFVFDATSWLRHSAR 1033

Query: 999  VYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTG 1058
            ++KLA N++L+FAICLTTFQELRFLRKSKDENV+EAATR +IT+RQLY E+++LPLRFTG
Sbjct: 1034 IFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLRFTG 1093

Query: 1059 NVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQEN------RDFHHVVLVTDDA 1112
            NVATHIEE+LEFEEQITWR+HVDEFV E+IKKAQ +L          R  ++VVL++DD 
Sbjct: 1094 NVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTPRHSNYVVLISDDD 1153

Query: 1113 NMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
             M++KA++  I TLST+FVF+ C  +G +  +CT+
Sbjct: 1154 TMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score = 1099 bits (2842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/934 (59%), Positives = 687/934 (73%), Gaps = 37/934 (3%)

Query: 239  ALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTAL 298
            AL+QKLQ++YKVIVKQEIELQERCSQLTNSQTTELK LW IYK+N+DL+NNYVTFITTAL
Sbjct: 274  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333

Query: 299  LPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISI 358
            LP Q   DL IGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFITHVF+S+
Sbjct: 334  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393

Query: 359  SNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYY 418
            S M++DIPS+Y+I W QRLGDLSRMAIALYPS FIDWKLSAEHWY EAMKYIY HGKLYY
Sbjct: 394  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453

Query: 419  HMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLIE 478
            HMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQRAFVERNNGN RNS LIE
Sbjct: 454  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 513

Query: 479  YLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRH 538
            YLKHSE MLLPSFLES DLQ VVL YF +KFG+D N  NIF+   MF QNPD  KYFFRH
Sbjct: 514  YLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRH 573

Query: 539  APAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMA--- 595
             P+FA+SHILQ+VGFG+PKNPFA+LFELP+ L                      +     
Sbjct: 574  GPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTGNSR 633

Query: 596  ---IDEEEYIDSSFSLGAQ--VQQFFDNIDSLTSPYLFPPSL---EVWNCSLKYLNITSL 647
                D++E + S+ S+     + +FF++ID+L  P L  PS+   E W  +LK+LN+TSL
Sbjct: 634  NDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPIL--PSMLTNEAWLETLKFLNMTSL 691

Query: 648  HCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNT 707
             C +IVL+KFL GP+ +ALPH+LPW YFII++  K   ++D  S+EFW+ +V R FPW+T
Sbjct: 692  KCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDT 751

Query: 708  IVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFD 767
            +V F+NVLI Y LDN   +  I  LC++   + L +L+E FN  E+LPE+  CWG LWFD
Sbjct: 752  MVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWGTLWFD 811

Query: 768  AICDKDKVQM---DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRI 824
             IC+K+   +   D+++  GIKD+M LD P DGI FD  DE+G KFWKRACR IFLF+ +
Sbjct: 812  TICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFREL 871

Query: 825  AENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSV-----LQNTIEVFEE 879
            + +F   +++ +   ++ R +    ++L S  FKL       N++     L++ I++ E 
Sbjct: 872  SRSFPIGVIIRNDPLIY-RSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALESIIDISEA 930

Query: 880  GSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKN 939
             S+ N D+   P+LSV E ++IF YVGYK+L +D +C+D+ GEF+S SLYT+W    S N
Sbjct: 931  RSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTWYVPNSNN 990

Query: 940  EIPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDTFFVLDATSWLRHFAHV 999
               +             LF+E I +       D+PE  ++ K T+FV DATSWLRH A +
Sbjct: 991  TNIEDNINYNSEKENEGLFLECIKS-------DYPE--IDFKTTYFVFDATSWLRHSARI 1041

Query: 1000 YKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGN 1059
            +KLA N++L+FAICLTTFQELRFLRKSKDENV+EAATR +IT+RQLY EN++LPLRFTGN
Sbjct: 1042 FKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGN 1101

Query: 1060 VATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQEN------RDFHHVVLVTDDAN 1113
            VATHIEE+LEFEEQITWR+HVDEFV E++ KAQ +L   +      R F++VVL++DD  
Sbjct: 1102 VATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRLSPRRFNYVVLISDDDA 1161

Query: 1114 MRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
            M++KA++  I TLSTRFVF+ C  +G +  +CT+
Sbjct: 1162 MKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD 1195

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score = 1097 bits (2836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/933 (59%), Positives = 673/933 (72%), Gaps = 28/933 (3%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            QALVQKLQDIYK IV+QE+ELQE+C+QLT+SQTT+L  +W IY++N +L+ NYVTFI+TA
Sbjct: 368  QALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTA 427

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LL  QS  DL IGQEIVE YRI RRLWVYGTITFLDVLKNFS+FMDPEVC+QFITHVFIS
Sbjct: 428  LLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFIS 487

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            IS MLADIP++Y+IPW QRLGDLSRMAIALYPSGFIDWKLS+E+WY +A+KY YG+GKLY
Sbjct: 488  ISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYGYGKLY 547

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLI 477
            YHMST+QQNTLEAFVNLGKSVFCQDTF PS QYMQLVIDNIYQRAF+ER + N RNSQLI
Sbjct: 548  YHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQLI 607

Query: 478  EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFR 537
            EYLKHSEVMLLP+F+ + +LQ+VV+ YF  KFG D ++ NIF  R +F QNP+ LKYFFR
Sbjct: 608  EYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFFR 667

Query: 538  HAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMAID 597
            HAPAFAESHILQ VGFGD KNPFALLF+LP+ L                      ++   
Sbjct: 668  HAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEPTSNESVMSL 727

Query: 598  EEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKF 657
            +    DS  S      Q+F N++S+  PYL PP  ++W  SL YLN+T++ C +IVL+KF
Sbjct: 728  DNISTDSLIS----SDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKF 783

Query: 658  LEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIA 717
            L GP VVALPHL+ W YFII+V  K + + D  SR FW   + R+ P N+IV+FLNVLIA
Sbjct: 784  LHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIA 843

Query: 718  YTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQM 777
            Y LDN + S  I  + EEL +M L +L+  FNNNE+LPEVWKCWG LWFDAI DK     
Sbjct: 844  YALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDT 903

Query: 778  DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQ 837
            +SYE  G+ DH+F D PIDGI FD  DE+G KFWKRA R+IFLFK+IAE F   + +S  
Sbjct: 904  NSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHT 963

Query: 838  AQVHCRRTD-PMNHVLKSFCFKLRDTFYNSNSV-------LQNTIEVFEEGSDANKDMQM 889
            A V+CRR D  +NH+L SF FK+     N N+V       L   IE+ E  ++ N  M  
Sbjct: 964  APVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNITMDA 1023

Query: 890  TPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSW---------GNETSKNE 940
            TP +S+ ENE+IF Y GYKR+  +L  +D+ GE  S + YTSW            + +N 
Sbjct: 1024 TPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAASPENS 1083

Query: 941  IPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDTFFVLDATSWLRHFAHVY 1000
            +  S P +   + + +  I  + T+  E +    +  +N + T FVLDATSWLRH AH+Y
Sbjct: 1084 VAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDG-LNLETTSFVLDATSWLRHSAHIY 1142

Query: 1001 KLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGNV 1060
            KLASN  L F+ICLTTFQELRFLRKSKDENV+EAA RA+I +RQLY++ +++PLRFTGN+
Sbjct: 1143 KLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQLYSDGKVIPLRFTGNI 1202

Query: 1061 ATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQE------NRDFHHVVLVTDDANM 1114
            ATHIEEHLEFEEQITWRSHVDEFV E+I KAQ +  Q       + D    VLV+DD NM
Sbjct: 1203 ATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDNDSRFFVLVSDDENM 1262

Query: 1115 RRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
            +RKA +  I T +TRFVFA C+ +G    ICTN
Sbjct: 1263 KRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score = 1094 bits (2829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/1022 (57%), Positives = 701/1022 (68%), Gaps = 112/1022 (10%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            +ALV+KLQDIYKVIVKQEIELQERCSQLT SQTT+LK LW IYKVN DLINNYVTFITTA
Sbjct: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LL  QS QDL IG+EI+EIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFITHVFIS
Sbjct: 358  LLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            +S MLADIP++Y+IPW QRLGDLSRMAIALYPSGFIDWKLSAE WYMEAMK+ Y HGKLY
Sbjct: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLI 477
            YHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQRAFVERNNGN+RN QLI
Sbjct: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLI 537

Query: 478  EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFG--------------MDTNENN-----I 518
            EYLKHSEVMLLP+FLE+++LQQVVL+YF++KFG              ++T  NN     +
Sbjct: 538  EYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDM 597

Query: 519  FDTRQMFDQNPDQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLXX------ 572
            F +R MF QNP+QLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELP+ L        
Sbjct: 598  FRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERKDKKE 657

Query: 573  ---XXXXXXXXXXXXXXXXXXXXAMAIDEEEY----IDSSFSLGAQVQ----QFFDNIDS 621
                                    M+ID  E     I++ FS     Q    +FF NI+ 
Sbjct: 658  KKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQ 717

Query: 622  LTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVS 681
            L   Y  P SLE+W  SL ++N+ SL CSMIVLKKFL GP+++ALPHLLPW YFII+++ 
Sbjct: 718  LRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILL 777

Query: 682  KVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIAYTLDNIHPSLP------------- 728
            K + +T   S+ FW+ ++  IFPWN I+NFLNVL+ YTLDNI    P             
Sbjct: 778  KREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNV 837

