Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B021205.708ON54854829710.0
YKR097W (PCK1)5.708ON54954726340.0
Smik_11.3615.708ON54954726150.0
Skud_11.3375.708ON54954726080.0
SAKL0E15048g5.708ON54254826050.0
KNAG0C066405.708ON54754426010.0
Suva_11.3345.708ON54854725930.0
NCAS0A031605.708ON55255225810.0
NDAI0E050805.708ON55155125780.0
ZYRO0B16456g5.708ON54854725670.0
KLLA0A00484g5.708ON54354925420.0
KAFR0H001605.708ON54954924920.0
CAGL0H06633g5.708ON54454224820.0
Ecym_40135.708ON54254824800.0
AFR292W5.708ON54154824740.0
KLTH0E00902g5.708ON54454624490.0
Kwal_55.196635.708ON54454624090.0
TBLA0E017005.708ON57655123190.0
TPHA0E001705.708ON57853122860.0
Kpol_1043.755.708ON55852322600.0
Suva_7.275singletonON961131652e-13
NDAI0A005601.67ON71469840.13
SAKL0B05126g8.762ON706119780.80
ZYRO0F18722gsingletonON69968761.4
Skud_15.933.168ON71828715.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02120
         (548 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...  1149   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...  1019   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...  1011   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...  1009   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...  1008   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...  1006   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...  1003   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   998   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   997   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   993   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   983   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   964   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   960   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   959   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   957   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   947   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   932   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   897   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   885   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   875   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    68   2e-13
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...    37   0.13 
SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} simila...    35   0.80 
ZYRO0F18722g Chr6 (1551987..1554086) [2100 bp, 699 aa] {ON} some...    34   1.4  
Skud_15.93 Chr15 complement(173073..175229) [2157 bp, 718 aa] {O...    32   5.2  

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score = 1149 bits (2971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/548 (100%), Positives = 548/548 (100%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60
           MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL
Sbjct: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60

Query: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120
           IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI
Sbjct: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120

Query: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180
           VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY
Sbjct: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180

Query: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300
           QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP
Sbjct: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300

Query: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360
           EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL
Sbjct: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360

Query: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420
           VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420

Query: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480
           PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY
Sbjct: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480

Query: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540
           ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE
Sbjct: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540

Query: 541 VLAAGPQV 548
           VLAAGPQV
Sbjct: 541 VLAAGPQV 548

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/547 (86%), Positives = 511/547 (93%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60
           MSPSKMN +V   SEVEQKIR EL+LS+EV TIRRNAPAA+LYED L E KT I+SSGAL
Sbjct: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60

Query: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120
           IAYSG KTGRSPKDKRI+EE TSKD IWWGPVNKP  E+TWSINRERAADYLRTR H+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180
           VDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELAHFGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HTQ MSSK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300
           Q  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI L+AEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360
           EI++AIKFGS+LENV+YD K+  VDY+DSSITENTRCAYPI++IPSAKIPCLADSHP+N+
Sbjct: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420
           +LLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480
           PIRYATMLA KMS+H+ANA+LINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLA E+Y
Sbjct: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540
           ETLP FNL +PTKVNGVP ELLNP+KNW +GE+KY  AV NLA LFV+NFKIYQDRATP+
Sbjct: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540

Query: 541 VLAAGPQ 547
           VLAAGPQ
Sbjct: 541 VLAAGPQ 547

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1011 bits (2615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/547 (86%), Positives = 509/547 (93%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60
           MSPSKMN +V   SEVEQKIR EL+LS+EV TIRRNAPAA+LYED L EKKT I+SSGAL
Sbjct: 1   MSPSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120
           IAYSG KTGRSPKDKRI+EE TSKD IWWGPVNKP  E+TWSINRERAADYLRTR H+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180
           VDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELAHFGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HTQ MSSK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300
           Q  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI L+AEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360
           EI++AIKFG++LENV YD K+  VDY+DSSITENTRCAYPI++IPSAKIPCLADSHP+N+
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420
           +LLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480
           PIRYATMLA KMS+H+ANA+LINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLA E+Y
Sbjct: 421 PIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540
           E+LP FNL +PTKV GVP ELLNP+KNW +GE KY  AV +LA LFVENFKIYQDRATP+
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPD 540

