Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B021305.707ON20820810981e-154
ZYRO0B16434g5.707ON2372071407e-10
TPHA0E001805.707ON165891159e-07
Smik_9.175.707ON2511101091e-05
TBLA0I016905.707ON320981046e-05
Skud_9.165.707ON226115957e-04
NDAI0F002705.707ON298113958e-04
Suva_9.365.707ON224103940.001
NCAS0G002105.707ON28885940.001
YIL152W5.707ON235102900.003
KLTH0E00946g5.707ON21586840.016
KAFR0D022005.707ON182123810.029
TBLA0E016004.35ON63982673.6
Kpol_1013.507.518ON2629112673.9
Kpol_1043.745.707ON17723644.9
KLLA0D09559g5.239ON58391665.1
Smik_1.63na 1ON64676665.3
YLL024C (SSA2)4.35ON63976655.5
YAL005C (SSA1)na 1ON64276655.9
NOTE: 5 genes in the same pillar as TDEL0B02130 were not hit in these BLAST results
LIST: Kwal_55.19675 KLLA0A00506g KNAG0L02160 Cgla_YGOB_Anc_5.707 SAKL0E15026g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02130
         (208 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.70...   427   e-154
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    59   7e-10
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    49   9e-07
Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)     47   1e-05
TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...    45   6e-05
Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)     41   7e-04
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    41   8e-04
Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)     41   0.001
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    41   0.001
YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...    39   0.003
KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved...    37   0.016
KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.70...    36   0.029
TBLA0E01600 Chr5 complement(379910..381829) [1920 bp, 639 aa] {O...    30   3.6  
Kpol_1013.50 s1013 complement(110643..118532) [7890 bp, 2629 aa]...    30   3.9  
Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {...    29   4.9  
KLLA0D09559g Chr4 complement(805863..807614) [1752 bp, 583 aa] {...    30   5.1  
Smik_1.63 Chr1 complement(122625..122997,123054..124621) [1941 b...    30   5.3  
YLL024C Chr12 complement(95566..97485) [1920 bp, 639 aa] {ON}  S...    30   5.5  
YAL005C Chr1 complement(139503..141431) [1929 bp, 642 aa] {ON}  ...    30   5.9  

>TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.707
           YIL152W
          Length = 208

 Score =  427 bits (1098), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%)

Query: 1   MPRRLNQTHPPYFGIDPIMGKRCNVLPDRSSRMPIGKLGSVVTKKRALRPTDVNVSAVFN 60
           MPRRLNQTHPPYFGIDPIMGKRCNVLPDRSSRMPIGKLGSVVTKKRALRPTDVNVSAVFN
Sbjct: 1   MPRRLNQTHPPYFGIDPIMGKRCNVLPDRSSRMPIGKLGSVVTKKRALRPTDVNVSAVFN 60

Query: 61  RSSTCKIPDTGLMKATALGGVLEEATTSRVARGRRVKPHLRRSRDQGLETSRDKSLSTAV 120
           RSSTCKIPDTGLMKATALGGVLEEATTSRVARGRRVKPHLRRSRDQGLETSRDKSLSTAV
Sbjct: 61  RSSTCKIPDTGLMKATALGGVLEEATTSRVARGRRVKPHLRRSRDQGLETSRDKSLSTAV 120

Query: 121 SVALSHLNTRIQVLSGELDQLMAFERLVLLSQHELLVVTQRKIFVLHSVIPLTREGVSRF 180
           SVALSHLNTRIQVLSGELDQLMAFERLVLLSQHELLVVTQRKIFVLHSVIPLTREGVSRF
Sbjct: 121 SVALSHLNTRIQVLSGELDQLMAFERLVLLSQHELLVVTQRKIFVLHSVIPLTREGVSRF 180

Query: 181 GALKLAVNSQCYYVLYNDVVWFMRWKFF 208
           GALKLAVNSQCYYVLYNDVVWFMRWKFF
Sbjct: 181 GALKLAVNSQCYYVLYNDVVWFMRWKFF 208