Query: 729  -IDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQMDSYESAGIKD 787
             I  LC + STMG   L++HFN NEDLPEVWKCWG LWFD I +K+ +  DS+E+ GIKD
Sbjct: 838  FILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKD 897

Query: 788  HMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQT-RLVVSSQAQVHCRRTD 846
            HMFLD PIDGIG+  +DE+G  FWKR  R+IFLFK IAENF +  L VS  A    R  +
Sbjct: 898  HMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNN 957

Query: 847  -PMNHVLKSFCFKLRDT---FYNSN-----SVLQNTI--------EVFEEGSDANKDMQM 889
             PM+++LK F FK   +   + ++N      +  NTI        ++ E   + N + ++
Sbjct: 958  VPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLNFEI 1017

Query: 890  TPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEIPQSEPTQQ 949
             P  S++ NE IF Y GYK+L  +   +D+ GEF S S+YT+W  +  +  + Q+     
Sbjct: 1018 PPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILAQNNNNNT 1077

Query: 950  QTANE-ADLFIEGINTSLTEF-NIDFPECK-------------MNGKDTFFVLDATSWLR 994
               +E  DLF   ++     F  +  PE +              N   T+FV DATSWLR
Sbjct: 1078 NATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFVFDATSWLR 1137

Query: 995  HFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPL 1054
            HFAH+YKLASN VL+FA+CLTTFQELRFLRKSKD NVVEA+TRA+IT+RQLY++  +LPL
Sbjct: 1138 HFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPL 1197

Query: 1055 RFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQ----ENRD--------- 1101
            RFTGNVAT IEEHLEFEEQITWRSHVDEFV EA+ KAQ +  +    EN +         
Sbjct: 1198 RFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGEID 1257

Query: 1102 ----------------FHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKIC 1145
                            F +VVL+TDD +MR KAQ   I T  T+ VF+ C+ +G    +C
Sbjct: 1258 ATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSMMGIDEGVC 1317

Query: 1146 TN 1147
            TN
Sbjct: 1318 TN 1319

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 55/99 (55%), Gaps = 16/99 (16%)

Query: 45  RQKRHSSNPYNSAEST-GVKRRVANHDDGITQFLDNGAIPN-------------TPCKEP 90
           RQKRHSSN Y++A++   VKRR+A  ++   +++DN                  TP K  
Sbjct: 53  RQKRHSSNSYSNAKNNPAVKRRIAKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSKGT 112

Query: 91  VSSRRPSATRRTVNRTPRSTTSYVADASASPYCYSPNNS 129
           +S RRPS  ++ +N TP+  +  V++  ASP+ Y P NS
Sbjct: 113 LS-RRPSLIKKQMNSTPQPMSYVVSEVPASPF-YLPANS 149

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1093 bits (2828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/969 (57%), Positives = 690/969 (71%), Gaps = 75/969 (7%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            QALVQKLQDIY+ IVKQEIELQERCSQLTNSQTT++K LWVIYKVN++LINNY++FITTA
Sbjct: 244  QALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITTA 303

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LLP Q +QDL IGQEIVEIYR+ERRLWVYGTITFLDVLKNFSNFMDPEVC QFI+HVF+S
Sbjct: 304  LLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFMS 363

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            ISNML D+P RY+IPW +RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+ Y YGHGKLY
Sbjct: 364  ISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKLY 423

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLI 477
            YHMSTVQQNTLEAFVNLGKSVFCQDTF PSQQYMQLVIDNIYQRAF ER+ G+ RN  ++
Sbjct: 424  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFPIV 483

Query: 478  EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFR 537
            EYLKHSEVMLLPSFLES +LQ+VVL +F+ +FG+  N  + FD +Q+F Q+ ++L+YFF 
Sbjct: 484  EYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYFFS 543

Query: 538  HAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMAID 597
            HAPAFAESHILQLVGFGDP+NPFA+LFELP+ L                           
Sbjct: 544  HAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTNLD---- 599

Query: 598  EEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKF 657
                 D + S    V  +F+NIDS   PY FP  +++W  SL YLN+TS+ CSM VLKKF
Sbjct: 600  -----DGNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKF 654

Query: 658  LEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIA 717
            L  P++ ALPHLLPWA+F+++V  ++  ++  A ++FWL  + RIFPWN++V+FLN L+A
Sbjct: 655  LHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMA 714

Query: 718  YTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQM 777
            + LDN      ++ LCEE + M L  LVEHF N+E+LPEVWKCWG LWFD I +K +++ 
Sbjct: 715  FLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKA 774

Query: 778  DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQ 837
             S +S GI+DH+FLD PIDGI FD+DDESG+KFWKRACRVIF+FK +A+ F   + VS  
Sbjct: 775  SSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSD- 833

Query: 838  AQVHCRRTDPMNHVLKSFCFKLRD--TFYNSNSVLQ--NTIEVFEEGSDANKDMQMTPQL 893
              +  RR     H LK F FK  +    +++   LQ  N I+VFE  S  N + +  P L
Sbjct: 834  TPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSL 893

Query: 894  SVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTS---------WGNE--------- 935
            S+++ ESIF + GY+R+  D  C+++ G+ ++ SLYTS          G++         
Sbjct: 894  SMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVEN 953

Query: 936  -----TSKNEIPQSEPTQQQTANEAD----------LFIEGINTSLTEFNIDFPE----C 976
                    + +  +E T +     A+           F+E +  S       FP     C
Sbjct: 954  GVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDS------RFPHGDLAC 1007

Query: 977  KMNGKDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAAT 1036
              +   T+FVLDATSWLRHFAHVYKLA+N VL+FAICLTTFQELRFLRKSKDE+VVEAAT
Sbjct: 1008 NADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAAT 1067

Query: 1037 RAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQAR-- 1094
            RAVIT RQLY E ++LPLRFTGN+ATH+EEHLEFEEQITWRSHVDEFV EA+ K+Q +  
Sbjct: 1068 RAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFK 1127

Query: 1095 -LSQENRD---------------FHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAV 1138
             L+ + RD               F+ VVLVTDD NMR KA+ H IH  S+RF+FA CN +
Sbjct: 1128 GLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQL 1187

Query: 1139 GNRLKICTN 1147
            G   K+C N
Sbjct: 1188 GYNQKVCIN 1196

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 60/120 (50%), Gaps = 20/120 (16%)

Query: 46  QKRHSSNPYNSAESTGVKRRVANHDDGITQ----------FLDNGAIPNTPCKEPVSSRR 95
           QKRH+SN Y+  +S   KRR       ++Q          FLD+     TP K    +  
Sbjct: 32  QKRHNSNSYDYYDSGYAKRRPNTLSQNVSQNDELAASAACFLDSNL---TPSKHQECT-- 86

Query: 96  PSATRRTVNRTPRSTTSYVADASASPYCYSPNNSNLRIDHLSRMV--NSSGVSIPNVCRD 153
           PS+ +R  + TP+    Y AD   SP+ Y P  S+  ++  S+++  ++S V +P++C D
Sbjct: 87  PSSFQRATDETPQPF--YPADTPQSPF-YLPTTSSSNLEAASKVITNDNSSVQLPDICID 143

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score = 1086 bits (2808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/935 (59%), Positives = 679/935 (72%), Gaps = 41/935 (4%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            QALVQKLQDIYK+I+KQE+ELQERCSQLTNSQTTE+K LWVIYK+N+DLINNYVTFITTA
Sbjct: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            L P QS  DL IG+EIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVC QFITHVFIS
Sbjct: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            IS+ML DIP +YAIPW Q+LGDLSRMA+AL+PSGFIDWKLSAE WYM AM+Y YG+GKLY
Sbjct: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERN-NGNHRNSQ- 475
            YHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQY+QLVIDNIYQRAF +RN + N RN Q 
Sbjct: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555

Query: 476  LIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNI--FDTRQMFDQNPDQLK 533
            L++YLKHSEVMLLP+F+ES DLQQVVL+YF +KFG+D N NN+  F  RQMF QN DQLK
Sbjct: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615

Query: 534  YFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXA 593
            ++FRHA AFAE+ ILQLVG+G+PKNPFALLF LP+ L                      +
Sbjct: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKNQIVGEDGSS 675

Query: 594  M---AIDEEEY---IDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSL 647
                ++   EY   ++++  LG+  + FF+NID L      P S+ +WN SLKY N T+ 
Sbjct: 676  TTFSSVSGMEYMVNMETNVFLGS--EDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTAT 733

Query: 648  HCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNT 707
             CSMIVL+KFL GP++VALPH+LPW YF+I++  +++   D A  EFW   + RIFPWN+
Sbjct: 734  KCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNS 793

Query: 708  IVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFD 767
            +V FLNVL+AY +DN   + P++ LC++  ++ L++L+ +FN NEDLPEVWKC G LWFD
Sbjct: 794  MVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFD 853

Query: 768  AICDKDKVQ-MDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAE 826
             I +K   Q  DSY   GIKD+ FLD P+DGI FD +DE GIKFWKR+ RVIFLF+ I E
Sbjct: 854  IIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVE 913

Query: 827  NFQ--TRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSVLQNTIEV--FEEGSD 882
             F     L +S  A V  RR   +N  L  + FKL      S+ ++ + + V  FEE   
Sbjct: 914  RFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKL---MAKSDDIMFDDMLVSNFEEIDS 970