Query: 541 VLAAGPQ 547
           VLAAGPQ
Sbjct: 541 VLAAGPQ 547

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1009 bits (2608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/547 (85%), Positives = 508/547 (92%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60
           MSPSKM+ +    SEVEQKIR EL+LS+EV TIRRNAPAA+LYED L EKKT I+SSGAL
Sbjct: 1   MSPSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120
           IAYSG KTGRSPKDKRI+EE TSKD IWWGPVNKP  E+TWSINRERAADYLRTR H+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180
           VDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELAHFGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HTQ MSSK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300
           Q  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI L+AEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360
           EI++AIKFG++LENV YD K+  VDY+DSSITENTRCAYPI++IPSAKIPCLADSHP+N+
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420
           +LLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480
           PIRYATMLA KMS H++NA+LINTGW+GSSYV+GGKRCPLKYTRAILD+IHDGSLA E+Y
Sbjct: 421 PIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540
           E+LP FNL +PTKV GVP ELLNP+KNW +GEAKY  +V NLA LFVENFKIYQDRATP+
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPD 540

Query: 541 VLAAGPQ 547
           VLAAGPQ
Sbjct: 541 VLAAGPQ 547

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/548 (85%), Positives = 512/548 (93%), Gaps = 6/548 (1%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60
           MSPSK   S       EQ+IR+EL LS+EV+TIRRNAPAA+LYEDAL E+KTTI+SSGAL
Sbjct: 1   MSPSKTYASA------EQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGAL 54

Query: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120
           IAYSG+KTGRSP+DKRI++E TS DN+WWGPVNK   E+TW INRERAADYLRTR HLYI
Sbjct: 55  IAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYI 114

Query: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180
           VDA+AGWDPRYRIKVRVVCARAYHALFMTNMLIRPT++ELA FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANT 174

Query: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HT GM+SKTTVEINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 175 HTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234

Query: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300
             NDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCIGL+AEKEP
Sbjct: 235 ADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEP 294

Query: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360
           EIYNAIKFGS+LENV+Y+P+TR+VDYEDSSITENTRCAYPI++IPSAKIPCLAD+HP N+
Sbjct: 295 EIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNI 354

Query: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420
           VLLTCDASGVLPP+S+LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH
Sbjct: 355 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414

Query: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480
           P++YATMLA+KM++H ANAWLINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLAKE Y
Sbjct: 415 PMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKY 474

Query: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540
           ETLPTFNL IPT+VN VP ELLNP+KNW+EGEAKY +AV NLA+LFVENFK YQDRAT +
Sbjct: 475 ETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQ 534

Query: 541 VLAAGPQV 548
           VL+AGPQ+
Sbjct: 535 VLSAGPQL 542

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score = 1006 bits (2601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/544 (85%), Positives = 509/544 (93%)

Query: 3   PSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGALIA 62
           PSK N + TD   VEQKIR EL+LS EVITIRRNAPAA+LYEDAL+E+KT IASSGALIA
Sbjct: 2   PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIA 61

Query: 63  YSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYIVD 122
           YSG+KTGRSPKDKRI+EEETSKDN+WWGPVNKP  E+TW INRERAADYLRTR HLYIVD
Sbjct: 62  YSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVD 121

Query: 123 AFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANYHT 182
           AFAGWDP+YRIKVRVVCARAYHALFMTNMLIRP+ EELA+FGEPDFTVWNAGQFPAN HT
Sbjct: 122 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHT 181

Query: 183 QGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQK 242
           Q MSSK+T+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI+ 
Sbjct: 182 QDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKN 241

Query: 243 NDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPEI 302
            DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI L+AEKEPEI
Sbjct: 242 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEI 301

Query: 303 YNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNLVL 362
           ++AI+FGS+LENV YD K+ +VDY+DS+ITENTRCAYPIE+IPSAKIPCLADSHP+N++L
Sbjct: 302 FDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIIL 361

Query: 363 LTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPI 422
           LTCDASGVLPP++KL+PEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHPI
Sbjct: 362 LTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 421

Query: 423 RYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESYET 482
           RYA MLA KMSEH+ANA+LINTGWTGSSYV+GGKRCPLKYTRAILDAIHDGSLA+ +YE+
Sbjct: 422 RYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYES 481

Query: 483 LPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPEVL 542
           LP FNL +PT VNGVP ELLNP+KNW +GEAKYN AV+NLA LFVENFKIYQD+ATP+VL
Sbjct: 482 LPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVL 541

Query: 543 AAGP 546
           AAGP
Sbjct: 542 AAGP 545

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/547 (85%), Positives = 505/547 (92%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60
           MSPSKMN      S VEQKIR EL+LS+EV TIRRNAPAA+LYED L EKKT I+SSGAL
Sbjct: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120
           IAYSG KTGRSPKDKRI+EE TSKD IWWGPVNKP  E+TWSINRERAADYLRTR H+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180
           VDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELAHFGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HTQ MSSK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240