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 58.5 bits (140), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 93/207 (44%), Gaps = 24/207 (11%)

Query: 17  PIMGKRCNVLPDRSSRMPIGKLGSVVTKKRALRPTDVNVSAVFNRSSTCKIPDTGLMKAT 76
           P+  K  NV    +S     K+     K++ L   +     V ++ S    P   +++ +
Sbjct: 40  PLESKNVNV----TSLCGSKKIEHASFKRKPLSSINQKSYVVASQESNNAKPLDSILQNS 95

Query: 77  ALGGVLEEATTSRVARGRRVKPHL---RRSRD--QGLETSRDK---SLSTAVSVALSHLN 128
            +  + +  TT+ +ARG  ++      RR RD  +   +S DK   +L T +  AL+  N
Sbjct: 96  KVSKLSQPITTTNIARGEDIRDSYTLRRRIRDDNEKCASSADKKKTNLVTQLICALNDFN 155

Query: 129 TRIQV--LSGELDQLMAFERLVLLSQHELLVVT-----QRKIFVLHSVIPLTREGVSRFG 181
             ++    +   D L+     + LS  E++V++     +R I   H  IP      SR  
Sbjct: 156 LMVKTSQQNQNYDILVDIRHAIWLSPFEIMVISDDPRVKRAILHSHKAIPKFVNSPSR-- 213

Query: 182 ALKLAVNSQCYYVLYNDVVWFMRWKFF 208
              LA+ S+C   LYND+ W+++WKF 
Sbjct: 214 ---LAICSKCCLTLYNDMNWYLKWKFL 237

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 122 VALSHLNTRIQVLSGELDQLMAFERLVLLSQHELLVVT-QRKIFVLHSVIP-LTREGVSR 179
           ++++  N  ++  S + D++     +  LSQ+E +V T   K  +LHS    +       
Sbjct: 64  LSINKFNMLLKASSNKYDEIHDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVVNSNNYT 123

Query: 180 FGALKLAVNSQCYYVLYNDVVWFMRWKFF 208
               ++A+NS+ Y  LYND+ W++ WKF+
Sbjct: 124 LKYQQVAINSKYYLSLYNDLNWYLDWKFY 152

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 9/110 (8%)

Query: 106 QGLETSRDKSLSTAVSVALSHLNTRIQVLSGELDQLMA-FERLVLLSQHELLV-VTQRKI 163
           QG  +S D  L + +  ++  L+  IQ    + D ++    R  +LS +ELL+ +   + 
Sbjct: 144 QGFYSS-DSKLVSQLHSSVKDLDAIIQTHKPKFDTIIHDLSRTTILSSNELLIKLPMEET 202

Query: 164 FVLHSVIPLTRE-----GVSRFGALKLAVNSQCYYVLYNDVVWFMRWKFF 208
            +LHS  P   E      VS  GA  L ++S+ + +L N++ W++ WKF 
Sbjct: 203 IILHSRTPTINEEWLHNKVSNPGA-SLVIDSRSFLILCNNIKWYLHWKFI 251

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 47/98 (47%), Gaps = 9/98 (9%)

Query: 116 LSTAVSVALSHLNTRIQVLSG-ELDQLMAFERLVLLSQHELLVVTQ-RKIFVLHSVIPLT 173
           L   +   LS+LNTRI      + D++    +L  LS  ELLV+T      +LHS   + 
Sbjct: 225 LVNGLHTILSNLNTRIHSSRNLKFDKIFQISKLTKLSDTELLVITNTNSSLLLHSDSTI- 283

Query: 174 REGVSRFGAL----KLAVNSQCYYVLYNDVVWFMRWKF 207
             G S F       K+A NS     +  D+ W+++WKF
Sbjct: 284 --GQSEFNNYTLKEKVATNSISILKITEDLNWYLKWKF 319

>Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)
          Length = 226

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 53/115 (46%), Gaps = 7/115 (6%)