Query: 883  ANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWG--NETSKNE 940
             N D    P LS++  E+IF YVGYKR+ +D   +D+ G+ +STS Y +W    +T  N 
Sbjct: 971  NNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNG 1030

Query: 941  IP------QSEPTQQQTANEADLFIEGIN---TSLTEF-------NIDFPECKMNGKDTF 984
             P       S        NE +LF +  +    S+ EF       +I         +DT+
Sbjct: 1031 GPLSNNSSSSNAASSDPMNEKELFNKCFDPEYDSVDEFWNKEIYDDIGRKFGMELYEDTY 1090

Query: 985  FVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQ 1044
            F+LDATSWLRHFAHVYK+A+N +L+F+ICLTTFQELRFLRKSKDENVVEAATRA+IT+RQ
Sbjct: 1091 FILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATRAIITLRQ 1150

Query: 1045 LYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQE---NRD 1101
            L++E ++LPLRFTGNVATHIEEHLEFEEQITWRSHVDEFV EA+ KA+ +  ++   N  
Sbjct: 1151 LFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETKRKEQEMHNMK 1210

Query: 1102 FHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCN 1136
               +VLVTDD+NM+ KA +    T STRFVFA  N
Sbjct: 1211 GFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISN 1245

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score = 1067 bits (2759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/952 (57%), Positives = 671/952 (70%), Gaps = 57/952 (5%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            QALVQKLQDIY+ IVKQE+ELQERC+QLT SQTT+LK LW+IYK+N +LINNYV FITTA
Sbjct: 242  QALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTA 301

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LLP Q +QDL IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVC QFITHVFIS
Sbjct: 302  LLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 361

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            IS ML D+P +++ PW++RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+ +I+GHGKLY
Sbjct: 362  ISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLY 421

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLI 477
            YHMSTVQQNTLEAFVNLGKSVFC+DTF PS QYMQLVIDNIYQRAF ERN GNHRNS ++
Sbjct: 422  YHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMV 481

Query: 478  EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFR 537
            EYLKHSEVMLL SFLES +LQ+VVL +F+ KFG+ T+  + F+ R MF Q+ +++KYFFR
Sbjct: 482  EYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFR 541

Query: 538  HAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMAID 597
            HAPAFAESHILQ VGFGDPKNPFALLFELP+ L                        +I+
Sbjct: 542  HAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSKSSHSFT-----SIE 596

Query: 598  EEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKF 657
               ++  S        ++ +N+DS    Y FP  L +W  SL ++NITS  CS IV +KF
Sbjct: 597  TTSHLSPS--------EYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKF 648

Query: 658  LEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIA 717
            L GP+VVA+ H+LPW+YF++++  K+  +     + FW+ LV +IFPWN+IV+FLN+L+A
Sbjct: 649  LRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMA 708

Query: 718  YTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQM 777
            + LDN   + PID LCE+L ++    LVEHF+ +EDLPE+W+CWG LWFD I DK   + 
Sbjct: 709  FVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGED 768

Query: 778  DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQ 837
                ++G KDH F DLP DGI FD DDE G KFWKRACR+IF+FK IA+ F   L +S+ 
Sbjct: 769  GDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAF 828

Query: 838  AQVHCRRTDPMNHVLKSFCFKLRDTFYNS--NSVLQNTIEVFEEGSDANKDMQMTPQLSV 895
            A    RR     H L++F F   +    S   S ++N I +FEE +  N D  + P  S+
Sbjct: 829  AP-QSRRPMTAGHPLQNFSFNFEEIPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQSM 887

Query: 896  LENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTS------------------WGNETS 937
            LE ESIF + GY+++ +D +C+++ G  +S SLYTS                  +G    
Sbjct: 888  LEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSED 947

Query: 938  KNEIPQSEPTQQQTANEADLFIEGINTSLTE--FNIDFP----ECKMNGKDTFFVLDATS 991
             N+ P++    +    E D     +N    E  + + FP     C  +   ++FVLDATS
Sbjct: 948  SNK-PENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDATS 1006

Query: 992  WLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRI 1051
            WLRHFAHV+KLA+N VL+F ICLTTFQELRFLRKSKDE+VVEAATRAVITVRQLY++ ++
Sbjct: 1007 WLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKL 1066

Query: 1052 LPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARL---------------- 1095
            LPLRFTGNVATH+EEHLEFEEQITWRSHVDEFV EA+ KAQ +                 
Sbjct: 1067 LPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIA 1126

Query: 1096 SQENRDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
            + +   FH V LV+DD NMR KA    I T STRF+FA CN +G   + CTN
Sbjct: 1127 TTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score = 1060 bits (2740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/954 (56%), Positives = 669/954 (70%), Gaps = 61/954 (6%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            QALVQKLQDIY+ IVKQE+ELQERCSQLT+SQTT+LK LW+IYKVN++LINNYV FITTA
Sbjct: 212  QALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTA 271

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LLP Q +QDL IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVC QFITHVFIS
Sbjct: 272  LLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 331

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            ISNML D+P ++A PW +RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+ +I+GHGKLY
Sbjct: 332  ISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLY 391

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLI 477
            YHMSTVQQNTLEAFVNLGKSVFC+DTF PSQQYMQLVIDNIYQRAF ERN GN RNS ++
Sbjct: 392  YHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLMV 451

Query: 478  EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFR 537
            EYLKHSEVMLL SFLES +LQ+VVL +F++KFG+ +N  + F  + +F Q+ ++ KYFFR
Sbjct: 452  EYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYFFR 511

Query: 538  HAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMAID 597
            HAPAFAESHILQ+VGFG+PKNPFALLFELP+ L                      A +  
Sbjct: 512  HAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSMEAPSPT 571

Query: 598  EE-EYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKK 656
               EY++S              +DS    Y FP  L +W  SL ++N TS+ CS +VL+K
Sbjct: 572  SPIEYLES--------------VDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQK 617

Query: 657  FLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLI 716
            FL GP+V A  HLLPWAYF++++  ++  +     ++FW+ L  ++FPWN+IVNFLN++I
Sbjct: 618  FLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMII 677

Query: 717  AYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQ 776
            A+ LDN   +  ID LCE+  ++ +  LV+HF+ NEDLPEVWKCWG LWFD I DK  V 
Sbjct: 678  AFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVV 737

Query: 777  MDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSS 836
             +      ++DHMF D+P+DGI FD DDE+G +FWKRACR++F+FK IA+ F   L ++S
Sbjct: 738  DEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLAS 797

Query: 837  QAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNS--VLQNTIEVFEEGSDANKDMQMTPQLS 894
               +  RR+    H L++FCFK  D   +S S  ++   +  FE  S+ N D    P  S
Sbjct: 798  -VPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFENISERNLDPNAPPGQS 856

Query: 895  VLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEIPQSEPTQQQTANE 954
            +LE +S+F   GY++L +D +C+++ G  ++ SLYTS   E  K  I   +    +  + 
Sbjct: 857  MLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLE--KGPIHGGDDFNTERYSR 914

Query: 955  ADLFIEGINTSLTE---------------------FNIDFP----ECKMNGKDTFFVLDA 989
            +D   +  N  + E                     +++ FP     C  +   ++FV DA
Sbjct: 915  SDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDA 974

Query: 990  TSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTEN 1049
            TSWLRHFAHVYKLA+N VL+FAICLTTFQELRFLRKSKDE+VVEAATRAVITVRQLY+E 
Sbjct: 975  TSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEK 1034

Query: 1050 RILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARL-------------- 1095
            R+LPLRFTGNVATH+EEHLEFEEQITWRSHVDEFV EA+ KAQ +               
Sbjct: 1035 RLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDF 1094

Query: 1096 --SQENRDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
              + E   FH + LV+DD NMR KA    I T S+RF+FA CN +G     CTN
Sbjct: 1095 IPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score = 1025 bits (2651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/972 (54%), Positives = 668/972 (68%), Gaps = 76/972 (7%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            Q LVQKLQDIYK IVKQEIELQERC +LTNSQTTELK LW IY+VNS+L++NY+TFITTA
Sbjct: 382  QVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFITTA 441

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            + P Q + D  IG+EI+EIY+IERRLWVYGTITFLD+LKNFSNFMDPEVC QFI HVFIS
Sbjct: 442  IHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHVFIS 501

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            ISNMLADIP +Y + WYQ+LGDLSRMAIALYPS FIDWKLSAE WYM AM++ YGHGKLY
Sbjct: 502  ISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHGKLY 561

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNH-RNSQL 476
            YHMSTVQQNTLEAFVNLGKS+FC++TF PSQQY+QLVI NIYQRA+ + NN N+ RN QL
Sbjct: 562  YHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRNDQL 621

Query: 477  -IEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTN--ENNIFDTRQMFDQNPDQLK 533
             ++Y+KH EV LLP+F ES +LQQVVL+YF DKFG+D N   NN+F +R+MF QN DQ K
Sbjct: 622  LVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNNDQFK 681

Query: 534  YFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXA 593
             F+R++ AFAES ILQ+VG+G+ K+PF+LLFELP+ L                       
Sbjct: 682  CFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILKITQP 741

Query: 594  MAIDEEEYIDSSF------SLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSL 647
                   ++ ++       ++    ++FF+NID++  P   P S+++WN SL+Y N  S+
Sbjct: 742  RLY--HRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVSI 799

Query: 648  HCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNT 707
             CSMIV KKFL  P ++ALPH LPW YFII++V ++    + A  EFW+E V RIFPWN+
Sbjct: 800  KCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWNS 859