Query: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300
           +  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD+GVFNIEGGCYAKCI L+AEKEP
Sbjct: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360
           EI++AI+FG++LENV YD  +  VDY+DSSITENTRCAYPI++IPSAKIPCLADSHP+N+
Sbjct: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420
           +LLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480
           PIRYATMLA KMS+HRANA+LINTGWTGSSYV+GG RC LKYTRAILD+IHDGSLAK SY
Sbjct: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480

Query: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540
           E+LP FNL +PTKVNGVP ELLNP+KNW +GEAKY  AV NLA LFVENFKIYQDRATP+
Sbjct: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540

Query: 541 VLAAGPQ 547
           VLAAGPQ
Sbjct: 541 VLAAGPQ 547

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  998 bits (2581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/552 (84%), Positives = 510/552 (92%), Gaps = 4/552 (0%)

Query: 1   MSPSKMNRS----VTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIAS 56
           MSP K++ S    ++D   VEQ IR EL LS +V TIRRNAPAA+LYEDAL+E+KT IAS
Sbjct: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60

Query: 57  SGALIAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRT 116
           SGALIAYSG KTGRSP+DKRI+EEETSKDN+WWGPVNKP  EKTW+INRERAADYLRTR 
Sbjct: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120

Query: 117 HLYIVDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQF 176
           HLYIVDAFAGWDP+YRIKVRVVCARAYHA+FMTNMLIRPT EELA FGEPDFT+WNAGQF
Sbjct: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180

Query: 177 PANYHTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSA 236
           PAN +TQ MSSKTT+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSA
Sbjct: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240

Query: 237 NQGIQKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTA 296
           NQGIQ  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI L+A
Sbjct: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300

Query: 297 EKEPEIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSH 356
           EKEPEI+NAIK+GSILENV+YD  TR VDY+D+SITENTRCAYPIE+IPSAKIPCLADSH
Sbjct: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360

Query: 357 PQNLVLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPF 416
           P+N++LLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTE+GVTEPE+TFSSCFGQPF
Sbjct: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420

Query: 417 LALHPIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLA 476
           LALHPIRYATMLA+K+S H A+AWLINTGWTGSSYV GGKRCPLKYTRAILD+IHDGSLA
Sbjct: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480

Query: 477 KESYETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDR 536
           K+SYETLP FNL +PT VNGVPKE+LNP+KNW EGEAKY+TAV+ L  LFVENFK YQDR
Sbjct: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540

Query: 537 ATPEVLAAGPQV 548
           ATP+VLAAGPQ+
Sbjct: 541 ATPDVLAAGPQI 552

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/551 (84%), Positives = 508/551 (92%), Gaps = 3/551 (0%)

Query: 1   MSPSKMNRSV---TDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASS 57
           MSP K + +    TD ++VEQKIR EL LS +V TIRRNAPAAILYEDAL+E+ T I+S+
Sbjct: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60

Query: 58  GALIAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTH 117
           GAL+AYSG+KTGRSP+DKRI+EEETSKD+IWWGPVNKP  E+TWSINRERAADYLRTR H
Sbjct: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120

Query: 118 LYIVDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFP 177
           LYIVDAFAGWDP YRIKVRVVCARAYHALFMTNMLIRPT EELA FGEPDFTVWNAGQFP
Sbjct: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180

Query: 178 ANYHTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSAN 237
           AN+HTQ MSSKTT+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSAN
Sbjct: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240

Query: 238 QGIQKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAE 297
           QGI+  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI L+ E
Sbjct: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300

Query: 298 KEPEIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHP 357
           KEPEI+ AIK+GSILENV+YDPKTR V Y+DS++TENTRCAYPIE IPSAKIPCLAD+HP
Sbjct: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360

Query: 358 QNLVLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL 417
            N++LLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL
Sbjct: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420

Query: 418 ALHPIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAK 477
           ALHPIRYATMLAKK+S+H ANAWLINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLAK
Sbjct: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480

Query: 478 ESYETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRA 537
           + +ETLP FNL +PT VN VPKELLNP+KNW +GEAKYN AV+NLA LFVENFKIYQD+A
Sbjct: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540

Query: 538 TPEVLAAGPQV 548
           TPEVLAA P++
Sbjct: 541 TPEVLAAAPRI 551

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  993 bits (2567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/547 (84%), Positives = 500/547 (91%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60
           MSPSK+   +TD +EVE++IR EL+L +EV+TIR NAPAA LYED L EKKT + SSGAL
Sbjct: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60

Query: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120
            AYSG KTGRSPKDKRIIEEETSK+ +WWGPVNKP  EKTWSINRERAADYLRTR HLYI
Sbjct: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120