Query: 101 RRSRDQGLETSR-DKSLSTAVSVALSHLNTRIQVLSGELDQLMA-FERLVLLSQHELLV- 157
           R+   Q L   R D  L + +  ++  L+T +Q      D ++       +LS +ELL+ 
Sbjct: 112 RKQEKQSLTFYRTDSKLVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIK 171

Query: 158 VTQRKIFVLHSVIPLTR----EGVSRFGALKLAVNSQCYYVLYNDVVWFMRWKFF 208
           +      +LHS IP          +   +  L ++S+ + +L N++ W++ WKF 
Sbjct: 172 LPMNDTIILHSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 53/113 (46%), Gaps = 11/113 (9%)

Query: 106 QGLETSRDKSLSTAVSVALSHLNTRIQVLS-GELDQLMAFERLVLLSQHELLV------- 157
           Q LE ++  +L  ++  +L  L+T ++ LS    D L+      +LS HE+ +       
Sbjct: 185 QDLEQNKPSALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEMLSDHEIKINSVKNYT 244

Query: 158 --VTQRKIFVLHSVIPLTREGVSRFGA-LKLAVNSQCYYVLYNDVVWFMRWKF 207
              T     +LHS I L     +      KLA++S+ Y  L  +V W++ WKF
Sbjct: 245 AGFTTDVTMLLHSKISLNVPLPNNLHKDYKLALDSKVYLELAPNVKWYLVWKF 297

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 51/103 (49%), Gaps = 8/103 (7%)

Query: 113 DKSLSTAVSVALSHLNTRIQVLSGELDQLMA-FERLVLLSQHELLV-VTQRKIFVLHSVI 170
           D  L + +  ++  L+T +Q      D ++       +LS +ELL+ +      +LHS  
Sbjct: 123 DSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLHTEDTIILHSRT 182

Query: 171 PLT-----REGVSRFGALKLAVNSQCYYVLYNDVVWFMRWKFF 208
           P+      R  VS  GA  L ++S+ + +L +++ W++ WKF 
Sbjct: 183 PIINAEWLRNKVSNAGA-SLVIDSRSFLILCSNIKWYLHWKFI 224

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 15/85 (17%)

Query: 139 DQLMAFERLVLLSQHELLVVTQR--KIFVLHSVIPLTREGVSRF-------------GAL 183
           D +     +  LS  EL V TQ   ++ +LH+   +    + +F              +L
Sbjct: 201 DSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSINNIPILKFIHDVSINTKIQVTESL 260

Query: 184 KLAVNSQCYYVLYNDVVWFMRWKFF 208
           KLA+NS+ +  + +D+ W++ WKF 
Sbjct: 261 KLAINSKSFIKVSDDINWYIDWKFI 285

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 52/102 (50%), Gaps = 6/102 (5%)

Query: 113 DKSLSTAVSVALSHLNTRIQVLSGELDQLM-AFERLVLLSQHELLV-VTQRKIFVLHSVI 170
           D  L + +  ++  L+  IQ    + D ++  F +  +LS +ELL+ + + +  +LHS  
Sbjct: 134 DSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIKLPKDQTIILHSRA 193

Query: 171 P-LTREGVSR---FGALKLAVNSQCYYVLYNDVVWFMRWKFF 208
           P +  E +       +  L ++S+ +  L N++ W++ WKF 
Sbjct: 194 PKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235

>KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved
           hypothetical protein
          Length = 215

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 9/86 (10%)

Query: 128 NTRIQ---VLSGELDQLMAFERLVLLSQHELLVVTQ----RKIFVLHSVIPLTREGVSRF 180
           N R+Q   + + E D+ +  +   LLS  ELL V      R++ +LH ++P T++   + 
Sbjct: 130 NRRLQRHGLSTHEYDRKLHVQYTKLLSPTELLAVAAGPLGREVLILH-MLPSTKDAEPKS 188