Query: 708  IVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFD 767
            IV FLNVL+AY +DN      ++ LC   ++M LD+L+ +FN NE+LPEVWKC G LWFD
Sbjct: 860  IVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWFD 919

Query: 768  AICDKDKVQMDS--------------YESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKR 813
             I +K  +  D               Y+  G+KD+ F D PIDG  FD  DE G +FWKR
Sbjct: 920  TIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWKR 979

Query: 814  ACRVIFLFKRIAENFQT--RLVVSSQAQVHCRRTD--PMNHV---LKSFCFKLRDTFYNS 866
            A RVIFLFK++AE++     L++S +A V  RR D   +N V   L  F FKL  +  + 
Sbjct: 980  AARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLNAS--SD 1037

Query: 867  NSVLQNTIEVFEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVST 926
              +L + IE FE   + N D   TP LS+++ +SIF YVGYKR+  +   +D+ G+F+ST
Sbjct: 1038 GVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNGDFIST 1097

Query: 927  SLYTSWG-----NETSKNEIPQ---------------SEPTQQQTANEADLFIEGIN--- 963
            S + SW      NE S+N                   +  T     NE  +F E  +   
Sbjct: 1098 SFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPMNELLVFNECFDPKY 1157

Query: 964  TSLTEF--NIDFPECKMN----GKDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTF 1017
             +L EF     +P+ + N    GK T+F+LDATSWLRHFAH+YK+A++++L+FAICLTTF
Sbjct: 1158 KTLEEFWSQEIYPDSQTNISLQGK-TYFILDATSWLRHFAHIYKIATSKILKFAICLTTF 1216

Query: 1018 QELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWR 1077
            QELR+LRKSKD NVVEAATRA+IT+RQLY EN +LPLRFTGNVATHIEEHLEFEEQITWR
Sbjct: 1217 QELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEEQITWR 1276

Query: 1078 SHVDEFVFEAIKKAQA----RLSQENRD-------FHHVVLVTDDANMRRKAQQHAIHTL 1126
            SHVDEFV EA+ KA+     RL+  N D          ++LVTDD  M+ KA    I T 
Sbjct: 1277 SHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDITMKNKAMDRKIKTF 1336

Query: 1127 STRFVFATCNAV 1138
            STRF+F+  N +
Sbjct: 1337 STRFIFSMANYI 1348

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/942 (54%), Positives = 649/942 (68%), Gaps = 60/942 (6%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            Q  ++KLQ+IYK+IV QE ELQ+RC  LT SQTTELK LW IYK+N++LI NY+ FI TA
Sbjct: 204  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITA 263

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LL  Q   DL +GQEI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEVC QFIT+ FI 
Sbjct: 264  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFIC 323

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            ISNML DIP +Y+I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MKYIYG GKLY
Sbjct: 324  ISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 383

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGN------- 470
            YH++T+QQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ AF++R++GN       
Sbjct: 384  YHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETA 443

Query: 471  HRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPD 530
            HRNSQLI+YLKH+EVMLLPSFLE+ DLQ VVL+YF+DKFG D N N++F T+ MF QNP+
Sbjct: 444  HRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFCQNPE 503

Query: 531  QLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXX 590
             L+Y+FRHAPAFAES ILQL+GFG+PKNPFALLF+LP+ L                    
Sbjct: 504  SLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHL-----------KFKKDKREK 552

Query: 591  XXAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPS-LEVWNCSLKYLNITSLHC 649
              + A +   Y D  F      + +F NID+L S +  PP+ + +W  SL Y+N+TS+ C
Sbjct: 553  KKSGAAEIPHYRD-PFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQC 611

Query: 650  SMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIV 709
            S+ VL KFL  P+ VALPH L W +FIIAV+ K++ I       FW+  + R  PWN++V
Sbjct: 612  SIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMV 671

Query: 710  NFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAI 769
             F NVL+ Y LDN+HP L  +   E+  ++ LD L+E+FN NE+LPEVWKCWG LWFDA+
Sbjct: 672  TFSNVLVCYMLDNLHPFL--EKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAV 729

Query: 770  CDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENF- 828
                  + D  E  G++DH+F D P+DGI FD+ DE G KFW R+ R I   K IA+ F 
Sbjct: 730  -----KKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFP 784

Query: 829  QTRLVVSSQAQVHCRRTD-PMNHVLKSFCFKL----RDTFYNSNSV--LQNTIEVFEEGS 881
               L V+ QA V CRR D   ++ LK+  FKL     D F ++N +  L +TIE+ E   
Sbjct: 785  DLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEINELIE 844

Query: 882  DANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEI 941
              N D+Q TP+LSV+  ESIF Y GY RL  D  C+D+ G F S  +YT W N  +   +
Sbjct: 845  TVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVGNGVTL 904

Query: 942  P-QSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDT--------FFVLDATSW 992
               SE     T N+          SL    I F +    GK+T        +FV+DATSW
Sbjct: 905  DVSSESLYDSTTNDL---------SLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSW 955

Query: 993  LRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRIL 1052
            LRHFAH++KLA N +L+FAICLTTFQELR+LR SKD+NVVEAATR+VIT+RQLY E +I+
Sbjct: 956  LRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKII 1015

Query: 1053 PLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQE-------NRDFHHV 1105
            P+RFTGN+ATHIEE+LEFEEQITW++HVDEFV +AI K       E        R     
Sbjct: 1016 PMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFA 1075

Query: 1106 VLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
            VLVTDD NM +KA+   I T +T+++F+  + +G    +CTN
Sbjct: 1076 VLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 62/131 (47%), Gaps = 13/131 (9%)

Query: 1   MIETFNHTSDRLTKNTDYIEQEKRPMCQPRHLNGPLDEIPASAGRQKRHSSNPYN-SAES 59
           M++     +D  +  TDY     R    P  +   +    A+   QKRHSS+ +N + ES
Sbjct: 1   MVDIMAQVNDDPSNETDY----SRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPES 56

Query: 60  TGVKRRVANHDDGITQFLDNG------AIPNTPCKEPVSSRRPSATRRTVNRTPR--STT 111
           +  KRRV    + + +   +G      ++ N P K    SRRPS +R+ +  TP+  +++
Sbjct: 57  SFAKRRVPGVVEPVGKGFIDGITTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSS 116

Query: 112 SYVADASASPY 122
           +   D   SPY
Sbjct: 117 NSAMDIPKSPY 127

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/941 (53%), Positives = 647/941 (68%), Gaps = 58/941 (6%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            Q  ++KLQ+IYK+IV QE ELQ+RC  LT SQTTELK LW IY++N++LI NY+ FI TA
Sbjct: 205  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LL  Q   DL +GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVC QFI + FIS
Sbjct: 265  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            +SNML DIP +Y+I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MKYIYG GKLY
Sbjct: 325  VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGN------- 470
            YH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ AF++R++G+       
Sbjct: 385  YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIA 444

Query: 471  HRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPD 530
            HRNSQLI+YLKH+EVMLLPSFLE+ DLQ VVL+YF+DKFG D N N++FDT+ MF QNP+
Sbjct: 445  HRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQNPE 504

Query: 531  QLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXX 590
             L+Y+FRHAPAFAES +LQL+GFG+PKNPFALLF+LP+                      
Sbjct: 505  SLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPK-----------YLKLKKDKREK 553

Query: 591  XXAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYL-FPPSLEVWNCSLKYLNITSLHC 649
              + A +   Y D  F +    + +F NID+L S +   P +L +W  SL ++N+TS+ C
Sbjct: 554  KRSEATETSSYTD-PFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQC 612

Query: 650  SMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIV 709
            S+ VL KFL  P+VVALPH L W +FI+A++ K++ +       FW+  + R  PWN+IV
Sbjct: 613  SIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIV 672

Query: 710  NFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAI 769
               NVL+ Y LDN+HP L  +   E+  ++ LD L+E++N NE+LPE+WKCWG LWFDAI
Sbjct: 673  TLGNVLVCYMLDNLHPFLKKE--LEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI 730

Query: 770  CDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENF- 828
                  + D  E  G++DH+F D P+DGI FD  DE G KFW R+ R + L K IA+ F 
Sbjct: 731  -----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFP 785

Query: 829  QTRLVVSSQAQVHCRRTD-PMNHVLKSFCFKL----RDTFYNSNSV--LQNTIEVFEEGS 881
               L VS QA V CRR D P ++ LK+  FKL     D + ++N +  L +TIE+ EE  
Sbjct: 786  DLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDTIEINEEIE 845

Query: 882  DANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEI 941
              N D Q TP LSV+  ESIF Y GY RL  D  C+D+ G F S  +Y+ W N  +   +
Sbjct: 846  AVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGVTL 905

Query: 942  PQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDT--------FFVLDATSWL 993
              S  +    AN         N SL    I F +     K +        +FV+DATSWL
Sbjct: 906  DVSGESIYDVANN--------NLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATSWL 957

Query: 994  RHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILP 1053
            RHFAH++KLA N  L+FAICLTTFQELR+LR SKD+ VVEAATR+VIT+RQLY E +I+P
Sbjct: 958  RHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIP 1017

Query: 1054 LRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQE-------NRDFHHVV 1106
            +RFTGN+ATH+EE+LEFEEQITW++HVDEFV +AI K   R   E       N+     V
Sbjct: 1018 MRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEFAV 1077