Query: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180
           +DA+AGWDPRYRIKVRV+CARAYHALFMTNMLIRP+ EELA+FGEPDFTVWNAGQFPAN 
Sbjct: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180

Query: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +T+GM+SKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300
           ++ DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI LTAEKEP
Sbjct: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300

Query: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360
           EIYNAIKFGS+LENVV+D   R+VDY D+SITENTRCAYPI++IPSAKIPCLAD HP N+
Sbjct: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360

Query: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420
           VLLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420

Query: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480
           P+RYATMLAKKM +H ANAWL+NTGWTGSSY AGGKRCPLKYTRAILD+IHDGSL+K  Y
Sbjct: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480

Query: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540
           ETLP FNLH P KVNGVP  LLNP+K+WVEG  KYN+AV  LA  F ENFKIYQD+ATP+
Sbjct: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540

Query: 541 VLAAGPQ 547
           VLAAGPQ
Sbjct: 541 VLAAGPQ 547

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  983 bits (2542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/549 (83%), Positives = 501/549 (91%), Gaps = 7/549 (1%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60
           MSP+K   S       E+ IR EL LS EV+TIRRNAPAA+LYEDAL E+ T I+++GAL
Sbjct: 1   MSPTKTQNSA------EENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGAL 54

Query: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120
           IAYSGDKTGRSP+DKRI+EEETSKDN+WWGPVNKP  E+TW INRERAADYLRTR H+YI
Sbjct: 55  IAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYI 114

Query: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180
           VDA+AGWDPRYRIKVRVVCARAYHALFMTNMLIRP+ EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANT 174

Query: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HT GM+SKTTVEINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 175 HTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234

Query: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300
           Q NDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKC+GL+AEKEP
Sbjct: 235 QDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEP 294

Query: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360
           EI+NAIKFGS+LEN++YDP TR+VDYEDS+ITENTRCAYPIE+IPSAKIPCLAD HP+N+
Sbjct: 295 EIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNI 354

Query: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420
           VLLTCDASGVLPP+SKLTP+QVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL+LH
Sbjct: 355 VLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLH 414

Query: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480
           P++YATMLA+KM+EH ANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKE Y
Sbjct: 415 PMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEY 474

Query: 481 ETLPTFNLHIPTKV-NGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATP 539
           E LP FNL IP  V + VP  LLNPSKNW EGEAKY + V +LA LFVENFK YQD+AT 
Sbjct: 475 EVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATE 534

Query: 540 EVLAAGPQV 548
           +VLAAGPQ+
Sbjct: 535 QVLAAGPQL 543

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/549 (81%), Positives = 502/549 (91%), Gaps = 1/549 (0%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDAL-NEKKTTIASSGA 59
           MSPSK+   + D++ VEQKIR EL LS+ V TIRRNAP ++LYEDAL +EK T I+S+GA
Sbjct: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60

Query: 60  LIAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLY 119
           LIAYSG+KTGR PKDKRI+EE  SK++IWWGPVNKP  E+TW INRERAADYLRTR H+Y
Sbjct: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120

Query: 120 IVDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPAN 179
           IVDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT +EL +FG+PDFTVWNAGQFPAN
Sbjct: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180

Query: 180 YHTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQG 239
           +HT+ MSSKTT+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSSAN+G
Sbjct: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240

Query: 240 IQKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKE 299
           I+K DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI L+ EKE
Sbjct: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300

Query: 300 PEIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQN 359
           PEI+N+IKFGSILENVVYDPK+R+VDY+DSSITENTRCAYPIE IPSAKIPC+A+SHP+N
Sbjct: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360

Query: 360 LVLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLAL 419
           ++LLTCDASGVLPP+SKLT +QVMYHFISGYTSKMAGTEQGVTEP+ TFSSCFGQPFLAL
Sbjct: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420

Query: 420 HPIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKES 479
           HP++YATMLA+KM +H+ANAWLINTGWTGSSY+AGGKRCPL YTRAILDAIHDGSL KES
Sbjct: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480

Query: 480 YETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATP 539
           +ETLP FNL +P  VN VP +LLNPSKNW EGE KY+ AV  L+KLF+ENFK Y+D+AT 
Sbjct: 481 FETLPIFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540

Query: 540 EVLAAGPQV 548
           EVLAAGP++
Sbjct: 541 EVLAAGPRL 549

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/542 (81%), Positives = 494/542 (91%)

Query: 7   NRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGALIAYSGD 66
           ++S    + VE++IR EL LS EV  IRRNAPAA+LY+DAL EKKT I+S+GALIAYSG+
Sbjct: 3   SKSSVSGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGE 62