Query: 181 GALKLAVNSQCYYVLYNDVVWFMRWK 206
           G+ +L ++S    +LY  + W+  W+
Sbjct: 189 GS-QLLLSSNASALLYPGLRWYFEWR 213

>KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.707
           YIL152W
          Length = 182

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 9/123 (7%)

Query: 91  ARGRRVKPHLRRSRDQGLETSRDKSLSTAVSVALSHLNTRIQVLSG--ELDQLMAFERLV 148
           AR    +PHL        E ++  SL+ ++  +L  LN  + V     + D L+      
Sbjct: 63  ARHWNERPHLNLLD----ECNKPVSLAISLQKSLWDLNALVTVSKNNKKYDLLIKVASAR 118

Query: 149 LLSQHELLVV--TQRKI-FVLHSVIPLTREGVSRFGALKLAVNSQCYYVLYNDVVWFMRW 205
            LS  E+L++  T   + ++LH  +      V  F    LA+NS+  + L + ++W + W
Sbjct: 119 RLSSTEMLIIPSTDEAMRYILHKPLTFRTNSVDNFTGAHLALNSKISFRLDDTLIWCLNW 178

Query: 206 KFF 208
           K  
Sbjct: 179 KLL 181

>TBLA0E01600 Chr5 complement(379910..381829) [1920 bp, 639 aa] {ON}
           Anc_4.35 YLL024C
          Length = 639

 Score = 30.4 bits (67), Expect = 3.6,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 34/82 (41%), Gaps = 2/82 (2%)

Query: 20  GKRCNVLPDRSSRMPIGKLGSVVTKKRALRPTD--VNVSAVFNRSSTCKIPDTGLMKATA 77
           G++    P++ S M +GK+          +  D  V V A FN S      D G +    
Sbjct: 107 GEKKTFTPEQISSMVLGKMKETAESYLGCKVNDAVVTVPAYFNDSQRQATKDAGTIAGLN 166

Query: 78  LGGVLEEATTSRVARGRRVKPH 99
           +  ++ E T + +A G   K H
Sbjct: 167 VLRIINEPTAAAIAYGLDKKGH 188

>Kpol_1013.50 s1013 complement(110643..118532) [7890 bp, 2629 aa] {ON}
            complement(110643..118532) [7890 nt, 2630 aa]
          Length = 2629

 Score = 30.4 bits (67), Expect = 3.9,   Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 55/112 (49%), Gaps = 10/112 (8%)

Query: 102  RSRDQGLETSRDKSLSTAVSVALSHLNTRIQVLSGELDQLMAFERLV-------LLSQHE 154
            ++R +    S D    T +  +   L++++++L+   ++L+  E+L+       L + H 
Sbjct: 2234 KNRAEKFAISYDFDDLTRLYQSAEKLSSQVRILNIVENELLFREKLLDDAGQVDLFNVHN 2293

Query: 155  LLVVTQRKIFVLHSVIPLTR---EGVSRFGALKLAVNSQCYYVLYNDVVWFM 203
              + T  K++VL SV+   R   EG S+     + +N    ++L ND+  F+
Sbjct: 2294 EKINTLSKLYVLMSVLCSKRKEKEGASKMMVWNIKINKVILHMLNNDMSPFL 2345

>Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {ON}
           complement(158958..159491) [534 nt, 178 aa]
          Length = 177

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 184 KLAVNSQCYYVLYNDVVWFMRWK 206
           K+A+NS  +  LY +V W++ W+
Sbjct: 153 KIAINSNSFVHLYGNVNWYLHWR 175

>KLLA0D09559g Chr4 complement(805863..807614) [1752 bp, 583 aa] {ON}
           similar to uniprot|P16474 Saccharomyces cerevisiae
           YJL034W KAR2 ATPase involved in protein import into the
           ER also acts as a chaperone to mediate protein folding
           in the ER and may play a role in ER export of soluble
           proteins regulates the unfolded protein response via
           interaction with Ire1p
          Length = 583