Query: 1107 LVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
            LVTDD NM +KA+   I T +T+++F+  + +G    +CTN
Sbjct: 1078 LVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 62/131 (47%), Gaps = 13/131 (9%)

Query: 1   MIETFNHTSDRLTKNTDYIEQEKRPMCQPRHLNGPLDEIPASAGRQKRHSSNPYN-SAES 59
           M++     +D  +  TDY     R      H+   +    A+   QKRHSS+ +N + ES
Sbjct: 1   MVDLMVPANDDPSNETDY----SRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPES 56

Query: 60  TGVKRRVANHDDGITQFLDNG------AIPNTPCKEPVSSRRPSATRRTVNRTPRSTTSY 113
           +  KRRV    D + +   +G      +  NTP K   +SRRPS +R+ +  TP+  TS 
Sbjct: 57  SFAKRRVPGIVDPVGKGFIDGITNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSS 116

Query: 114 VA--DASASPY 122
           +   D   SPY
Sbjct: 117 IPTMDVPKSPY 127

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  995 bits (2573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/939 (53%), Positives = 650/939 (69%), Gaps = 54/939 (5%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            Q  ++KLQ+IY++IV QE ELQ+RC  LT SQTTELK LW IY++N++LI NY+ FI TA
Sbjct: 205  QTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LL  Q   DL +GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVC QFI + FIS
Sbjct: 265  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            +S+ML DIP +Y+I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MKYIYG GKLY
Sbjct: 325  VSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVER-------NNGN 470
            YH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ AF++R       N   
Sbjct: 385  YHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETA 444

Query: 471  HRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPD 530
            HRNSQLI+YLKH+EVMLLPSFLE+ DLQ VVL+YF+DKFG D N N+IFDT+ MF QNP+
Sbjct: 445  HRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPE 504

Query: 531  QLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXX 590
             L+Y+FRHAPAFAES +LQL+GFG+PKNPFALLF+LP+ L                    
Sbjct: 505  SLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYL-----------KLKRHKREK 553

Query: 591  XXAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPY-LFPPSLEVWNCSLKYLNITSLHC 649
              + A +  +Y D  F      + +F NIDSLTS +   P +L +W  SL ++N+TS+ C
Sbjct: 554  KKSGATEVPQYRD-PFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQC 612

Query: 650  SMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIV 709
            S+ VL KFL  P+VVALPH L W +FI+A++ K++ +   A   FW+  + R  PWN++V
Sbjct: 613  SIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMV 672

Query: 710  NFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAI 769
            N  NVL+ Y LDNIHP L  +   E   ++ LD L+E+FN NE+LPE+WKCWG LWFDAI
Sbjct: 673  NLANVLVCYMLDNIHPFLERE--LERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAI 730

Query: 770  CDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENF- 828
                  + D  E  G++DH+F D P+DGI FD  DE G +FW R+ R I + K +A+ F 
Sbjct: 731  -----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFP 785

Query: 829  QTRLVVSSQAQVHCRRTD-PMNHVLKSFCFKL---RDTFYNSNSVLQ---NTIEVFEEGS 881
               L V+ QA V CRR D   ++ LK+F FKL    +  +N N+ L    +TIE+ E+  
Sbjct: 786  DLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELYDTIEINEKIE 845

Query: 882  DANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEI 941
              N+D++ TP LSV+  E+IF Y GY RL  D  C+D+ G F S  +Y+ W N  +   +
Sbjct: 846  RVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVGNGMVL 905

Query: 942  PQSEPTQQQTANE------ADLFIEGINTSLTEFNIDFPECKMNGKDTFFVLDATSWLRH 995
              S  +    AN         +F + I T+    N D    K      +FV+DATSWLRH
Sbjct: 906  DVSSESMYDAANNNLSPHWEKIFFDRITTA--GHNGD----KNGNCSVYFVIDATSWLRH 959

Query: 996  FAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLR 1055
            FAH++KLA N +L+FAICLTTFQELR+LR SKD+NVVEAATR+VIT+RQLY E +I+PLR
Sbjct: 960  FAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLR 1019

Query: 1056 FTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQE-------NRDFHHVVLV 1108
            FTGN+AT++EE+LEFEEQITW +HVDEFV +AI K       E       N++  + VLV
Sbjct: 1020 FTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYAVLV 1079

Query: 1109 TDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
            TDD NM  KA+   I T +T+++F+  + +G    +CTN
Sbjct: 1080 TDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 50/86 (58%), Gaps = 9/86 (10%)

Query: 46  QKRHSSNPYN-SAESTGVKRRVANHDDGITQ-FLDNGA-----IPNTPCKEPVSSRRPSA 98
           QKRHSS+ +N + ES+ VKRRV    + + + F+D  A     + NTP K    SRRPS 
Sbjct: 42  QKRHSSSSHNDTPESSFVKRRVPGVVEPVGKGFIDGIASGQVSVQNTPSKTDDISRRPSI 101

Query: 99  TRRTVNRTPRSTTSYVA--DASASPY 122
           +R+ +  TP+  T+ ++  D   SPY
Sbjct: 102 SRKAMETTPKVNTASISTIDVPKSPY 127

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  987 bits (2552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/938 (53%), Positives = 643/938 (68%), Gaps = 52/938 (5%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            Q  ++KLQ+IYK+IV QE ELQ+RC  LT SQTTELK LW IY++N++LI NY+ FI TA
Sbjct: 205  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LL  Q   DL +GQEI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEVC QFI + FIS
Sbjct: 265  LLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            +SNML DIP +Y+I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MKYIYG GKLY
Sbjct: 325  VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVER-------NNGN 470
            YH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ AF++R       N   
Sbjct: 385  YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETA 444

Query: 471  HRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPD 530
            H+NSQLI+YLKH+EVMLLPSFLE+ DLQ VVL+YF++KFG D N N++FDT+ MF QNP+
Sbjct: 445  HKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQNPE 504

Query: 531  QLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXX 590
             L+Y+FRHAPAFAES +LQL+GFG+PKNPFALLF+LP+                      
Sbjct: 505  SLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPK-----------YLKLKKDKREK 553

Query: 591  XXAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPY-LFPPSLEVWNCSLKYLNITSLHC 649
              + A +  +Y D  F      + +F NID+L+S +   P +L +W  SL ++N+TS+ C
Sbjct: 554  KRSSATETPQYRD-PFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQC 612

Query: 650  SMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIV 709
            S+ VL KFL  P V+ALPH L W YF++A++ +++ I       FW+  + R  PWN++V
Sbjct: 613  SIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMV 672

Query: 710  NFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAI 769
            +  NVL+ Y LDN+HP L  +   E   +  LD L+EHFN NE+LPE+WKCWG LWFDAI
Sbjct: 673  SLANVLVCYMLDNLHPFLKKE--LESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAI 730

Query: 770  CDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENF- 828
                  + D  E  G++DH+F D P+DGI FD  DE G +FW R+ R I L K IA+ F 
Sbjct: 731  -----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFP 785

Query: 829  QTRLVVSSQAQVHCRRTD-PMNHVLKSFCFKLRDTF-------YNSNSVLQNTIEVFEEG 880
               L V+ QA V CRR D P ++ L+ F FKL D +        N    L  TIE+ E+ 
Sbjct: 786  DLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKL-DAYDEGNNNDNNELDELYETIEINEKI 844

Query: 881  SDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNE 940
             + N D++ TP LSV+  ESIF Y GY RL  D  C+D+ G F S  +Y+ W N    N 
Sbjct: 845  DNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSN--VGNG 902

Query: 941  IP---QSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDT-FFVLDATSWLRHF 996
            +P    +EP    T N+  L  E I          +  C  N   T +FV+DATSWLRHF
Sbjct: 903  VPIDVSNEPIYDVTDNDLSLHWEKI--FFDRIAAAYKNCDENDNCTIYFVVDATSWLRHF 960

Query: 997  AHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRF 1056
            AH++KLA N +L FAICLTTFQELR+LR SKD+NVVEAATR+VIT+RQLY E +I+P+RF
Sbjct: 961  AHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRF 1020

Query: 1057 TGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQE-------NRDFHHVVLVT 1109
            TGN+ATH+EE+LEFEEQITW++HVDEFV +AI K       E       N++    VLVT
Sbjct: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQFAVLVT 1080

Query: 1110 DDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
            DD NM +KA+   I T +T+++F+  + +G    +CTN
Sbjct: 1081 DDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1118

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 9/86 (10%)

Query: 46  QKRHSSNPYN-SAESTGVKRRVANHDDGITQ-FLD---NGAIP--NTPCKEPVSSRRPSA 98
           QKRHSS+ +N + ES+  KRRV    + + + F+D   NG I   NTP K    SRRPS 
Sbjct: 42  QKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGVTNGQISAQNTPSKVDDVSRRPSI 101

Query: 99  TRRTVNRTPRSTTSYVA--DASASPY 122
           +R+ +  TP++ T+ ++  D   SPY
Sbjct: 102 SRKVMESTPQAKTASISTMDVPKSPY 127

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/959 (54%), Positives = 646/959 (67%), Gaps = 73/959 (7%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            QAL++KLQ+IY+ IV+QE ELQ+RCSQLT SQTT+LK LW+IYKVN++LI+NY  FITTA
Sbjct: 283  QALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMFITTA 342

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LLP Q + DL IG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFI +VFIS
Sbjct: 343  LLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIYVFIS 402