Query: 67  KTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYIVDAFAG 126
           KTGRSPKDKRI+EEETS+DN+WWGPVNKP  E+TW+INRERAADYLRTR  LY+VDAFAG
Sbjct: 63  KTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAG 122

Query: 127 WDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANYHTQGMS 186
           WDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELA+FGEPDFTVWNAGQFPAN  TQ M+
Sbjct: 123 WDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMT 182

Query: 187 SKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQKNDVT 246
           SKTT+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSS NQGI+  DVT
Sbjct: 183 SKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVT 242

Query: 247 LFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPEIYNAI 306
           LFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEI++AI
Sbjct: 243 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAI 302

Query: 307 KFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNLVLLTCD 366
           +FGS+LENV+YD ++ +VDY+DSSITENTRCAYPI+ IPSAKIPCLA +HP+N++LLTCD
Sbjct: 303 RFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCD 362

Query: 367 ASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPIRYAT 426
           ASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHP+RYAT
Sbjct: 363 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYAT 422

Query: 427 MLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESYETLPTF 486
           MLA+KM EH ANAWLINTGWTGSSYV+GGKRC LKYTRAILDAIHDGSLAK  +E+LP F
Sbjct: 423 MLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIF 482

Query: 487 NLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPEVLAAGP 546
           NL +P  V GVP ELLNP++NW EGEAKY +AV+ LA LFVENFK YQD+AT +VLAAGP
Sbjct: 483 NLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGP 542

Query: 547 QV 548
           Q+
Sbjct: 543 QL 544

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/548 (81%), Positives = 497/548 (90%), Gaps = 6/548 (1%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60
           MSPSK+ +S       E+KIR EL LS+ V+ IRRNAPAA+LYEDAL E+ T I+S+GAL
Sbjct: 1   MSPSKVFQSP------EEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGAL 54

Query: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120
           IAYSG+KTGRSPKDKRI++E TS + +WWGPVN+ + E+TW INRERA DYLRTR HLYI
Sbjct: 55  IAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYI 114

Query: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180
           VDAFAGWDPRYRIK+R+VC RAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174

Query: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HT+GMSSKTTVEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQGI
Sbjct: 175 HTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGI 234

Query: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300
            K DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCIGL+AEKEP
Sbjct: 235 AKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEP 294

Query: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360
           EI+NAI++GS+LENVVY+P +R VDY+DSSITENTRCAYPIE+IPSAKIPCL++SHP N+
Sbjct: 295 EIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNI 354

Query: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420
           VLLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH
Sbjct: 355 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414

Query: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480
           P++YATMLA+KMS+H ANAWLINTGWTG+SYV+GGKRCPLKYTRAILDAIH GSLA   Y
Sbjct: 415 PMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADY 474

Query: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540
           ETLP F L IP  V GVP ELLNPS+NWVEGE KY+ AV +LA LFV+NFKIYQD+AT E
Sbjct: 475 ETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKE 534

Query: 541 VLAAGPQV 548
           VL AGPQ+
Sbjct: 535 VLYAGPQL 542

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/548 (81%), Positives = 498/548 (90%), Gaps = 7/548 (1%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60
           MSPSK+ ++       E+KIR EL LS+ V+TIRRNAPAA+LYEDAL E+KT I+S+GAL
Sbjct: 1   MSPSKVYQTP------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGAL 54

Query: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120
           IAYSG+KTGRSPKDKRI++E TS DNIWWGPVN+   EKTW INRERAAD+LRTR HLYI
Sbjct: 55  IAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYI 114

Query: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180
           VDA+AGWDPRYRIK+R+VC RAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174

Query: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HT+GMSSKTTVEINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQG 
Sbjct: 175 HTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG- 233

Query: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300
             NDVTLFFGLSGTGKTTLSAD HRKLIGDDEHCWSD+GVFNIEGGCYAKCIGL+ EKEP
Sbjct: 234 PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEP 293

Query: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360
           EI+NAIK+GS+LENVVYDP TR VDYEDSSITENTRCAYPIE+IPSA+IPCL+++HP N+
Sbjct: 294 EIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNI 353

Query: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420
           VLLTCDASGVLPP+S+LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH
Sbjct: 354 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 413

Query: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480
           P++YATMLA+KMS+H A+AWLINTGWTGSSY AGGKRCPLKYTRAILD+IHDG+LA+  Y
Sbjct: 414 PMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEY 473

Query: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540
           ETLP F L IP  V GVP ELLNP+KNWVEGE KY +AV+ LA  F ENFKIYQD+AT E
Sbjct: 474 ETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEE 533