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 3/91 (3%)

Query: 5   LNQTHPPYFGIDPIMGKRCNVLPDRSSRMPIGKLGSVVTKKRALRPTD--VNVSAVFNRS 62
           +N+ + PY  +  + G++    P+  S M +GK+  +       + T   V V A FN +
Sbjct: 142 VNKGNKPYVEV-TVKGEKKEFTPEEVSGMILGKMKQIAEDYLGKKVTHAVVTVPAYFNDA 200

Query: 63  STCKIPDTGLMKATALGGVLEEATTSRVARG 93
                 D G +    +  ++ E T + +A G
Sbjct: 201 QRQATKDAGAIAGLNILRIVNEPTAAAIAYG 231

>Smik_1.63 Chr1 complement(122625..122997,123054..124621) [1941 bp,
           646 aa] {ON} YAL005C (REAL)
          Length = 646

 Score = 30.0 bits (66), Expect = 5.3,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 2/76 (2%)

Query: 20  GKRCNVLPDRSSRMPIGKLGSVVTKKRALRPTD--VNVSAVFNRSSTCKIPDTGLMKATA 77
           G+  N  P++ S M +GK+          +  D  V V A FN S      D G +    
Sbjct: 107 GETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLN 166

Query: 78  LGGVLEEATTSRVARG 93
           +  ++ E T + +A G
Sbjct: 167 VLRIINEPTAAAIAYG 182

>YLL024C Chr12 complement(95566..97485) [1920 bp, 639 aa] {ON}
           SSA2ATP binding protein involved in protein folding and
           vacuolar import of proteins; member of heat shock
           protein 70 (HSP70) family; associated with the
           chaperonin-containing T-complex; present in the
           cytoplasm, vacuolar membrane and cell wall; 98%
           identical with Ssa1p, but subtle differences between the
           two proteins provide functional specificity with respect
           to propagation of yeast [URE3] prions and
           vacuolar-mediated degradations of gluconeogenesis
           enzymes
          Length = 639

 Score = 29.6 bits (65), Expect = 5.5,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 2/76 (2%)

Query: 20  GKRCNVLPDRSSRMPIGKLGSVVTKKRALRPTD--VNVSAVFNRSSTCKIPDTGLMKATA 77
           G+  N  P++ S M +GK+          +  D  V V A FN S      D G +    
Sbjct: 107 GETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLN 166

Query: 78  LGGVLEEATTSRVARG 93
           +  ++ E T + +A G
Sbjct: 167 VLRIINEPTAAAIAYG 182

>YAL005C Chr1 complement(139503..141431) [1929 bp, 642 aa] {ON}
           SSA1ATPase involved in protein folding and nuclear
           localization signal (NLS)-directed nuclear transport;
           member of heat shock protein 70 (HSP70) family; forms a
           chaperone complex with Ydj1p; localized to the nucleus,
           cytoplasm, and cell wall; 98% identical with Ssa2p, but
           subtle differences between the two proteins provide
           functional specificity with respect to propagation of
           yeast [URE3] prions and vacuolar-mediated degradations
           of gluconeogenesis enzymes
          Length = 642

 Score = 29.6 bits (65), Expect = 5.9,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 2/76 (2%)

Query: 20  GKRCNVLPDRSSRMPIGKLGSVVTKKRALRPTD--VNVSAVFNRSSTCKIPDTGLMKATA 77
           G+  N  P++ S M +GK+          +  D  V V A FN S      D G +    
Sbjct: 107 GETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLN 166

Query: 78  LGGVLEEATTSRVARG 93
           +  ++ E T + +A G
Sbjct: 167 VLRIINEPTAAAIAYG 182

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,881,509
Number of extensions: 649013
Number of successful extensions: 2178
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2239
Number of HSP's successfully gapped: 24
Length of query: 208
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 103
Effective length of database: 41,441,469
Effective search space: 4268471307
Effective search space used: 4268471307
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 63 (28.9 bits)