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            ISNML DIP +++I W +RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+KY +GHGKLY
Sbjct: 403  ISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGHGKLY 462

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLI 477
            YHMSTVQQNTL AFVNLGKSVFC+DTF PSQQYMQLVIDNIYQRAF ERN+G+HRN+ L+
Sbjct: 463  YHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRNAHLV 522

Query: 478  EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFR 537
            EYLKH+EVMLLPSFLES++LQ VVL +F  KFG+ +N  + FD R +F Q+ ++LK+FFR
Sbjct: 523  EYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSNV-DFFDPRLVFVQDSERLKHFFR 581

Query: 538  HAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMAID 597
            HA  +AESH+LQLVGFGDP+NPFALLFELP+ L                        +ID
Sbjct: 582  HASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSSTSTQYDT--SID 639

Query: 598  EEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKF 657
            +    D +F   A   +FF+ IDS    Y FP  + +W  SL Y N+T++ CSMIVL+KF
Sbjct: 640  D----DCAF---AAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKF 692

Query: 658  LEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIA 717
            L GP++ ALPHLLPW YF+ A  S+V  I     R FW+ LV ++FP+NTI+ FLNVL+ 
Sbjct: 693  LHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLL 752

Query: 718  YTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQM 777
            Y  +    + P D   E+   M L  LV +F  NE+LPEVW+CWG LWFDA+  K    +
Sbjct: 753  YMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHITNL 812

Query: 778  DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQ 837
                S G+KDHMF+D PIDGI FD +DESG KFWKR  RVI LF+ +A      L     
Sbjct: 813  TDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGL----- 867

Query: 838  AQVHCRRTDPMNHVLKSFCFKLR-------DTFYNSNSVLQNTIEVFEEGSDANKDMQMT 890
                  R        +S  FK         D +    +++ +T   FE+ S  N D + T
Sbjct: 868  ------REISGGRNWRSLVFKFEEPPSEWCDMYLEPFTLVFDT---FEQISPVNLDQRAT 918

Query: 891  PQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETS----------KNE 940
            P   +  +  I    GY+ LL D  C++R G+ ++ SLYT    E+S          K  
Sbjct: 919  PYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRL 978

Query: 941  IPQSE--PTQQQTAN------EADLFIEGINTSLTEFNIDFPE--------CKMNGKDTF 984
            +   E   T+++  N      E  +  E +  +  + ++ + +        C  +   T+
Sbjct: 979  LENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFADTHVTY 1038

Query: 985  FVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQ 1044
            FVLDAT+WLRHF HVYKLA+N +L+FAICLTTFQELRFLRKSKDE+V+EAATRAVITVRQ
Sbjct: 1039 FVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQ 1098

Query: 1045 LYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQENRD--- 1101
            LY E ++LPLRFTGNVA H+EEHLE EEQ+TWRSHVDEFV EAI KAQ + +  N D   
Sbjct: 1099 LYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNALNDDAKA 1158

Query: 1102 -------------FHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
                         F+ + LVTDD NMR KA    I   STRF+F+ CN +G+   +CTN
Sbjct: 1159 ASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHAKNVCTN 1217

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/962 (53%), Positives = 636/962 (66%), Gaps = 77/962 (8%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            Q LV+KLQ+IYK IVKQE ELQERCSQLT SQTT+LK LWVIYK+N++LI+NY TFITTA
Sbjct: 321  QTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFITTA 380

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LLP Q   DL IGQEI+E+YRIERRLW+YGTITFLDVLKNFSNFMDPEVC QFI +VFIS
Sbjct: 381  LLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVFIS 440

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            ISN+L +IP  +++ W +RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+KY +GHGKLY
Sbjct: 441  ISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGKLY 500

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLI 477
            YHMSTVQQNTL AFVNLGKSVFC+DTF PSQQYMQLVIDNIYQRAF ERN+G+HR S ++
Sbjct: 501  YHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSHIV 560

Query: 478  EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFR 537
            EYLKH+EVMLLPSFLE+ + Q VVL +F  KFG  T   N FD   +F Q+ ++LK+FFR
Sbjct: 561  EYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGA-TGSANFFDPSLIFVQDCERLKHFFR 619

Query: 538  HAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMAID 597
            HA  +AESHILQLVGFGDP+NPFALLFELP+C+                      +    
Sbjct: 620  HASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSKSTASNQSDMS---- 675

Query: 598  EEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKF 657
                ID +F LG  V QFF+ ++S  + Y F   L +W  SL Y+N TS+ CSM+VL+KF
Sbjct: 676  ----IDDTF-LGDPV-QFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKF 729

Query: 658  LEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIA 717
            L   ++ ALPHLLPWAYF++AV  ++  I +  S+ FW+  + +IFPW +I NFLNVL+ 
Sbjct: 730  LNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLL 789

Query: 718  YTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQM 777
            Y  D      PID        M L +L+E+F  NEDLPEVW CWG LWFD I  K    +
Sbjct: 790  YINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNL 849

Query: 778  DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQ 837
                S G+KDHMFLD P+DGI FD  DESG KFWKR  RVI LF+ IA  F       + 
Sbjct: 850  VDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGFTEFNG 909

Query: 838  AQVHCRRTDPMNHVLKSFCFKL-------RDTFYNSNSVLQNTIEVFEEGSDANKDMQMT 890
            +              KS  FK        ++ +  S S        FE  S  N D+Q  
Sbjct: 910  SD-----------DWKSLVFKFNEPPAEWKEQYLGSFS---KEYGEFESISFVNTDLQSP 955

Query: 891  PQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEIPQSE---PT 947
            P   ++    I    GYK+L+ D  C+++ G+ ++ SLYTS  +E        SE    T
Sbjct: 956  PHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGST 1015

Query: 948  QQQTAN------------------EADLFIEGINTSLTEFNIDFPECKMNG--------K 981
            ++   N                  E  +  E +    +  N  + +C   G         
Sbjct: 1016 KRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTH 1075

Query: 982  DTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVIT 1041
             T+FVLDAT+WLRHF HVYKLA++ +L+FAICLTTFQELRFLRKSKDE+V+EAATRAVIT
Sbjct: 1076 VTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVIT 1135

Query: 1042 VRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQENRD 1101
            VRQLY E ++LPLRFTGNVA H+EEHLE EEQ+TWRSHVDEFV EAI KAQ++ +Q N+D
Sbjct: 1136 VRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNKD 1195

Query: 1102 ----------------FHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKIC 1145
                            F+ + LVTDD NMR KA+  +I   ST+F+FA C+ +G   K+C
Sbjct: 1196 AKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVC 1255

Query: 1146 TN 1147
            T+
Sbjct: 1256 TD 1257

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/1018 (47%), Positives = 651/1018 (63%), Gaps = 117/1018 (11%)

Query: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
            QAL+ KLQDIYK I+ QE+ELQ  CS +T+SQTT+LK++W +YK+N +L+NNYV FITTA
Sbjct: 274  QALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTA 333

Query: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
            LLP QS  DL IGQEI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+C QFI HVFIS
Sbjct: 334  LLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFIS 393

Query: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
            I+NM   IP +++IPW+ RLGDLSRMA ALYP G  DWKLSAE+WY EAMKY YG GKLY
Sbjct: 394  IANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLY 453

Query: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLI 477
            YHM+TVQQN+L AF+NLGKSVFC+D F P+QQY+QLVIDNIYQRA++ R   +  N Q++
Sbjct: 454  YHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQIL 513

Query: 478  EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFR 537
            +YLKH+E+M+LP+F+E+ +LQ++  +YF +KFG D   NN FDTR MF QN + +K++FR
Sbjct: 514  DYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKFYFR 573

Query: 538  HAPAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMAID 597
            H+P FA++HILQ+VG+G+  N FALL+ELP+ +                       M+ID
Sbjct: 574  HSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDN-----MSID 628

Query: 598  EEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKF 657
               +  S   +   V ++F++++++   +  PP++++W  SL+Y N T + C M+VL+KF
Sbjct: 629  TLSFQVSGNEI-HDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKF 687

Query: 658  LEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIA 717
            L+GP V ALPHLLPW YF+I+V  K++ + D  S+ FW   + RIFPWNTI+NFLNVLIA
Sbjct: 688  LQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIA 747

Query: 718  YTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQM 777
            +  DN      ++ LCE  S + LD+++ +F+ NE+LPEVW CWG LWFD I +K +   
Sbjct: 748  FLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSY 807

Query: 778  DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVV--- 834
               ++AGIKD  FLD P DGI FD +D++G KFWKRACR++FLFK  AE F   L +   
Sbjct: 808  SGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTNI 867

Query: 835  ----SSQAQVHCRRTDPMNHVLKSFCFKLRDT------------FYNSNSVLQNTIEVFE 878
                S +  +  ++ +  N     F FK   T            ++   S+    +  FE
Sbjct: 868  NSLNSEEENIFTKKQEKRN---IDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFE 924

Query: 879  EGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSW------ 932
              S+ N  +   PQLSV++ ESIF YVGYK+LL     YD+ G     ++Y++W      
Sbjct: 925  SISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQL 984

Query: 933  -----------------GNETSKN-EIPQS---------EPTQQQTANEADL-------- 957
                             G + SKN EI +          + +Q+ + + A++        
Sbjct: 985  GNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAEVEREGDETE 1044