Query: 541 VLAAGPQV 548
           V+ AGPQ+
Sbjct: 534 VVRAGPQI 541

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/546 (81%), Positives = 487/546 (89%), Gaps = 4/546 (0%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60
           MSP+K    V+     +  IR EL+L  EV+TIRRNAPAA+LYEDAL E KTTIASSGAL
Sbjct: 1   MSPTKTRNHVS----AKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGAL 56

Query: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120
           IA+SG KTGRSPKDKRI++E TS  NIWWGPVNK   EKTW +NRERAADYLRTR HLYI
Sbjct: 57  IAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYI 116

Query: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180
           VDA+AGWDPRYRIK+RVVCARAYHALFMTNMLIRPT EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANT 176

Query: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HT GM+SKTTVEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 177 HTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 236

Query: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300
           +  DVTLFFGLSGTGKTTLSADP RKLIGDDEHCWSDHGVFNIEGGCYAKCIGLT  KEP
Sbjct: 237 RDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296

Query: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360
           EI+NAIKFGS+LENV YDP TR VDYED  ITENTRCAYPIE+IPSAKIPCLA+SHP+N+
Sbjct: 297 EIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNI 356

Query: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420
           VLLTCDASGVLPP+SKLTP QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALH
Sbjct: 357 VLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416

Query: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480
           P++YATMLA+KMS+HRANAWLINTGWTG+S+V GG RCPLKYTRAILDA+HDGSLA+E +
Sbjct: 417 PLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDF 476

Query: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540
           ETLPTF LH+P  VN VP+ +LNP+KNW EGE KY   V  LAKLF ENFK YQDRA+ +
Sbjct: 477 ETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASAD 536

Query: 541 VLAAGP 546
           V++AGP
Sbjct: 537 VISAGP 542

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/546 (79%), Positives = 484/546 (88%), Gaps = 4/546 (0%)

Query: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60
           MSPSK+   V+    V+ +IR EL+L  EV+TIRRNAPAA+LYEDAL E KT I++SGAL
Sbjct: 1   MSPSKIRNLVS----VKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGAL 56

Query: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120
           IA+SG KTGRSPKDKRI++E TS  NIWWGPVNK   EKTW +NRERAAD+LRTR HLYI
Sbjct: 57  IAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYI 116

Query: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180
           VDA+AGWDPRYRIK+RVVCARAYHALFMTNMLI+PT +EL  FGEPDFTVWNAGQFPAN 
Sbjct: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANT 176

Query: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           HT GM+SKTT+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSSANQGI
Sbjct: 177 HTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGI 236

Query: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300
           + NDVTLFFGLSGTGKTTLSADP RKLIGDDEHCWSDHGVFNIEGGCYAKCIGLT  KEP
Sbjct: 237 RDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296

Query: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360
           EI+NAI+FGS+LENV YD  TR+VD+E+  ITENTRCAYPIE+IPSAKIPCLAD HP+N+
Sbjct: 297 EIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNI 356

Query: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420
           VLLTCDASGVLPP+SKLTPEQVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALH
Sbjct: 357 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416

Query: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480
           P++YATMLA KMS H+A+AWLINTGWTG S+V GG RCPLKYTRAILDAIHDG+LAKE Y
Sbjct: 417 PLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEY 476

Query: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540
           ETLPTFNLHIP  VN VP  +LNP+++WV GEAKY T V  LA LFVENFK Y+  A+ E
Sbjct: 477 ETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTE 536

Query: 541 VLAAGP 546
           ++ AGP
Sbjct: 537 IMCAGP 542

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/551 (76%), Positives = 476/551 (86%), Gaps = 4/551 (0%)

Query: 2   SPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGALI 61
           +PS   + ++   ++  ++  + S  + +I I+ N  AAILYEDAL E KT I+SSGALI
Sbjct: 26  NPSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALI 85

Query: 62  AYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYIV 121
           AYSG KTGRSPKDKRI+ E+ SKDN+WWGPVNKP  EKTW INRER  DYL TR++LY++
Sbjct: 86  AYSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVI 145

Query: 122 DAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANYH 181
           DA+ GWDPRYR+KVRVVCARAYHALFMTNMLIRPT+EEL +F EPDFTVWNAG F AN +
Sbjct: 146 DAYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSY 205

Query: 182 TQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQ 241
           T  M+SKT+VEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSAN+GI+
Sbjct: 206 TADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIE 265

Query: 242 KNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPE 301
           K DVT+FFGLSGTGKTTLSADP+R LIGDDEHCWSDHGVFNIEGGCYAKCIGLT EKEPE
Sbjct: 266 KKDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPE 325