Query: 958  ---------FIEGINTSLTEFNIDFPECKMNGK------DTFFVLDATSWLRHFAHVYKL 1002
                      ++   T+  + +  F   K+NG+       T+F+ DAT+WLRHFAH+YK+
Sbjct: 1045 DETEETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKI 1104

Query: 1003 ASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGNVAT 1062
            A + +L F ICLTTFQELRFLR+S+DENV+EAATRAVI +R LY   +++PLRF G +A+
Sbjct: 1105 AYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIAS 1164

Query: 1063 HIEEHLEFEEQITWRSHVDEFVFEAIKKAQ--------------ARLSQENRDFHH---- 1104
            HIEEHLEFEEQITWRSHV+EFV EA+ K+Q              A    EN D       
Sbjct: 1165 HIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADT 1224

Query: 1105 ---------------VVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147
                            VLVTDD NM  KA++  I T STRF+F+ C+ +G +  ICTN
Sbjct: 1225 KQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282

 Score = 36.2 bits (82), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (57%), Gaps = 6/64 (9%)

Query: 46  QKRHSSNPYNSAESTGVKRR--VANHDDGITQFLDNGAIPNTP---CKEPVSSRRPSATR 100
           QKRH+S+  N    T VKRR  V + ++ I  FLD+ +  ++P   C+ P  SR  S T+
Sbjct: 48  QKRHNSSANNHTRDTIVKRRLPVQSDENPIGNFLDSFSKNSSPLQQCRTP-GSRPHSVTK 106

Query: 101 RTVN 104
           +T N
Sbjct: 107 KTSN 110

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/961 (51%), Positives = 630/961 (65%), Gaps = 68/961 (7%)

Query: 240  LVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTALL 299
            LV+KLQ+IYK IVKQE ELQERCS LT  QTT+LK LW+ YK+N++LI+NY+ FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 300  PPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISIS 359
            P QS+  LAIGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFI +VFI++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 360  NMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYYH 419
            NML D+P +Y+IPW +RLGDLSRMAIALYPSGF+DWKLSAEHWY E++K+ +GHGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 420  MSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLIEY 479
            MSTVQQNTLEAFVNLGKSVFC+D F PS QYMQLVIDNIYQRAF ER++  +R + +++Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 480  LKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRHA 539
            LKH+EVMLLPSFLES++LQ VV+ YF+ KFG+ ++  N FD   +F Q+ ++LK+FFRH+
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGV-SSSGNFFDPNLIFIQDAERLKHFFRHS 582

Query: 540  PAFAESHILQLVGFGDPKNPFALLFELPRCLXXXXXXXXXXXXXXXXXXXXXXAMAIDEE 599
              F++SHILQL GFGDPKNPFA+LFEL + L                        ++D  
Sbjct: 583  SLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEG-----SLDPV 637

Query: 600  EYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLE 659
            E+   S    A  + FF  IDS   PY FP  L VW  SL Y+N+TS+ C MIVL++FL 
Sbjct: 638  EF---SSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLY 694

Query: 660  GPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIAYT 719
            GP+V ALPH+LPW  FII++  ++  + D   ++FW+  + RIFPW++++ F+N LI Y 
Sbjct: 695  GPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYC 754

Query: 720  LDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQMDS 779
            +     +  ID        M  ++L+     NE+LPE W CWG LWF+ I  K  + + +
Sbjct: 755  MVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTT 814

Query: 780  YESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQAQ 839
             ES G+ D +FLD P +GI FD DDE G K+W+R CR + LF  I E        +    
Sbjct: 815  LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE------WEACDGY 868

Query: 840  VH-CRRTDPMNHVLKSFCFKLRDTFYNSNSV----LQNT---IEVFEEGSDAN-KDMQMT 890
             H C++ +P     K+  F+  D   +  SV     +N     E FE  S+ N  D    
Sbjct: 869  GHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQD 928

Query: 891  PQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTS---------WGNETSKNEI 941
               S++   SI    G+K +  D  C+++ G+ ++ SLYT           G++ + N+I
Sbjct: 929  GSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKI 988

Query: 942  PQSEPTQQQTANEADLFIEGINTSLTE--FNIDFPE-------------CKMNGKDTFFV 986
              +     Q   E    I+ +     E   N DF +             C+ +   TFFV
Sbjct: 989  LDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFV 1048

Query: 987  LDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLY 1046
            LDAT+WLRHFAH+YKLA++ VL+FAICLTTFQELRFLRKSKDE+V+EAATRAVI VRQLY
Sbjct: 1049 LDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLY 1108

Query: 1047 TENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQENRD----- 1101
             E ++L LRFTGNVA H+EEHLE EEQ+TW+SHVDEFV +AI KAQ + +  N D     
Sbjct: 1109 YERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKG 1168

Query: 1102 ---------------FHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICT 1146
                           F+ V LVTDD NMR KAQQ  I T STRFVFA C  +G    +CT
Sbjct: 1169 KDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCT 1228

Query: 1147 N 1147
            N
Sbjct: 1229 N 1229

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 6/83 (7%)

Query: 42  SAGRQKRHSSNPYNSAESTGVKRRVANHDDGITQFLD--NGAIPNTPCKEPVSSRRPSAT 99
           S   QKRH+SN  +  +S  +KRR     DG+ + +D     IP  PC+   +S   S +
Sbjct: 12  SGLHQKRHNSNSVDYYDSNIIKRRTG---DGVPENVDISVAEIPQEPCQYLDTSLLTSPS 68

Query: 100 R-RTVNRTPRSTTSYVADASASP 121
           + R   +TP  T  +      +P
Sbjct: 69  KIRHHEKTPSITKPHTLQMEQTP 91

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  528 bits (1361), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 271/376 (72%), Positives = 299/376 (79%), Gaps = 43/376 (11%)

Query: 238 QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
           QAL+QKLQDIYK+IVKQEI+LQ+RCSQLT SQTT+LK LW IYK+N DLINNY+ FIT A
Sbjct: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455

Query: 298 LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
           LLP QS  DL IG+EI+EIYRIERRLWVYGTITFLDVLK+FSNFMDPEVC QFI+HVFI+
Sbjct: 456 LLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515

Query: 358 ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
           IS +L DIP +Y+I W QRLGDLSRMAIALYPSGFIDWKLSAEHWY EAMK+ Y HGKLY
Sbjct: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575

Query: 418 YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLI 477
           YHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQRAFVERNNGNHRN QLI
Sbjct: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635

Query: 478 EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFG-MDTNEN-------------------- 516
           EYLKH+EVMLLP+FLES DLQ VVL+YF+ KFG +D+                       
Sbjct: 636 EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPYS 695

Query: 517 ----------------------NIFDTRQMFDQNPDQLKYFFRHAPAFAESHILQLVGFG 554
                                 +IF  + MF QNPD LKYFFRH+  FA+SHILQLVGFG
Sbjct: 696 SSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755

Query: 555 DPKNPFALLFELPRCL 570
           DPKNPFALLFELP+ L
Sbjct: 756 DPKNPFALLFELPKFL 771

 Score =  455 bits (1171), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 254/578 (43%), Positives = 345/578 (59%), Gaps = 95/578 (16%)

Query: 613  QQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEGPMVVALPHLLPW 672
            ++FF+NID L  PY  P ++E+W  SLK +N+ SL CS+IVLKKFL GP+++ALPHLL W
Sbjct: 866  EEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925

Query: 673  AYFIIAVVSKVQH-ITDGASREFWLELVNRIFPWNTIVNFLNVLIAYTLDNIHPS----- 726
             +FII+++ K+++ ITD  S+ FW   +  I PWN+IVNFLNVL+ Y LDNI+       
Sbjct: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985

Query: 727  LPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDK-------------- 772
            + +      +S+  L+++++ FN NE+LPE+WKCWG LWFD IC+K              
Sbjct: 986  ISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNN 1045

Query: 773  ----------DKVQMDSYES------AGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACR 816
                      + +  D+Y++       GI+DH  LD P+DGIGF  +DE GI F+KR+ R
Sbjct: 1046 NTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIR 1105

Query: 817  VIFLFKRIAENF-QTRLVVSSQAQVHCRRTD-PMNHVLKSFCFKLRDTFYNS-------- 866
            +IFL K + E F    L +S +   +CR T  P N +L +F FKL + +  S        
Sbjct: 1106 LIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTE 1165

Query: 867  -----------------NSVLQNTIEVF---EEGSDANKDMQMTPQLSVLE-NESIFGYV 905
                              S+L N +E F   E   + N ++Q+ P LS+L  NE+IF Y+
Sbjct: 1166 QNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYL 1225

Query: 906  GYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSK-NEIPQSEPTQQQTANEADLFIEGI-- 962
            GYKRL  ++  +   GE +S S+Y+SW  + +K  E  Q +  Q+   N++ +  E +  
Sbjct: 1226 GYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTV 1285

Query: 963  ------NTSLTEF-------------------NIDFPECKMNGKDTFFVLDATSWLRHFA 997
                  + S  EF                   N       +N   TFFV DATSWLRHFA
Sbjct: 1286 GDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFA 1345

Query: 998  HVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFT 1057
            H+YKL+ N  L+FA+CLTTFQELRFLRKSKD NVVEA+TRA+IT+RQLY E ++LPLRFT
Sbjct: 1346 HIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFT 1405

Query: 1058 GNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARL 1095
            GNVAT IEEHLEFEEQITWRSHVDEFV EAI ++Q R 
Sbjct: 1406 GNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF 1443

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  466 bits (1200), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 236/409 (57%), Positives = 288/409 (70%), Gaps = 76/409 (18%)

Query: 238 QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297
           Q L+QKLQ+IYK+IV QE+ELQ++C++L+ SQ+T+LK LW IYK+N DLINNY+ FI T+
Sbjct: 267 QNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTS 326

Query: 298 LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357
           L P QS  D  IG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+ +QFITHVF S
Sbjct: 327 LSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFES 386

Query: 358 ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417
           ISNM++D+P  +  PWYQRLGDLSRMAIALYPS FIDWKLS+E+WY+E+MK+ + HGKLY
Sbjct: 387 ISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLY 446

Query: 418 YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNN--------- 468
           YH+STVQQN LEAFVNLGKSVFC DTF PSQ+YMQLVIDNIYQRAF+ERN+         
Sbjct: 447 YHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSNNAG 506

Query: 469 --------------GNHRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFG---- 510
                          N +   LIEYLKHSEVMLLP+FLE+  L+ VVL YF + FG    
Sbjct: 507 SSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAI 566

Query: 511 -----------MDTN-------------EN------------------------NIFDTR 522
                      ++TN             EN                        N+F+ R
Sbjct: 567 QSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLFNFR 626

Query: 523 QMFDQ-NPDQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCL 570
            +F Q N D LKYFF+++  FAESHILQL+GFGDPKNPFALLF+LP+ L
Sbjct: 627 NIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675

 Score =  278 bits (710), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 204/336 (60%), Gaps = 70/336 (20%)

Query: 877  FEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSW---- 932
            FE+ S  N D+   P LS++ENES+F Y GYKR + D S +D+ GE +STSLYTS     
Sbjct: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDT 1209

Query: 933  --GNETSKNEIPQSEPTQQQTANEA----------------------DLFI---EGINTS 965
              G+ ++ N I  +     ++ N++                      +LF+   E  N  
Sbjct: 1210 INGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269

Query: 966  LTE--FNID-------FPECKMNGKDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTT 1016
            L     NID       F +  +   DT+FVLDATSWLRHFAHVYKLA+N +L+FAICLTT
Sbjct: 1270 LDPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTT 1329

Query: 1017 FQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITW 1076
            FQELRFLRKSKDENV+EAATRA+IT+RQLY+E R+LPLRFTGN+ATHIEEHLEFEEQITW
Sbjct: 1330 FQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITW 1389

Query: 1077 RSHVDEFVFEAIKKAQ-ARLSQENRDFHHV-------------------------VLVTD 1110
            RSHVDEFV EAIK+AQ  R    N++  +V                         VLVTD
Sbjct: 1390 RSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVLVTD 1449

Query: 1111 DANMRRKAQQHA----IHTLSTRFVFATCNAVGNRL 1142
            D +M +K Q+      I T ST+FVF+ CN + N+ 
Sbjct: 1450 DISMIKKRQEEKSDNDIITFSTKFVFSLCNMLVNKF 1485

 Score =  267 bits (682), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 181/268 (67%), Gaps = 10/268 (3%)

Query: 597  DEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKK 656
            DE+E +D         Q FF+N++SL   +  P SLE+WN SLKY+NI SL+CS+IVLKK
Sbjct: 778  DEDEMLD-----NLSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKK 832

Query: 657  FLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLI 716
            FL GP+ V+LPH+LPW+YFII++  +++ + +  SR FWL+ + +IFPWN+IV++LNV+I
Sbjct: 833  FLNGPLFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVII 892

Query: 717  AYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNE-DLPEVWKCWGLLWFDAICDKDKV 775
            +  LDN + +  I  L    S   LD+L+  FN NE +LPEVWKC+G LWFD I +  ++
Sbjct: 893  SVLLDNCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQI 952

Query: 776  -QMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQ--TRL 832
               D  ++  +KD   L+ PIDG+ FD  +E+G  FWKR+CR+IFLFK +   F     L
Sbjct: 953  YSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGL 1012

Query: 833  VVSSQAQVHCRRTD-PMNHVLKSFCFKL 859
             +SS   V+C R+D P NH+L++F FKL
Sbjct: 1013 TISSNTSVYCNRSDIPNNHILRTFAFKL 1040

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  119 bits (299), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 107/513 (20%), Positives = 224/513 (43%), Gaps = 42/513 (8%)

Query: 631  SLEVWNCSLKYLNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGA 690
            SL  W   ++ ++ T LH + ++ KKFL   + ++ P +LPW  F I+V S+V ++TD  
Sbjct: 477  SLSNWKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRH 536

Query: 691  SREFWLELVNRIFPWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNN 750
                W +L+  + PW+ IV +LN  I     +   S  +  L + + +  L  L+ +   
Sbjct: 537  VLLLWKDLLQNLLPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMY 596

Query: 751  NEDLPEVWKCWGLLWFDAICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKF 810
              +  E+  C G +WFD++  K K    +   + +K   + +   D + +D DD+   K 
Sbjct: 597  ESNFQEISMCEGFIWFDSLASKIKQASITTNESLMKFKSY-NASEDSLIYDDDDQVYTKM 655

Query: 811  WKRACRVIFLFKRIAENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSVL 870
            W RA  +I L K +  ++   + VS + Q           +  S C K  D+  N     
Sbjct: 656  WTRALLIILLIKNVINDYPELIDVSIRGQ----------SLTNSSCIKNSDSLTND---- 701

Query: 871  QNTIEVFEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYT 930
                 +F+ G + N +  +    ++     IF +      + D   +D+ G+        
Sbjct: 702  ----YLFDWGFELNNNNAVIIDDTLHGRNRIFKF----SYIPDFQDFDKNGDI------- 746

Query: 931  SWGNETSKN--EIPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNG-----KDT 983
            +WG     N   I  ++   ++  N    F +  +  L   + D+ E K        ++ 
Sbjct: 747  TWGYSLISNYDYIYSNDFNSEEDGN----FFQRYSRRLLSAHNDYSEDKSKKYLPKLENN 802

Query: 984  FFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRK-SKDENVVEAATRAVITV 1042
            +F++D  +WL+H   + +  + + ++  + ++   +L  L+  S+ E+V  +A+R +I +
Sbjct: 803  YFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVI 862

Query: 1043 RQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQENRDF 1102
              LY  N+I  L+   +  +   ++++  + + +       +         +L+      
Sbjct: 863  NYLYAMNQINILKEFESPISKALKNIDGSQILNFNGKFKNDLLTKENGPGQQLNMIELRM 922

Query: 1103 HHVVLVTDDANMRRKAQQHAIHTLSTRFVFATC 1135
             +VV+V+DD       ++   + +ST+ +F+  
Sbjct: 923  DNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVA 955

>SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly
           similar to uniprot|P33420 Saccharomyces cerevisiae
           YPL174C NIP100 Large subunit of the dynactin complex
           which is involved in partitioning the mitotic spindle
           between mother and daughter cells putative ortholog of
           mammalian p150(glued)
          Length = 869

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 63/143 (44%), Gaps = 8/143 (5%)

Query: 763 LLWFDAICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFK 822
           LL  D +  K + +    E  G+K+ + L   I+     ++D   +  WKR+  V     
Sbjct: 156 LLGHDLLSLKKRHEAVVEELEGVKEELILRRVIEDEELKKEDVDPVTLWKRSKLVEHALV 215

Query: 823 RIAENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSVLQN-TIEVFEEGS 881
           ++  + +    V+   +      +  N  LKS  F+L +   ++  ++ + T ++  EGS
Sbjct: 216 KLQSSLEASRKVNKSLEGEKHEVEVENKKLKSEIFELTNQLDDAKKIITDLTSQLAAEGS 275

Query: 882 DAN-------KDMQMTPQLSVLE 897
             N       K++Q+T ++  L+
Sbjct: 276 YNNIVDMLTEKNIQLTEEIEELK 298

>AEL256C Chr5 complement(156109..161709) [5601 bp, 1866 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPL082C
            (MOT1)
          Length = 1866

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 332  LDVLKNFSNFMDPEVCAQFITHVFISISNMLADIPSRYAIPWYQRLGDLSRMAIA 386
            L VL+    +MDP +    + HVF  + ++L  + SRY++  Y     L+ +A+A
Sbjct: 1098 LGVLRALFTYMDPVI---HLEHVFTRLHDLLKYLTSRYSVVRYSAARTLAELAVA 1149

>TBLA0C05240 Chr3 (1267099..1268670) [1572 bp, 523 aa] {ON} Anc_8.93
           YPR002W
          Length = 523

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query: 403 YMEAMKYIYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRA 462
           YM A+  IYG     ++   + +N   A  NL   +FC +    SQ YM     +I    
Sbjct: 389 YMTAIPLIYGELTSNHYQDKIAEN--PAIDNLRSKMFCVEDKQFSQDYMDPEKRSIANAL 446

Query: 463 FVERNNGNHRNSQLIEY 479
            +E N+G   +  ++EY
Sbjct: 447 LIELNDGTTLDEIVVEY 463

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 118,354,199
Number of extensions: 5225254
Number of successful extensions: 15431
Number of sequences better than 10.0: 47
Number of HSP's gapped: 15680
Number of HSP's successfully gapped: 80
Length of query: 1147
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1026
Effective length of database: 39,606,813
Effective search space: 40636590138
Effective search space used: 40636590138
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)