Query: 302 IYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNLV 361
           I++AI+FGS+LENV Y+     VDY D +ITENTRCAYPI++I SAKIPCLA+SHP+NL+
Sbjct: 326 IFDAIRFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLI 385

Query: 362 LLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHP 421
           LLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHP
Sbjct: 386 LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHP 445

Query: 422 IRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESYE 481
           I YATMLAKKM ++++NAWLINTGWTGSSY AGG RCPLKYTRAILDAIHDG+LA E+YE
Sbjct: 446 ITYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYE 505

Query: 482 TLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAK----YNTAVNNLAKLFVENFKIYQDRA 537
           TLP FNL IPT VNGVP E+LNP  +W     K    YN AVN LA LFVENFKIYQD+A
Sbjct: 506 TLPVFNLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKA 565

Query: 538 TPEVLAAGPQV 548
           T +VLAAGPQV
Sbjct: 566 TDDVLAAGPQV 576

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/531 (76%), Positives = 461/531 (86%), Gaps = 1/531 (0%)

Query: 16  VEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGALIAYSGDKTGRSPKDK 75
           +E+ I D LS ++++I I+RN P A LYED L E KTT++S+GALIAYSG KTGRSPKDK
Sbjct: 47  LEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDK 105

Query: 76  RIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYIVDAFAGWDPRYRIKV 135
           RI+EEE SKDNIWWGPVNK   E+TW+INRERA DYL TR  LY++DAF GWDPRYRIK+
Sbjct: 106 RIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKI 165

Query: 136 RVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANYHTQGMSSKTTVEINF 195
           RVVCARAYHALFM NMLIRPT EEL +FG+PDFTVWNAGQF AN  T  MSSKT+VEINF
Sbjct: 166 RVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINF 225

Query: 196 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQKNDVTLFFGLSGTG 255
           K MEM ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQ     DVTLFFGLSGTG
Sbjct: 226 KEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTG 285

Query: 256 KTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPEIYNAIKFGSILENV 315
           KTTLSADPHR+LIGDDEHCWSD+GVFNIEGGCYAKCIGL+ EKEP+I+NAIKFGS+LEN 
Sbjct: 286 KTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENC 345

Query: 316 VYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNLVLLTCDASGVLPPIS 375
           +YD +T +VDY++S+ITENTRCAYPI++I +AKIPCLAD HP NL+LLTCDASGVLPP+S
Sbjct: 346 IYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVS 405

Query: 376 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPIRYATMLAKKMSEH 435
           KLTPEQVMYHFISGYTSKMAGTE GVTEP+ TFSSCFGQPFLALHP++YA+MLA+KM +H
Sbjct: 406 KLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKH 465

Query: 436 RANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESYETLPTFNLHIPTKVN 495
           +ANAWL+NTGWTGSSYV+GG RCPLKYTRAILDAIHDGSL  E YETLP FNL IP   N
Sbjct: 466 KANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNAN 525

Query: 496 GVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPEVLAAGP 546
           GVP ELLNP+ +W +    Y TAV  L KLF ENFK Y+D+AT EV+ AGP
Sbjct: 526 GVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/523 (77%), Positives = 452/523 (86%)

Query: 26  LSNEVITIRRNAPAAILYEDALNEKKTTIASSGALIAYSGDKTGRSPKDKRIIEEETSKD 85
           L N+ ITI+RN P A LYED L E  TT++S+GAL+AYSG KTGRSPKDKRI+EE +SKD
Sbjct: 36  LYNKDITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKD 95

Query: 86  NIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYIVDAFAGWDPRYRIKVRVVCARAYHA 145
           NIWWGPVNKP  E TWSINRERA DYL TR  LY++DA+AGWD  YRIK+RVVCAR YHA
Sbjct: 96  NIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHA 155

Query: 146 LFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANYHTQGMSSKTTVEINFKAMEMIILGT 205
           LFM NMLIRPT EEL +FGEPDFT+WNAG F AN  T+ M+SKT++EINFK+MEM+ILGT
Sbjct: 156 LFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGT 215

Query: 206 EYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQKNDVTLFFGLSGTGKTTLSADPHR 265
           EYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQG+   DVTLFFGLSGTGKTTLSADPHR
Sbjct: 216 EYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHR 275

Query: 266 KLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPEIYNAIKFGSILENVVYDPKTRDVD 325
           +LIGDDEHCWSDHGVFNIEGGCYAKCIGLT EKEPEI+NAIKFGS+LEN VYD  T  VD
Sbjct: 276 ELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVD 335

Query: 326 YEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNLVLLTCDASGVLPPISKLTPEQVMYH 385
           Y+DS ITENTRCAYPI+ I SAKIPCL D HP NL+LLTCDASGVLPP+SKLTPEQVMYH
Sbjct: 336 YDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYH 395

Query: 386 FISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPIRYATMLAKKMSEHRANAWLINTG 445
           FISGYTSKMAGTEQGVTEPE TFS+CFGQPFLALHP++YA MLA KM+ H+A+AWLINTG
Sbjct: 396 FISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTG 455

Query: 446 WTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESYETLPTFNLHIPTKVNGVPKELLNPS 505
           WTG+SY AGGKRCPLKYTRAILDAIH+GSLA E YETLP FNL IP  V  VP ELLNPS
Sbjct: 456 WTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPS 515

Query: 506 KNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPEVLAAGPQV 548
           K W + +  Y+ AV  L  LFV+NF IYQD+AT +V+AAGP +
Sbjct: 516 KTWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 68.2 bits (165), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 60/113 (53%), Gaps = 22/113 (19%)

Query: 377 LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPIRYATMLAKKMSEHR 436
           LT E+VMYHF SG+ S   G         +       +PFLALHPI Y T++A KM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 437 ANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKE-----SYETLP 484
            +A+LINTG+             LK TR   D+IHD SLAKE     +Y+ LP
Sbjct: 58  -SAYLINTGYA------------LK-TRVNFDSIHDDSLAKELFRAPTYKCLP 96

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 250 GLSGTGKTTLSADPHRKL-IGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPEIYNAIKF 308
           G SG+GK+T+++   R   + +      D+ + N     Y + IG T ++EP ++N    
Sbjct: 480 GFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIG-TVQQEPSLFN---- 534

Query: 309 GSILENVVY 317
           GSIL+N++Y
Sbjct: 535 GSILDNIIY 543

>SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} similar
           to uniprot|Q05670 Saccharomyces cerevisiae YMR232W FUS2
           Cytoplasmic protein localized to the shmoo tip required
           for the alignment of parental nuclei before nuclear
           fusion during mating
          Length = 706

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 52/119 (43%), Gaps = 15/119 (12%)

Query: 64  SGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWS-INRERAADYL---------R 113
           +  K GR  +DK II+++    N+ W   N+P  +KT+S ++  +  DY+         +
Sbjct: 100 NASKRGRDEEDKEIIQKKPPSLNLVWDAFNEPSQKKTYSPLDLHKFKDYMTLESPRIDPK 159

Query: 114 TRTHLYIVDAFAGWDPRYRIKVRV---VCARAYHA--LFMTNMLIRPTDEELAHFGEPD 167
               L  +      + +Y   + +   V  R  H    F   +L + ++EEL  FG  D
Sbjct: 160 LSNLLQTIQNLVETEEKYARVLEISNAVYRRELHENRKFKNKLLNKNSNEELLLFGNID 218

>ZYRO0F18722g Chr6 (1551987..1554086) [2100 bp, 699 aa] {ON} some
           similarities with uniprot|P32319 Saccharomyces
           cerevisiae YBL017C PEP1 Type I transmembrane sorting
           receptor for multiple vacuolar hydrolases cycles between
           the late-Golgi and prevacuolar endosome-like
           compartments
          Length = 699

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 331 ITENTRCAYPIEHIPSAKIPCLADSHP--QNLVLLTCDASGVLPPISKLTPEQVMYHFIS 388
           +TE+   ++    +P  +I C +D+HP   NL+LL CD+   L    + TP+   +    
Sbjct: 118 MTEDQGRSWKQLSLPQDEIDCFSDTHPFNTNLLLLHCDSR--LENNPETTPDSSSFQERI 175

Query: 389 GYTSKMAG 396
            Y S  AG
Sbjct: 176 AYASDDAG 183

>Skud_15.93 Chr15 complement(173073..175229) [2157 bp, 718 aa] {ON}
           YOL060C (REAL)
          Length = 718

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 494 VNGVPKELLNPSKNWVEGEAKYNTAVNN 521
           V GVPK ++ P+K+W E +++Y+   N+
Sbjct: 629 VKGVPKTIIGPAKDWDESKSEYDNGYND 656

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,094,638
Number of extensions: 2705345
Number of successful extensions: 7322
Number of sequences better than 10.0: 27
Number of HSP's gapped: 7462
Number of HSP's successfully gapped: 27
Length of query: 548
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 433
Effective length of database: 40,294,809
Effective search space: 17447652297
Effective search space used: 17447652297
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)